g.barbadense_cottongen_reftransV1_0092931, g.barbadense_cottongen_reftransV1_0092931 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092931
Unique Nameg.barbadense_cottongen_reftransV1_0092931
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2262
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Dt08chromosomeg.barbadense_cottongen_reftransV1_0092931:1..2262 .
Dt08:37952556..37955215 +
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: TIC32_ARATH (Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.859e-41
Identity = 94/183 (51.37%), Postives = 126/183 (68.85%), Query Frame = -1
Query: 1345 YLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRY 1893
            +  GS G SGF S+STAEEVT    D   +T I+TGA+SGIG ETARVL+ RG  +V+  RN  +  + K  IV + P +++ VM LDLSS+ SVR F SE +S  LP+N+LINNAG  A    +S+D IE+ FATN+LGHFLLTKLLL+TM  T++++   GRIVN+SS  H +   + +R+
Sbjct:    2 WFFGSKGASGFSSRSTAEEVTHGV-DGTGLTAIVTGASSGIGVETARVLSLRGVHVVMAVRNTDSGAKVKEDIVKQVPGAKLDVMELDLSSMQSVRKFASEYKSTGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKSTSRESKREGRIVNLSSEAHRFSYPEGVRF 183          

HSP 2 Score: 56.9954 bits (136), Expect = 2.567e-7
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = -2
Query: 1020 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTR 1169
            S Y + RAY  SKL NVLH  EL ++LK+   N+T N +HPG + T L R
Sbjct:  190 SSYSSMRAYGQSKLCNVLHANELTKQLKEDGVNITANSLHPGAIMTNLGR 239          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: TIC32_PEA (Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 3.012e-38
Identity = 91/177 (51.41%), Postives = 122/177 (68.93%), Query Frame = -1
Query: 1345 GVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRY 1875
            GVSGF   STAE+VT    D   +T I+TGA+SGIGAET RVLA RGA +++  RN+ AA++ K  I+ + P +++  + LDLSSL SV+ F SE  S   P+NILINNAG  A    +S+D IE+ FATN++GHFLLT LLL+TM KT +++   GRIVNV+S  H +   + IR+
Sbjct:    9 GVSGFSGSSTAEQVTHGI-DATGLTAIVTGASSGIGAETTRVLALRGAHVIMGVRNMVAAKDVKDTILKDIPSAKVDAIELDLSSLDSVKKFASEFNSSGRPLNILINNAGIMACPFKLSKDNIELQFATNHIGHFLLTNLLLDTMKKTTRESKKEGRIVNVASEAHRFAYPEGIRF 184          

