g.barbadense_cottongen_reftransV1_0092018, g.barbadense_cottongen_reftransV1_0092018 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092018
Unique Nameg.barbadense_cottongen_reftransV1_0092018
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2035
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: A0A0B0PTY4_GOSAR (Protein GDAP2 OS=Gossypium arboreum GN=F383_16358 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 3.162e-111
Identity = 166/173 (95.95%), Postives = 169/173 (97.69%), Query Frame = -3
Query:  276 LLATMYTAPVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 794
            ++   + APVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS
Sbjct:   75 IVGKYFPAPVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 247          
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: A0A0D2RUA0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G1334001 PE=4 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.065e-110
Identity = 165/169 (97.63%), Postives = 168/169 (99.41%), Query Frame = -3
Query:  276 MYTAPVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 782
            MY APVVSGERLKRYIYHKICSELPEGPFC+VYMHSTVQKEDNSPGVTILRWIYEELPPEIK+RLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYI+RLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS
Sbjct:    1 MYAAPVVSGERLKRYIYHKICSELPEGPFCIVYMHSTVQKEDNSPGVTILRWIYEELPPEIKDRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYISRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 169          
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: A0A0D2Q0G2_GOSRA (Uncharacterized protein (Fragment) OS=Gossypium raimondii GN=B456_006G1334001 PE=4 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 1.955e-107
Identity = 162/165 (98.18%), Postives = 165/165 (100.00%), Query Frame = -3
Query:  276 PVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 770
            PVVSGERLKRYIYHKICSELPEGPFC+VYMHSTVQKEDNSPGVTILRWIYEELPPEIK+RLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYI+RLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS
Sbjct:    1 PVVSGERLKRYIYHKICSELPEGPFCIVYMHSTVQKEDNSPGVTILRWIYEELPPEIKDRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYISRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 165          
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: A0A061EW74_THECC (SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein isoform 2 OS=Theobroma cacao GN=TCM_024410 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 3.872e-103
Identity = 153/178 (85.96%), Postives = 167/178 (93.82%), Query Frame = -3
Query:  276 LAFY*LLATMYTAPVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 809
            L F+ L  +  +APV+SGERLK+YI+HKICSELPEGPFC+VYMHSTVQKEDNSPGVTILRWIYEELP EIK+RLQV+YFIHPGL SRLVFATLGR FLSGGLYWKIKY++RLQYLW+DIKKGEVEIPEFVQNHD+VLEHRPLTDYGIEPDPLHLTEVP+ AYSLGRYEERL SREFMS
