g.arboreum_cottongen_reftransV1_0017230, g.arboreum_cottongen_reftransV1_0017230 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0017230
Unique Nameg.arboreum_cottongen_reftransV1_0017230
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length801
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeg.arboreum_cottongen_reftransV1_0017230:1..801 .
Chr1:20465401..20466201 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0017230 vs. ExPASy TrEMBL
Match: A0A0B0NTE4_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_05837 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 4.579e-10
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 1
Query:  442 MSWNGSLNKSLVNSTLTAXXXXXXXXXWGYNLLVAYMFFWIS 567
            MSWNGSLNKSLVNSTLTALFCFF FLFWGYNLLVAYMFFWIS
Sbjct:    1 MSWNGSLNKSLVNSTLTALFCFFSFLFWGYNLLVAYMFFWIS 42          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0017230 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A0B0NTE4_GOSAR4.579e-1097.62Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
back to top
BLAST of g.arboreum_cottongen_reftransV1_0017230 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 67..84
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 37..55
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..36
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 85..100
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 56..66
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 65..84

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0017230 ID=g.arboreum_cottongen_reftransV1_0017230|Name=g.arboreum_cottongen_reftransV1_0017230|organism=Gossypium arboreum|type=contig|length=801bp
TTTCTATCCAGAAAAGCAAAGTCAATATCACACACAAACACCTATTTCAT
CTTATACCATTTTCTGTGTCGCCTTTACTTACACACCGGGCCAAAAAGTA
AAACATTTTGTAAAGCAAAAAAATTAAAAACATGTGTTGTGATGGAGATT
GCAGGCCCCTGGGCTTCCTCCTTGGCCTTCCCTTTGCTTTTCTTTCTCTC
ATCATCTCTATTGTTGGCGTTGTTGTTTGGATCGTGGGGTAGTCCTTTCC
ATTCCTCCACTTTCTTCTACTGTTTGCGAATTGGGATCTGGGTTTTAATT
TCTTCTAATTTTCTACCTCAATCAACTTATCAGCACTTGGGGTTTTTGCT
TGCAGGTTGTTGTTGACACTGATCTGTCCTTGTTGTTTGTGCGTGACGGT
GCTAGTAGAGATGGCGCTGGAGTTGGTCAAAGCTCCAATTCATGTCATGG
AATGGTTCACTGAACAAATCCCTTGTTAATTCCACACTCACTGCTTTGTT
CTGCTTTTTTTTTTTTCTCTTTTGGGGGTACAATTTATTGGTAGCATACA
TGTTTTTCTGGATCTCTTGATTATATGTTCTTGATGTAGACATGGGATTT
ATGAGGATTCCCAATTTATATTCTTGTGGTTTGGATTTTGTTTATTGTTG
ATATTATTCATTGTCATTGGTTATGATAAAATAAGTTATGTCCAATATAT
GCTGATCAAAAGCGCATTCGTTCTGGCAATTCAAATCCTTAACCAGACCA
CCAGAGGGAATTCTGTAGAACCTTTTATTACTTATTCGTTGTTGATTCTT
G
back to top