HSP 2 Score: 55.8398 bits (133), Expect = 6.618e-7
Identity = 29/62 (46.77%), Postives = 36/62 (58.06%), Query Frame = -2
Query:  993 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTRERE---GLITGI 1169
            S Y+  RAY  SKLANVLH  +L + LK+   N+T N +HPG + T L R      GLI  I
Sbjct:  191 SSYNNWRAYGQSKLANVLHANQLTKHLKEDGVNITANSLHPGTIVTNLFRHNSAVNGLINVI 252          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: WWOX_CHICK (WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 1.416e-25
Identity = 67/163 (41.10%), Postives = 100/163 (61.35%), Query Frame = -1
Query: 1375 FGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIH 1863
            +   STA E+ +   DL    +IITGA SGIG ETA+  A  GA ++L  RN+    +A  RI+ E+ ++++  M LDL+SL SV+NF    +S N+P++IL+ NA  F     ++EDG+E TF  N+LGHF L +LL + + +++     P R+V VSS  H
Sbjct:  107 YDGNSTAMEILQG-RDLSGKVIIITGANSGIGFETAKSFALHGAYVILACRNMSRGNDAVQRILEEWHKAKVEAMTLDLASLRSVQNFAEAFKSKNMPLHILVCNAAIFGSSWCLTEDGLESTFQVNHLGHFYLVQLLEDILRRSS-----PARVVVVSSESH 263          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: WWOX_HUMAN (WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 9.693e-24
Identity = 62/163 (38.04%), Postives = 102/163 (62.58%), Query Frame = -1
Query: 1375 FGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIH 1863
            +   +TA E+ +   D     V++TGA SGIG ETA+  A  GA ++L  RN+  A EA +RI+ E+ ++++  M LDL+ L SV++F    ++ N+P+++L+ NA  FA   ++++DG+E TF  N+LGHF L +LL + + ++A     P R++ VSS  H
Sbjct:  107 YDGSTTAMEILQG-RDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSA-----PARVIVVSSESH 263          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: WWOX_MOUSE (WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 4.717e-23
Identity = 62/163 (38.04%), Postives = 101/163 (61.96%), Query Frame = -1
Query: 1375 FGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIH 1863
            +   +TA E+ +   D     V++TGA SGIG ETA+  A  GA ++L  RNL  A EA +RI+ E+ ++++  M LDL+ L SV++F    ++ N+ +++L+ NAG FA    +++DG+E TF  N+LGHF L +LL + + +++     P R++ VSS  H
Sbjct:  107 YDGSTTAMEILQG-RDFTGKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLDLAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSS-----PARVIVVSSESH 263          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: WWOX_PONAB (WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.854e-23
Identity = 58/148 (39.19%), Postives = 95/148 (64.19%), Query Frame = -1
Query: 1375 DLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIH 1818
            D     V++TGA SGIG ETA+  A  GA ++L  RN+  A EA +RI+ E+ ++++  + LDL+ L SV++F    ++ N+P+++L+ NA  FA   ++++DG+E TF  N+LGHF L +LL + + ++A     P R++ VSS  H
Sbjct:  121 DFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAVTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSA-----PARVIVVSSESH 263          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: RDH13_HUMAN (Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 9.821e-22
Identity = 66/153 (43.14%), Postives = 90/153 (58.82%), Query Frame = -1
Query: 1375 CPDLRSI---TVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIH 1824
            CP   +I   TVI+TGA +GIG +TA  LA+RG  ++L  R+++  E A   I  E     +    LDL+SL S+R F +++      V+ILINNAG     H  +EDG EM F  N+LGHFLLT LLL+ +  +A     P RI+N+SS  H
Sbjct:   30 CPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASA-----PSRIINLSSLAH 177          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: WWOX_DANRE (WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.205e-21
Identity = 61/148 (41.22%), Postives = 89/148 (60.14%), Query Frame = -1
Query: 1375 DLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIH 1818
            DL    +I+TGA SGIG ETAR  A  GA ++L  RN   A +A + I+ E+ ++ + V+ LDL+SL SVR F    ++  LP+++L+ NA   +    ++EDG E TF   +LGHFLL +LL + +  +A     P R+V VSS  H
Sbjct:  118 DLSDKVIIVTGANSGIGFETARSFALHGAHVILACRNQSRASKAASLIMGEWSKARVEVLPLDLASLRSVRQFAELFKATKLPLHVLVCNAAVCSQPWRLTEDGFESTFQICHLGHFLLVQLLQDVLRLSA-----PARVVVVSSESH 260          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: RDH13_MOUSE (Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.026e-21
Identity = 66/153 (43.14%), Postives = 88/153 (57.52%), Query Frame = -1
Query: 1375 CPDLRSI---TVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIH 1824
            CP   +I   TVI+TGA +GIG +TA  LAKRG  ++L  R+++  E A   I  E     +    LDL+SL S+R F  ++      V+IL+NNA      H  +EDG EM F  NYLGHFLLT LLL+ +  +A     P RI+N+SS  H
Sbjct:   30 CPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAKDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGFEMQFGVNYLGHFLLTNLLLDKLKASA-----PSRIINLSSLAH 177          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Match: RDH12_MOUSE (Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.056e-20
Identity = 61/142 (42.96%), Postives = 87/142 (61.27%), Query Frame = -1
Query: 1375 VIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIH 1800
            V+ITGA +GIG ETAR LA+RGAR+ +  R++   E A + I ++   S+++V  LDLS   S+R F     +    ++ILINNAG     ++ + DG E  F  N+LGHFLLT LLL  + ++A     P R+VN+SS  H
Sbjct:   42 VVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSKTTDGFETHFGVNHLGHFLLTYLLLERLKESA-----PARVVNLSSIAH 178          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A0D2R3N0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G131000 PE=4 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.848e-119
Identity = 197/198 (99.49%), Postives = 197/198 (99.49%), Query Frame = -1
Query: 1318 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSKR 1911
            MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSIT IITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSKR
Sbjct:    1 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITAIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSKR 198          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A0D2RYD4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G131000 PE=3 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 3.263e-119
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = -1
Query: 1321 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 1911
            MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSIT IITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK
Sbjct:    1 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITAIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 197          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A0D2R3M8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G131000 PE=3 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 2.140e-118
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = -1
Query: 1321 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 1911
            MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSIT IITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK
Sbjct:    1 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITAIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 197          

