g.barbadense_cottongen_reftransV1_0092653, g.barbadense_cottongen_reftransV1_0092653 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092653
Unique Nameg.barbadense_cottongen_reftransV1_0092653
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length1958
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy Swiss-Prot
Match: TIF8_ARATH (Protein TIFY 8 OS=Arabidopsis thaliana GN=TIFY8 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.180e-47
Identity = 129/310 (41.61%), Postives = 166/310 (53.55%), Query Frame = 1
Query:  169 QQVKPAAMFHDFLGMK-PSNSSVVLAPKATDARF--XXXXXXXXXXXXXXXXXXXXXXXXXXXTSDLGSERQAG--NHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALA 1083
            Q  +   +FHDFLG K P+ +S  +A    D R      +   + + + +S     G G +SSTSDL  ER +G  NHL+GI  +GPRS++SG  ++N  +G+KRS SDS F   E  E+LH  K+LRNG G                 S   +   +  QPP G                       GG     +HQ+S++RFKD  VGPSVI+Q AADEGSRTG+KGPGILSS     +P      +  PS     TG            +R+ L S+++QMTIFYGGQAHVFDDVHPNKADVIMALA
Sbjct:   20 QTEQDKLLFHDFLGSKNPTLASTSMA----DHRLPPDNKAAKAAMTPSTASASSAGGLGGLSSTSDL-VERHSGGGNHLDGIQLFGPRSDVSGSIMSNRFSGNKRSNSDSHFTTQEHPETLHWSKLLRNGPG-----------------SFSMNVNPLANQPPRG-----------------------GGQISHLLHQLSTSRFKDENVGPSVIAQTAADEGSRTGMKGPGILSSFT---MPNSSKLESFAPS----NTG------------NRKDLASSTKQMTIFYGGQAHVFDDVHPNKADVIMALA 265          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A0D2RRX8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G011200 PE=4 SV=1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 422/426 (99.06%), Postives = 425/426 (99.77%), Query Frame = 1
Query:   79 MAAVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXXXXXTSDLGSERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 1356
            MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPK TDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGSERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDE+FLGMKSMRPSSTS+ILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAV+GNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV
Sbjct:    1 MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKPTDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGSERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEVFLGMKSMRPSSTSLILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVTGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 426          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A0B0NSU5_GOSAR (Protein TIFY 8-like protein OS=Gossypium arboreum GN=F383_17051 PE=4 SV=1)

HSP 1 Score: 759.214 bits (1959), Expect = 0.000e+0
Identity = 424/427 (99.30%), Postives = 425/427 (99.53%), Query Frame = 1
Query:   79 MAAVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXXXXXTSDLGS-ERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 1356
            MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGS ERQ GNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAV+GNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV
Sbjct:    1 MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGSVERQVGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVTGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 427          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A0D2TBC3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G011200 PE=4 SV=1)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 422/427 (98.83%), Postives = 425/427 (99.53%), Query Frame = 1
Query:   79 MAAVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXXXXXTSDLGS-ERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 1356
            MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPK TDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGS ERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDE+FLGMKSMRPSSTS+ILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAV+GNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV
Sbjct:    1 MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKPTDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGSVERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEVFLGMKSMRPSSTSLILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVTGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 427          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A0D2UEA1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G011200 PE=4 SV=1)

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 393/426 (92.25%), Postives = 396/426 (92.96%), Query Frame = 1
Query:   79 MAAVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXXXXXTSDLGSERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 1356
            MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPK TDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGSERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDE+FLGMKSMRPSSTS+ILQPPAGSRLE                             VSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAV+GNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV
Sbjct:    1 MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKPTDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGSERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEVFLGMKSMRPSSTSLILQPPAGSRLE-----------------------------VSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVTGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 397          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A0D2Q6Q4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G011200 PE=4 SV=1)

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 393/427 (92.04%), Postives = 396/427 (92.74%), Query Frame = 1
Query:   79 MAAVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXXXXXTSDLGS-ERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVPSAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 1356
            MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPK TDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGS ERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDE+FLGMKSMRPSSTS+ILQPPAGSRLE                             VSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAV+GNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV
Sbjct:    1 MAAVLKMAEQSKTTNTNNANTTNTPTHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKPTDARFSEASPSPSASVAASSGGGGAGRGPISSTSDLGSVERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEVFLGMKSMRPSSTSLILQPPAGSRLE-----------------------------VSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRTGENYAPGGEPEAVGSIAFSRELRGKMAVTGNASQATGSGERIPIQTGVPQGTIVMARDGRNLEAGTEDKREV 398          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A061GND8_THECC (TIFY domain protein 8 isoform 3 OS=Theobroma cacao GN=TCM_038313 PE=4 SV=1)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 356/434 (82.03%), Postives = 374/434 (86.18%), Query Frame = 1
Query:   85 AVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXX-XXXTSDLGS-ERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVP---SAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR-TGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTGVPQGTIVMARDGRN----LEAGTEDKREV 1356