Sbjct:   57 LHFFRLQGSDKSAPVISGERLKKYIFHKICSELPEGPFCIVYMHSTVQKEDNSPGVTILRWIYEELPSEIKDRLQVVYFIHPGLCSRLVFATLGRLFLSGGLYWKIKYVSRLQYLWDDIKKGEVEIPEFVQNHDNVLEHRPLTDYGIEPDPLHLTEVPSAAYSLGRYEERLASREFMS 234          
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: A0A061EVD9_THECC (SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein isoform 1 OS=Theobroma cacao GN=TCM_024410 PE=4 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 1.183e-101
Identity = 150/173 (86.71%), Postives = 164/173 (94.80%), Query Frame = -3
Query:  276 LLATMYTAPVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 794
            ++   + APV+SGERLK+YI+HKICSELPEGPFC+VYMHSTVQKEDNSPGVTILRWIYEELP EIK+RLQV+YFIHPGL SRLVFATLGR FLSGGLYWKIKY++RLQYLW+DIKKGEVEIPEFVQNHD+VLEHRPLTDYGIEPDPLHLTEVP+ AYSLGRYEERL SREFMS
Sbjct:   75 IVGKYFPAPVISGERLKKYIFHKICSELPEGPFCIVYMHSTVQKEDNSPGVTILRWIYEELPSEIKDRLQVVYFIHPGLCSRLVFATLGRLFLSGGLYWKIKYVSRLQYLWDDIKKGEVEIPEFVQNHDNVLEHRPLTDYGIEPDPLHLTEVPSAAYSLGRYEERLASREFMS 247          
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: D7TIK6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_08s0007g05700 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 4.835e-97
Identity = 143/166 (86.14%), Postives = 159/166 (95.78%), Query Frame = -3
Query:  276 APVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 773
            APVVSGERLK+Y++HKI SELPEGPFC+VYMHSTVQKEDNSPG+TILRWIYEELP + K+RLQ +YF+HPGLRSRL+FATLGRFFLSGGLYWKIKY++RLQYLWED+KKGEVEIPEFVQ+HDDVLEHRPLTDYGIEPDPLHLTE+P+TAYS GRYEER TSRE MS
Sbjct:   82 APVVSGERLKKYVFHKIVSELPEGPFCIVYMHSTVQKEDNSPGLTILRWIYEELPSDFKDRLQTVYFVHPGLRSRLLFATLGRFFLSGGLYWKIKYVSRLQYLWEDVKKGEVEIPEFVQSHDDVLEHRPLTDYGIEPDPLHLTEMPSTAYSFGRYEERWTSRECMS 247          
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: B9SZT0_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1108000 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 4.562e-96
Identity = 139/173 (80.35%), Postives = 159/173 (91.91%), Query Frame = -3
Query:  276 LLATMYTAPVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 794
            ++   + A V+S ERLK+YI+HK+CSELPEGPFC+VYMHSTVQKEDNSPG+TILRWIYEELP + KNRLQV+YFIHPGLRSRLVFATLGRFFLSGGLYWKIKY++RLQYLWEDIKKGEVEIPEFVQ+HDD+LEHRPLTDYGIEPDP HL E+P TAYSLG+YEER  +RE+ +
Sbjct:   89 VIGKYFPAQVISAERLKKYIFHKMCSELPEGPFCIVYMHSTVQKEDNSPGITILRWIYEELPADYKNRLQVVYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYVSRLQYLWEDIKKGEVEIPEFVQSHDDILEHRPLTDYGIEPDPFHLNEIPTTAYSLGKYEERWAAREYAT 261          
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: M5W350_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa010499mg PE=4 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 1.489e-95
Identity = 139/173 (80.35%), Postives = 161/173 (93.06%), Query Frame = -3