HSP 2 Score: 119.783 bits (299), Expect = 4.522e-30
Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = -2
Query:  993 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITGI 1169
            SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLIT +
Sbjct:  198 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITDL 256          

HSP 3 Score: 41.2022 bits (95), Expect = 4.522e-30
Identity = 18/18 (100.00%), Postives = 18/18 (100.00%), Query Frame = -1
Query:  853 DLVFFLASKLLKTIPQVN 906
            DLVFFLASKLLKTIPQVN
Sbjct:  255 DLVFFLASKLLKTIPQVN 272          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A0D2MXG9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G131000 PE=3 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 3.934e-118
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = -1
Query: 1321 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 1911
            MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSIT IITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK
Sbjct:    1 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITAIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 197          

HSP 2 Score: 128.257 bits (321), Expect = 2.051e-29
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = -2
Query:  987 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITGIYI 1169
            SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITGIYI
Sbjct:  198 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITGIYI 258          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A0D2QWS7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G131000 PE=3 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 4.873e-118
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = -1
Query: 1321 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 1911
            MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSIT IITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK
Sbjct:    1 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITAIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 197          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A0D2MXG6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G131000 PE=3 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 1.131e-117
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = -1
Query: 1321 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 1911
            MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSIT IITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK
Sbjct:    1 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITAIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 197          

HSP 2 Score: 121.324 bits (303), Expect = 1.163e-26
Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = -2
Query:  996 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITG 1169
            SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITG
Sbjct:  198 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITG 255          

HSP 3 Score: 106.686 bits (265), Expect = 1.228e-21
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = -2
Query:  621 TGSCHDLLRRHASKTAKYKWEILCRLQRSMDIQTGVEFQRSCKALGCL 764
            TGSCHDLLRRHASKTAKYKWEILCRLQRSMDIQTGVEFQRSCKALGCL
Sbjct:  254 TGSCHDLLRRHASKTAKYKWEILCRLQRSMDIQTGVEFQRSCKALGCL 301          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A0D2PB19_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G131000 PE=3 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 3.780e-117
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = -1
Query: 1321 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 1911
            MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSIT IITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK
Sbjct:    1 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITAIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 197          

HSP 2 Score: 154.836 bits (390), Expect = 9.092e-69
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = -3
Query:  551 QAAATTCYVATHPRLLNISGKYFADCNEAWTSKLGSNSNEAAKLWAASEIMVSKHAKAVFDPLSAFDYHHM 763
            QAAATTCYVATHPRLLNISGKYFADCNEAWTSKLGSNSNEAAKLWAASEIMVSKHAKAVFDPLSAFDYHHM
Sbjct:  270 QAAATTCYVATHPRLLNISGKYFADCNEAWTSKLGSNSNEAAKLWAASEIMVSKHAKAVFDPLSAFDYHHM 340          