            AVLKMA+QSKTTNTNNANT NT THLQHQQ     MFHDFLGMK ++S VVLA KATDARFSEASPS SASV ASSGGGG      ISSTSDLGS ERQ GNHLEGIPYYGPRSEISGP+I+N L GSKR  SDSAFMGHESLESLHLMKMLRNGAGGER RRSNEDE+FLGM+SMRPSS S+ILQPP GSRLEGNASKWERSVP   SAVQY  RGGHFVPFVHQ SSNRFKDT VGPSVISQ+AADEGSRTGIKGPGILSSIN SG+PTEK SS +VPSG RPK+GAH SDPE  VPPSRQGLTSASRQMTIFY GQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR   ENYAPG EPEAVGS+ FSRE RG++AV+GN SQ TGSGERI IQTGVPQGTIV+A+D RN     E   EDKREV
Sbjct:    2 AVLKMAQQSKTTNTNNANTNNTSTHLQHQQQVKPTMFHDFLGMKATDSPVVLAHKATDARFSEASPSASASVGASSGGGGGAGRGPISSTSDLGSVERQVGNHLEGIPYYGPRSEISGPEISNRLVGSKRGNSDSAFMGHESLESLHLMKMLRNGAGGERSRRSNEDEVFLGMQSMRPSSASLILQPPTGSRLEGNASKWERSVPMIGSAVQYGPRGGHFVPFVHQASSNRFKDTNVGPSVISQSAADEGSRTGIKGPGILSSINTSGIPTEKNSSGVVPSGARPKSGAHISDPESSVPPSRQGLTSASRQMTIFYAGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRPVSENYAPGEEPEAVGSMVFSREFRGRIAVAGNTSQGTGSGERISIQTGVPQGTIVIAKDARNPVQAAEPSAEDKREV 435          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A061GW75_THECC (TIFY domain protein 8 isoform 2 OS=Theobroma cacao GN=TCM_038313 PE=4 SV=1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 355/433 (81.99%), Postives = 373/433 (86.14%), Query Frame = 1
Query:   85 AVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXX-XXXTSDLGS-ERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVP---SAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR-TGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTGVPQGTIVMARDGRN----LEAGTEDKRE 1353
            AVLKMA+QSKTTNTNNANT NT THLQHQQ     MFHDFLGMK ++S VVLA KATDARFSEASPS SASV ASSGGGG      ISSTSDLGS ERQ GNHLEGIPYYGPRSEISGP+I+N L GSKR  SDSAFMGHESLESLHLMKMLRNGAGGER RRSNEDE+FLGM+SMRPSS S+ILQPP GSRLEGNASKWERSVP   SAVQY  RGGHFVPFVHQ SSNRFKDT VGPSVISQ+AADEGSRTGIKGPGILSSIN SG+PTEK SS +VPSG RPK+GAH SDPE  VPPSRQGLTSASRQMTIFY GQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR   ENYAPG EPEAVGS+ FSRE RG++AV+GN SQ TGSGERI IQTGVPQGTIV+A+D RN     E   EDKRE
Sbjct:    2 AVLKMAQQSKTTNTNNANTNNTSTHLQHQQQVKPTMFHDFLGMKATDSPVVLAHKATDARFSEASPSASASVGASSGGGGGAGRGPISSTSDLGSVERQVGNHLEGIPYYGPRSEISGPEISNRLVGSKRGNSDSAFMGHESLESLHLMKMLRNGAGGERSRRSNEDEVFLGMQSMRPSSASLILQPPTGSRLEGNASKWERSVPMIGSAVQYGPRGGHFVPFVHQASSNRFKDTNVGPSVISQSAADEGSRTGIKGPGILSSINTSGIPTEKNSSGVVPSGARPKSGAHISDPESSVPPSRQGLTSASRQMTIFYAGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRPVSENYAPGEEPEAVGSMVFSREFRGRIAVAGNTSQGTGSGERISIQTGVPQGTIVIAKDARNPVQAAEPSAEDKRE 434          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A061GQE6_THECC (TIFY domain protein 8 isoform 5 OS=Theobroma cacao GN=TCM_038313 PE=4 SV=1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 338/404 (83.66%), Postives = 354/404 (87.62%), Query Frame = 1
Query:   85 AVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXX-XXXTSDLGSERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVP---SAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR-TGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTG 1281
            AVLKMA+QSKTTNTNNANT NT THLQHQQ     MFHDFLGMK ++S VVLA KATDARFSEASPS SASV ASSGGGG      ISSTSDLGSERQ GNHLEGIPYYGPRSEISGP+I+N L GSKR  SDSAFMGHESLESLHLMKMLRNGAGGER RRSNEDE+FLGM+SMRPSS S+ILQPP GSRLEGNASKWERSVP   SAVQY  RGGHFVPFVHQ SSNRFKDT VGPSVISQ+AADEGSRTGIKGPGILSSIN SG+PTEK SS +VPSG RPK+GAH SDPE  VPPSRQGLTSASRQMTIFY GQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR   ENYAPG EPEAVGS+ FSRE RG++AV+GN SQ TGSGERI IQTG