Query:  276 LLATMYTAPVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 794
            ++   + APVVSG+RLKRYI+HK+CSELPEGP+C+VYMHSTVQKEDNSPG+TILRWIYE+LP  +K+RLQ++YFIHPGLRSRLVFATLGRFFL+GGLYWKIKY++RLQYLWE+IKKGEVEIPEFV+ HDDVLEHRPLTDYGIEPDPLH+ EVP+TAYS GRYEER  SRE+ S
Sbjct:   75 IVGKYFPAPVVSGDRLKRYIFHKLCSELPEGPYCIVYMHSTVQKEDNSPGITILRWIYEDLPSYLKDRLQIVYFIHPGLRSRLVFATLGRFFLTGGLYWKIKYVSRLQYLWENIKKGEVEIPEFVKGHDDVLEHRPLTDYGIEPDPLHMIEVPSTAYSFGRYEERWASREYTS 247          
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: A9PCA7_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 2.369e-95
Identity = 141/173 (81.50%), Postives = 158/173 (91.33%), Query Frame = -3
Query:  276 LLATMYTAPVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREFMS 794
            ++   + A VVSGERLK+YI+HKICSELPEGP C+VY HSTVQKEDNSPGVTILRWIYEELP  IK+RLQ +YFIHPGLRSRLVFATLGRFFLSGGLYWKIKY++RLQYLWEDIKKGE+EIPEFVQNHD++LE+RPLTDYGIEPDP HL+E+P TAYS GRYEER +SREF S
Sbjct:   80 IVGKYFPAQVVSGERLKKYIFHKICSELPEGPLCIVYKHSTVQKEDNSPGVTILRWIYEELPAGIKDRLQTVYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYVSRLQYLWEDIKKGEIEIPEFVQNHDNILENRPLTDYGIEPDPFHLSEMPMTAYSFGRYEERWSSREFAS 252          
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Match: A0A067K384_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_22470 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 4.097e-91
Identity = 135/171 (78.95%), Postives = 155/171 (90.64%), Query Frame = -3
Query:  282 LLATMYTAPVVSGERLKRYIYHKICSELPEGPFCLVYMHSTVQKEDNSPGVTILRWIYEELPPEIKNRLQVIYFIHPGLRSRLVFATLGRFFLSGGLYWKIKYINRLQYLWEDIKKGEVEIPEFVQNHDDVLEHRPLTDYGIEPDPLHLTEVPNTAYSLGRYEERLTSREF 794
            ++   + A V+SGERLK+YI HKICSELPEGPFC+VYMH+TVQKEDNSPGVTILRWIYEELP + K+RLQV+YFIHPGLRSRLVFATLGRFFLSG LYWKIKY++RLQYLW+DIK+GEVEIPEFV +HDD+LE RPLTDYGIEPDP HL EVPNTAYS G+YE+R  +RE+
Sbjct:   84 IVGKYFPAQVISGERLKKYILHKICSELPEGPFCIVYMHTTVQKEDNSPGVTILRWIYEELPADYKDRLQVVYFIHPGLRSRLVFATLGRFFLSGSLYWKIKYVSRLQYLWDDIKRGEVEIPEFVCSHDDILEDRPLTDYGIEPDPFHLHEVPNTAYSFGKYEQRWVAREY 254          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092018 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PTY4_GOSAR3.162e-11195.95Protein GDAP2 OS=Gossypium arboreum GN=F383_16358 ... [more]
A0A0D2RUA0_GOSRA1.065e-11097.63Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2Q0G2_GOSRA1.955e-10798.18Uncharacterized protein (Fragment) OS=Gossypium ra... [more]
A0A061EW74_THECC3.872e-10385.96SEC14 cytosolic factor family protein / phosphogly... [more]
A0A061EVD9_THECC1.183e-10186.71SEC14 cytosolic factor family protein / phosphogly... [more]
D7TIK6_VITVI4.835e-9786.14Putative uncharacterized protein OS=Vitis vinifera... [more]
B9SZT0_RICCO4.562e-9680.35Putative uncharacterized protein OS=Ricinus commun... [more]
M5W350_PRUPE1.489e-9580.35Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