HSP 3 Score: 119.783 bits (299), Expect = 9.092e-69
Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = -2
Query:  993 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITGI 1169
            SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLIT +
Sbjct:  198 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITDL 256          

HSP 4 Score: 37.3502 bits (85), Expect = 9.092e-69
Identity = 16/16 (100.00%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  859 DLVFFLASKLLKTIPQ 906
            DLVFFLASKLLKTIPQ
Sbjct:  255 DLVFFLASKLLKTIPQ 270          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A0B0P8L4_GOSAR (Short-chain dehydrogenase TIC 32, chloroplastic-like protein OS=Gossypium arboreum GN=F383_02458 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 1.632e-116
Identity = 195/197 (98.98%), Postives = 195/197 (98.98%), Query Frame = -1
Query: 1321 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 1911
            MLETLKYLIGSTGVSGFGSKSTAEE TETCPDLRSIT IITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK
Sbjct:    1 MLETLKYLIGSTGVSGFGSKSTAEEATETCPDLRSITAIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFLLTKLLLNTMMKTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 197          

HSP 2 Score: 151.754 bits (382), Expect = 7.839e-68
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = -3
Query:  551 QAAATTCYVATHPRLLNISGKYFADCNEAWTSKLGSNSNEAAKLWAASEIMVSKHAKAVFDPLSAFDYHHM 763
            QAAATTCYVA HPRLLNISGKYFADCNEAWTSKLGSNSNE+AKLWAASEIMVSKHAKAVFDPLSAFDYHHM
Sbjct:  270 QAAATTCYVAAHPRLLNISGKYFADCNEAWTSKLGSNSNESAKLWAASEIMVSKHAKAVFDPLSAFDYHHM 340          

HSP 3 Score: 119.783 bits (299), Expect = 7.839e-68
Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = -2
Query:  993 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITGI 1169
            SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLIT +
Sbjct:  198 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITDL 256          

HSP 4 Score: 37.3502 bits (85), Expect = 7.839e-68
Identity = 16/16 (100.00%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  859 DLVFFLASKLLKTIPQ 906
            DLVFFLASKLLKTIPQ
Sbjct:  255 DLVFFLASKLLKTIPQ 270          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A061G5K7_THECC (NAD(P)-binding Rossmann-fold superfamily protein OS=Theobroma cacao GN=TCM_016543 PE=3 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 2.348e-103
Identity = 172/197 (87.31%), Postives = 189/197 (95.94%), Query Frame = -1
Query: 1321 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 1911
            MLET+KYL GSTG SGFGSKSTAE+VTETCPDLRSIT IITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFP+++I+VMALDLSSL+SVR FVSE +SL+LP+N+LINNAGKFAHEH ISEDGIEMTFATNYLGHFLLTKLLLN M+KTAK++GV GRIVNVSSSIHGWFSGD+IR++GQISRSK
Sbjct:    1 MLETVKYLFGSTGASGFGSKSTAEQVTETCPDLRSITAIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPDAKIVVMALDLSSLSSVRKFVSEFQSLSLPLNVLINNAGKFAHEHGISEDGIEMTFATNYLGHFLLTKLLLNKMIKTAKESGVQGRIVNVSSSIHGWFSGDVIRHLGQISRSK 197          

HSP 2 Score: 127.872 bits (320), Expect = 6.475e-60
Identity = 58/71 (81.69%), Postives = 62/71 (87.32%), Query Frame = -3
Query:  551 QAAATTCYVATHPRLLNISGKYFADCNEAWTSKLGSNSNEAAKLWAASEIMVSKHAKAVFDPLSAFDYHHM 763
            QAAATTCYVATHPRL+N+SGKYFADCNEA  SKLGSNSNEAA+LW ASEIMVS   KAVFDP + FDY HM
Sbjct:  270 QAAATTCYVATHPRLVNVSGKYFADCNEARPSKLGSNSNEAARLWTASEIMVSIDPKAVFDPRNGFDYDHM 340          