Sbjct:    2 AVLKMAQQSKTTNTNNANTNNTSTHLQHQQQVKPTMFHDFLGMKATDSPVVLAHKATDARFSEASPSASASVGASSGGGGGAGRGPISSTSDLGSERQVGNHLEGIPYYGPRSEISGPEISNRLVGSKRGNSDSAFMGHESLESLHLMKMLRNGAGGERSRRSNEDEVFLGMQSMRPSSASLILQPPTGSRLEGNASKWERSVPMIGSAVQYGPRGGHFVPFVHQASSNRFKDTNVGPSVISQSAADEGSRTGIKGPGILSSINTSGIPTEKNSSGVVPSGARPKSGAHISDPESSVPPSRQGLTSASRQMTIFYAGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRPVSENYAPGEEPEAVGSMVFSREFRGRIAVAGNTSQGTGSGERISIQTG 405          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A061GPP9_THECC (TIFY domain protein 8 isoform 6 OS=Theobroma cacao GN=TCM_038313 PE=4 SV=1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 339/407 (83.29%), Postives = 355/407 (87.22%), Query Frame = 1
Query:   85 AVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXX-XXXTSDLGS-ERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVP---SAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR-TGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTGVP 1287
            AVLKMA+QSKTTNTNNANT NT THLQHQQ     MFHDFLGMK ++S VVLA KATDARFSEASPS SASV ASSGGGG      ISSTSDLGS ERQ GNHLEGIPYYGPRSEISGP+I+N L GSKR  SDSAFMGHESLESLHLMKMLRNGAGGER RRSNEDE+FLGM+SMRPSS S+ILQPP GSRLEGNASKWERSVP   SAVQY  RGGHFVPFVHQ SSNRFKDT VGPSVISQ+AADEGSRTGIKGPGILSSIN SG+PTEK SS +VPSG RPK+GAH SDPE  VPPSRQGLTSASRQMTIFY GQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR   ENYAPG EPEAVGS+ FSRE RG++AV+GN SQ TGSGERI IQTG P
Sbjct:    2 AVLKMAQQSKTTNTNNANTNNTSTHLQHQQQVKPTMFHDFLGMKATDSPVVLAHKATDARFSEASPSASASVGASSGGGGGAGRGPISSTSDLGSVERQVGNHLEGIPYYGPRSEISGPEISNRLVGSKRGNSDSAFMGHESLESLHLMKMLRNGAGGERSRRSNEDEVFLGMQSMRPSSASLILQPPTGSRLEGNASKWERSVPMIGSAVQYGPRGGHFVPFVHQASSNRFKDTNVGPSVISQSAADEGSRTGIKGPGILSSINTSGIPTEKNSSGVVPSGARPKSGAHISDPESSVPPSRQGLTSASRQMTIFYAGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRPVSENYAPGEEPEAVGSMVFSREFRGRIAVAGNTSQGTGSGERISIQTGDP 408          
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Match: A0A061GPB9_THECC (TIFY domain protein 8 isoform 4 OS=Theobroma cacao GN=TCM_038313 PE=4 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 338/405 (83.46%), Postives = 354/405 (87.41%), Query Frame = 1
Query:   85 AVLKMAEQSKXXXXXXXXXXXXXXHLQHQQVKPAAMFHDFLGMKPSNSSVVLAPKATDARFXXXXXXXXXXXXXXXXXXXXXXXX-XXXTSDLGS-ERQAGNHLEGIPYYGPRSEISGPDINNSLAGSKRSFSDSAFMGHESLESLHLMKMLRNGAGGERPRRSNEDEIFLGMKSMRPSSTSVILQPPAGSRLEGNASKWERSVP---SAVQYASRGGHFVPFVHQVSSNRFKDTTVGPSVISQAAADEGSRTGIKGPGILSSINASGVPTEKGSSAIVPSGGRPKTGAHNSDPEPLVPPSRQGLTSASRQMTIFYGGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR-TGENYAPGGEPEAVGSIAFSRELRGKMAVSGNASQATGSGERIPIQTG 1281
            AVLKMA+QSKTTNTNNANT NT THLQHQQ     MFHDFLGMK ++S VVLA KATDARFSEASPS SASV ASSGGGG      ISSTSDLGS ERQ GNHLEGIPYYGPRSEISGP+I+N L GSKR  SDSAFMGHESLESLHLMKMLRNGAGGER RRSNEDE+FLGM+SMRPSS S+ILQPP GSRLEGNASKWERSVP   SAVQY  RGGHFVPFVHQ SSNRFKDT VGPSVISQ+AADEGSRTGIKGPGILSSIN SG+PTEK SS +VPSG RPK+GAH SDPE  VPPSRQGLTSASRQMTIFY GQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVR   ENYAPG EPEAVGS+ FSRE RG++AV+GN SQ TGSGERI IQTG
Sbjct:    2 AVLKMAQQSKTTNTNNANTNNTSTHLQHQQQVKPTMFHDFLGMKATDSPVVLAHKATDARFSEASPSASASVGASSGGGGGAGRGPISSTSDLGSVERQVGNHLEGIPYYGPRSEISGPEISNRLVGSKRGNSDSAFMGHESLESLHLMKMLRNGAGGERSRRSNEDEVFLGMQSMRPSSASLILQPPTGSRLEGNASKWERSVPMIGSAVQYGPRGGHFVPFVHQASSNRFKDTNVGPSVISQSAADEGSRTGIKGPGILSSINTSGIPTEKNSSGVVPSGARPKSGAHISDPESSVPPSRQGLTSASRQMTIFYAGQAHVFDDVHPNKADVIMALAGSNGGSWSTTYSPKSAVRPVSENYAPGEEPEAVGSMVFSREFRGRIAVAGNTSQGTGSGERISIQTG 406          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 1
Match NameE-valueIdentityDescription
TIF8_ARATH2.180e-4741.61Protein TIFY 8 OS=Arabidopsis thaliana GN=TIFY8 PE... [more]