A9PCA7_POPTR2.369e-9581.50Putative uncharacterized protein OS=Populus tricho... [more]
A0A067K384_JATCU4.097e-9178.95Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001251CRAL-TRIO lipid binding domainPFAMPF13716CRAL_TRIO_2coord: 8..125
e-value: 1.4E-25
score: 89.9
NoneNo IPR availablePANTHERPTHR11106GANGLIOSIDE INDUCED DIFFERENTIATION ASSOCIATED PROTEIN 2-RELATEDcoord: 4..169
NoneNo IPR availablePANTHERPTHR11106:SF64SUBFAMILY NOT NAMEDcoord: 4..169

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092018 ID=g.barbadense_cottongen_reftransV1_0092018|Name=g.barbadense_cottongen_reftransV1_0092018|organism=Gossypium barbadense|type=contig|length=2035bp
CTCCCAACAAAATGCCGACAAATTAATTATCAAATTTATAGTATCTATGA
TATTTTAAAGCTGCAATATAATAGTAAATCTATGCATTAATGTTAGCCAT
AACACACCAAATTTAATTAACTACAAGTACAGCGTAGCGATTTCTCACAA
TTCAAGGCACGCAATATAAAGACTACTATAGACAATCTTATTTCTTGTTT
TACCTGATAATTCCTACTGGCCAGATCCTGCAAACCCTTTTACTGGGTTC
AGCTGTGTATTTAATATCTAAACTATGACATGAATTCCCTTGAGGTTAAT
CTCTCTTCATACCTCCCTAATGAGTAAGCAGTGTTAGGTACCTCTGTTAA
GTGGAGAGGATCTGGCTCAATACCATAATCTGTTAAGGGCCGGTGCTCAA
GAACATCGTCATGGTTTTGCACAAATTCAGGGATCTCAACCTCTCCCTTC
TTTATGTCCTCCCATAGGTATTGTAGGCGGTTTATGTATTTGATCTTCCA
GTATAAACCCCCACTTAAGAAGAATCGGCCAAGAGTGGCAAAGACAAGCC
GTGAACGAAGCCCAGGGTGTATGAAGTAGATGACTTGCAGCCTATTCTTG
ATCTCAGGGGGAAGTTCTTCGTAAATCCACCTCAAGATAGTAACACCAGG
GGAGTTATCCTCCTTCTGCACTGTACTGTGCATATAAACTAAGCAGAATG
GACCTTCAGGCAACTCACTGCATATCTTGTGGTATATATATCTCTTCAGT
CGCTCCCCGCTAACAACTGGAGCTGTATACATTGTGGCAAGTAGTTAGTA
AAAAGCCAAATCGAAGTTTACTAGAGGAACAACTTAAGCCTGAAGAAACC
CGATAAAATTTGTTCAATTTCAAATATTGTCTTTGACATTAATCAAGAAA
CCAACATTTAAGACAATTACATCACAATCAAACAGAACTCTTTAGAGAAT
AGAAATGAAAACTGCAAAGACTTATCACATTGAGCTTCACACCAAGAGGT
TCAACTAATGTAAAGGACTCTGGCATAAATGCATTGCATTAGGTACATAG
GATGATGGAGAGGATAAAACAAATAAGTATATGGAAAAAGGTAGGATCGG
ATGATCTTATCCTATTCATGTTTAGTGTATAATAAGTTAAAAAGTATATT
TGTCATAGATTTCATCTTCAGCCATGTTTTGTGTAGGATAGGTCATAGGG
TAATATTTTGGTGATCGGTCTAAATTAACTCCCAAATCAACTGAAGTAAA
AGCATAATGATGAAAACTAAGGAAAGAAATAAAATCGAAACCTAAGCCTT
GATTAGAGATTCGAAATTAACTAATGGCCTTTCCTAAAATAGGTTTAGCC
CATAACATATATACACTCCATTACCTATACTAGAGGTGCCTCGGACTCAT
TAAGCATTAATTTTGTCTTGGGATTACAAAAAAAAAAAGTTTATGGTTCC
ATCTTTGTTGTGGTGATAATTCTCGACTATAACACATTACATTCTTTGTT
CTATGAATTCTGATGCTACTCATATTACTGAGTTGTTTTCAAGAAAATGC
TAAGGCTACATGGTGCTCTGAAATCTATAGTTTTTTATAGCAAAAATGAT
GAGTCAAAGAAATATAGAATCCAAACTACAATATTAACGTAAACAATGCA
AGCCAAGCACATTTAAGCTTACTTAGACACTTCTTGCTATTTTGCGTATT
GCACATTATAATTGGTTAATCATAATTGAGATATTCTATATTAATAAGTA
AACTTCAATGATATGATCATATAAAATTATGAAAACAAAGACCATATGAC
ATAGAAAGCCTAACAAAGTAATTATTAAGAGTTACTATTATTAAATCCTT
ATGCATGACAATCATGTTTCTTAGATAGATTCTAGTAGTGTCATTGAGGG
CACAAGGTGCAGTCTAAGCACTAGAAACCTTTATTGCTTGGGGCACAAGG
CACAAAAAGAAGGCTCACCTGAGTGAAGCATGGTGCAATGTATATTTGTG
TATTTAAGTGCCTCCCTCCCTCCTATCTCTCTCTC
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR001251CRAL-TRIO_dom