HSP 3 Score: 117.087 bits (292), Expect = 6.475e-60
Identity = 56/59 (94.92%), Postives = 57/59 (96.61%), Query Frame = -2
Query:  993 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITGI 1169
            S YDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLIT +
Sbjct:  198 SPYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITDL 256          

HSP 4 Score: 36.965 bits (84), Expect = 6.475e-60
Identity = 16/16 (100.00%), Postives = 16/16 (100.00%), Query Frame = -1
Query:  859 DLVFFLASKLLKTIPQ 906
            DLVFFLASKLLKTIPQ
Sbjct:  255 DLVFFLASKLLKTIPQ 270          
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Match: A0A0D2SCP5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G020400 PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.101e-101
Identity = 170/197 (86.29%), Postives = 184/197 (93.40%), Query Frame = -1
Query: 1321 MLETLKYLIGSTGVSGFGSKSTAEEVTETCPDLRSITVIITGATSGIGAETARVLAKRGARLVLPARNLKAAEEAKARIVSEFPESEIIVMALDLSSLTSVRNFVSELESLNLPVNILINNAGKFAHEHAISEDGIEMTFATNYLGHFXXXXXXXXXXXXTAKQTGVPGRIVNVSSSIHGWFSGDMIRYIGQISRSK 1911
            MLET+KYLIGS G SGFGSKSTAEEVTETCPDLR IT IITGATSGIGAETARVLAKRGARLV+PARNLKAA EAKARIVSEFP SEI++MALDLSSL+SVR FV + ESL+LP+N+L+NNAG+FAH HAISEDGIEMTFATNYLGHFLLTKLLLN MM+T KQTGV GRIVNVSSSI+GWFSGDMIRY+GQISRSK
Sbjct:    1 MLETVKYLIGSRGASGFGSKSTAEEVTETCPDLRFITAIITGATSGIGAETARVLAKRGARLVIPARNLKAAAEAKARIVSEFPNSEIVIMALDLSSLSSVRKFVLDFESLDLPLNLLVNNAGRFAHHHAISEDGIEMTFATNYLGHFLLTKLLLNKMMETTKQTGVQGRIVNVSSSINGWFSGDMIRYLGQISRSK 197          

HSP 2 Score: 113.62 bits (283), Expect = 8.363e-50
Identity = 53/59 (89.83%), Postives = 56/59 (94.92%), Query Frame = -2
Query:  993 SQYDATRAYALSKLANVLHTKELAQRLKQVDANVTVNCVHPGIVRTRLTREREGLITGI 1169
            SQYDATRAYALSKLANVLHTKELAQRLK++ ANVTVNCVHPGIVRTRLTREREG IT +
Sbjct:  198 SQYDATRAYALSKLANVLHTKELAQRLKEMGANVTVNCVHPGIVRTRLTREREGFITDL 256          

HSP 3 Score: 99.3673 bits (246), Expect = 8.363e-50
Identity = 45/54 (83.33%), Postives = 51/54 (94.44%), Query Frame = -3
Query:  602 QAAATTCYVATHPRLLNISGKYFADCNEAWTSKLGSNSNEAAKLWAASEIMVSK 763
            QAA+TTCYVAT+PRL N+SGKYFADCNE WTSKLGS+S EA+KLWAASEIMVS+
Sbjct:  270 QAASTTCYVATYPRLENVSGKYFADCNETWTSKLGSDSIEASKLWAASEIMVSE 323          