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092653 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2RRX8_GOSRA0.000e+099.06Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0NSU5_GOSAR0.000e+099.30Protein TIFY 8-like protein OS=Gossypium arboreum ... [more]
A0A0D2TBC3_GOSRA0.000e+098.83Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2UEA1_GOSRA0.000e+092.25Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2Q6Q4_GOSRA0.000e+092.04Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GND8_THECC0.000e+082.03TIFY domain protein 8 isoform 3 OS=Theobroma cacao... [more]
A0A061GW75_THECC0.000e+081.99TIFY domain protein 8 isoform 2 OS=Theobroma cacao... [more]
A0A061GQE6_THECC0.000e+083.66TIFY domain protein 8 isoform 5 OS=Theobroma cacao... [more]
A0A061GPP9_THECC0.000e+083.29TIFY domain protein 8 isoform 6 OS=Theobroma cacao... [more]
A0A061GPB9_THECC0.000e+083.46TIFY domain protein 8 isoform 4 OS=Theobroma cacao... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010399Tify domainSMARTSM00979tify_2coord: 302..337
e-value: 2.9E-16
score: 70.0
IPR010399Tify domainPFAMPF06200tifycoord: 304..336
e-value: 4.7E-15
score: 54.5
IPR010399Tify domainPROSITEPS51320TIFYcoord: 302..337
score: 15.761
NoneNo IPR availablePANTHERPTHR33077FAMILY NOT NAMEDcoord: 12..426
NoneNo IPR availablePANTHERPTHR33077:SF8PROTEIN TIFY 8coord: 12..426

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092653 ID=g.barbadense_cottongen_reftransV1_0092653|Name=g.barbadense_cottongen_reftransV1_0092653|organism=Gossypium barbadense|type=contig|length=1958bp
GGAGGAGCAACAACTGCAGATGAATGATGATGATGATGTGGAGTCTATAT
TGGTGATGATGATGATGATGAAGATGGAATGGCTGCTGTTCTGAAAATGG
CTGAACAAAGCAAAACTACCAACACCAACAATGCCAACACTACAAACACC
CCAACTCATCTGCAACACCAACAAGTAAAACCAGCAGCAATGTTTCACGA
TTTCCTGGGAATGAAACCTTCTAATTCCTCTGTCGTTTTAGCCCCTAAAG
CCACTGATGCAAGGTTTTCAGAGGCTTCACCGTCTCCTTCAGCCTCCGTC
GCCGCTTCTTCCGGTGGTGGTGGTGCTGGCCGTGGACCCATCTCTTCCAC
CTCCGATCTGGGTTCTGAAAGGCAGGCTGGTAATCATCTTGAGGGGATTC
CATACTATGGTCCAAGGAGTGAAATATCCGGGCCAGATATAAACAACAGT
TTGGCTGGAAGTAAGAGAAGTTTTTCAGATTCGGCCTTTATGGGTCATGA
ATCTCTTGAGAGCTTGCATTTGATGAAGATGCTTCGCAATGGGGCTGGAG
GAGAGCGACCTAGAAGGTCCAACGAGGACGAAATATTCCTTGGTATGAAG
TCAATGAGGCCTTCTTCTACATCTGTTATATTGCAGCCTCCCGCTGGTAG
CAGACTCGAAGGTAATGCTTCCAAATGGGAACGGTCTGTCCCCTCAGCAG
TACAGTATGCTTCTCGTGGTGGTCATTTTGTGCCTTTTGTGCATCAAGTA
TCTTCAAACAGGTTCAAGGATACAACTGTTGGTCCTTCTGTTATCTCTCA
AGCAGCTGCCGATGAAGGATCTAGAACTGGAATTAAAGGCCCTGGAATTT
TGAGTTCTATTAATGCTAGCGGTGTTCCCACTGAAAAGGGTTCATCTGCG
ATAGTGCCAAGTGGGGGCAGGCCTAAGACTGGGGCTCATAATTCAGATCC
CGAGCCTTTAGTTCCTCCGAGTCGACAGGGATTAACATCTGCCAGCCGAC
AAATGACTATATTTTATGGTGGTCAGGCTCACGTCTTTGATGATGTGCAC
CCGAACAAGGCAGATGTAATAATGGCATTGGCTGGATCAAATGGAGGATC
TTGGTCGACAACCTACTCTCCTAAATCTGCTGTGAGAACAGGTGAAAATT
ATGCACCAGGCGGGGAACCTGAAGCAGTAGGAAGCATTGCGTTCTCACGT
GAACTTCGGGGAAAGATGGCTGTTTCTGGTAATGCAAGTCAAGCAACTGG
TTCCGGTGAACGAATCCCGATACAAACAGGGGTTCCTCAAGGCACAATTG
TTATGGCTAGAGATGGAAGAAACCTGGAAGCTGGTACTGAAGATAAAAGA
GAGGTATAAAGTTTAAGCAAAGTTTTCGGAATAGCTTCAAATCCAGATAT
TACAGAAATTGCAGATTTCCAACCTGCTATCATCTCTACTTATTAGGAAT
AGTCCCATCCATTTCATGTCTCTGTCATTAATGCTTAAAACTTGTTCGAA
TTTTTAACTTAATTTCTGGGTAGAGCAGCATATAAGAACAGCTTCTGAGT
CGAATAGCAATGAACCCCCCTGCGTTTGCGTAATGGACGAAGTCCATGAA
ATCGAAATCCTTGAAAACTCGAGGATGTTCCTCGTCAACCATCACTTTTG
CTGCTTTGGTACTTCCACCGGAACCGCGAATGTTCCCAAAGAATATCGAT
ATTCGTTTCTACTCAACATTACCCTATGATTTGCTGCATGCATTCTTCCA
TTACTCCACGCCTGCAATTTAATTTGGAAATTCAACATTAGTAAATTAGG
TAAAATAACCATGGAGGCCGTATGCCAAGAGATAGATTGCATTTTACCGC
TTTTAAATTAGTTACTATACATTAGGTTAAAGATCTTTTTTGTTAAAAAA
ATTATCAATTTCTATTGTTAAAAAATTAGCGTGGTTGACAAACCGACTAA
AAAGTTGC
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR010399Tify_dom