HSP 4 Score: 35.039 bits (79), Expect = 8.363e-50
Identity = 15/16 (93.75%), Postives = 15/16 (93.75%), Query Frame = -1
Query:  859 DLVFFLASKLLKTIPQ 906
            DLVFFLASKLLKT PQ
Sbjct:  255 DLVFFLASKLLKTTPQ 270          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
TIC32_ARATH6.859e-4151.37Short-chain dehydrogenase TIC 32, chloroplastic OS... [more]
TIC32_PEA3.012e-3851.41Short-chain dehydrogenase TIC 32, chloroplastic OS... [more]
WWOX_CHICK1.416e-2541.10WW domain-containing oxidoreductase OS=Gallus gall... [more]
WWOX_HUMAN9.693e-2438.04WW domain-containing oxidoreductase OS=Homo sapien... [more]
WWOX_MOUSE4.717e-2338.04WW domain-containing oxidoreductase OS=Mus musculu... [more]
WWOX_PONAB5.854e-2339.19WW domain-containing oxidoreductase OS=Pongo abeli... [more]
RDH13_HUMAN9.821e-2243.14Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 ... [more]
WWOX_DANRE1.205e-2141.22WW domain-containing oxidoreductase OS=Danio rerio... [more]
RDH13_MOUSE3.026e-2143.14Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 ... [more]
RDH12_MOUSE1.056e-2042.96Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 ... [more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092931 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2R3N0_GOSRA1.848e-11999.49Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RYD4_GOSRA3.263e-11999.49Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2R3M8_GOSRA2.140e-11899.49Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2MXG9_GOSRA3.934e-11899.49Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QWS7_GOSRA4.873e-11899.49Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2MXG6_GOSRA1.131e-11799.49Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PB19_GOSRA3.780e-11799.49Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0P8L4_GOSAR1.632e-11698.98Short-chain dehydrogenase TIC 32, chloroplastic-li... [more]
A0A061G5K7_THECC2.348e-10387.31NAD(P)-binding Rossmann-fold superfamily protein O... [more]
A0A0D2SCP5_GOSRA1.101e-10186.29Uncharacterized protein OS=Gossypium raimondii GN=... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 37..54
score: 43.09
coord: 113..124
score: 43.53
coord: 163..179
score: 28.87
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 37..177
e-value: 9.0E-29
score: 100.2
IPR016040NAD(P)-binding domainGENE3D3.40.50.720coord: 31..180
e-value: 1.4E-42
score: 145.2
IPR016040NAD(P)-binding domainSUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 31..185
NoneNo IPR availablePANTHERPTHR24320FAMILY NOT NAMEDcoord: 13..179
NoneNo IPR availablePANTHERPTHR24320:SF100SUBFAMILY NOT NAMEDcoord: 13..179

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092931 ID=g.barbadense_cottongen_reftransV1_0092931|Name=g.barbadense_cottongen_reftransV1_0092931|organism=Gossypium barbadense|type=contig|length=2262bp
GCCCACTTATTCTCTTCTCTCCCTTTCTTCATTTTTTTTATTGCATATTC
TTCCTAAAGAAACCCATGAACATGTACCTTATATCTATTAATATTCATCC
TGATTAGGGTTTCCAAGTACTTCCACGATTCCAAGCAAAACCCCATCAGC
TCATTAACATATATATCCATCCGCCATAATCATTTTACAATTATCACTGG
ATCCCTTTCTTTATAATCCGTCTTTAAAAAATTAGTATGGGGGTATTATA
GGGCAATATATATGCAAATTATATAATACCAGTACTAATAATAATGGATA
GAAACAGTTTTATAAGTACAAAACCCTCTTCTTTTCCAGTACTAGGTAAG
CTTCTTAACATGTACCGAACCAACATAGCTATAATTTAAGGTGCATAATA
CTTGTATATCTAATTGTCTTTTAACTGATGTATACATATACACTATATTC
CTATCATCTTTTCTCTTCCAACTAAGATATTTCATATCTTTTGCTGTTTC
TGTTTCTAATTTCTAGTCTTCTTTTTTTTTTCATCTCTTTATTTTTATTA
CATATGGTGATAATCGAAGGCACTAAGCGGATCAAACACTGCTTTAGCGT
GTTTGGAAACCATGATTTCAGAGGCAGCCCAAAGCTTTGCAGCTTCGTTG
GAATTCGACCCCAGTTTGGATGTCCATGCTTCGTTGCAGTCTGCAAAGTA
TTTCCCACTTATATTTAGCAGTCTTGGATGCGTGGCGACGTAACAAGTCG
TGGCAGCTGCCTGTACCCTCGACAAATGAAAGTCCATTGTCCATCAAAAC
CACCCACTTCAACTCTCATTAATCAAAAGCTTTAATTACTTAAGATATAT
TAGTTTACCTGAGGAATGGTTTTCAGGAGCTTGGAAGCCAAAAAGAAAAC
CAGATCTGCAGGTTAATATATATTAGATTTTAACCAGAGAGAGTTGAAAG
TTGAAAACATTAAATAAAATCAAATGGCATCTTCTATATGTATATACCTG
TTATCAAGCCCTCACGTTCCCTGGTGAGACGGGTTCTAACAATACCTGGA
TGAACACAGTTCACAGTCACGTTGGCATCCACTTGCTTCAGTCTCTGGGC
AAGCTCCTTGGTATGCAAAACGTTAGCGAGCTTCGAGAGAGCATAAGCAC
GTGTCGCATCGTATTGACTGGGAACAGACAGCCAGACAAAAAACAGACAC
ATGAATTAAAAATCGATAGGAAATGTCAAATCCAAAAGAAAAGAAACCCA
ATCTTCTGTAACAATCATTTACTCCTATACTATGTTCGATTCTGTCACTG
TTATTTATCATTCTTCACCTTTTGCTTCTGGATATCTGGCCTATATATCG
GATCATATCGCCAGAAAACCATCCATGGATACTCGACGACACATTCACTA
TTCTTCCTGGAACACCTGTTTGTTTAGCCGTCTTCATCATCGTGTTTAGC
AACAACTTCGTCAACAAAAAATGACCAAGATAATTAGTGGCAAATGTCAT
CTCGATTCCATCCTCGGAGATTGCATGTTCATGCGCAAACTTCCCGGCAT
TGTTTATGAGGATATTGACTGGCAAGTTAAGAGACTCCAACTCCGATACA
AAATTTCGAACAGAAGTGAGTGAACTAAGATCAAGAGCCATGACAATAAT
TTCTGATTCAGGAAACTCGGAAACTATCCTAGCCTTTGCTTCCTCAGCGG
CTTTAAGGTTCCGAGCTGGAAGCACCAACCTCGCTCCTCGTTTGGCCAAC
ACTCTGGCCGTCTCAGCTCCGATCCCCGACGTCGCACCTGTGATGATGAC
TGTTATAGAGCGGAGATCAGGGCAAGTCTCGGTGACTTCCTCGGCGGTGG
ACTTAGAGCCGAAGCCGCTGACTCCTGTTGAGCCGATCAGGTACTTCAGA
GTCTCTAGCATTTCAACTTCCTTTTTTTTCTTTTAGATATGATACAATTT
TTGAGAGTTTAAAGTTGGGTGAAGAACACACAAAATGACGTAAAAATCAT
TTAAGAAAAACAAACAGCAATAAAGGGGTTTGTTTACTCTTGTGGGATTT
AAGGTTTACTATAGAAAGAAAAGATTATCAGAAATGAAAGTTTTAGGGGA
AAGGAGCTAAAAGCTAATCTGTTTCAAGGACAAAAGAGAAAGTGGGATCG
GATTTTATAATGGAGCTAGCTTTGGTGGGGGAGAATCCAATTGAGAGAAC
GAGAGAGAGAGAGAATGGATTATATGTTTGTCATTTGATTGATTATATTT
AACGAAAATTAA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom