g.arboreum_cottongen_reftransV1_0017230, g.arboreum_cottongen_reftransV1_0017230 (contig) Gossypium arboreum
Overview
Alignments
The following features are aligned
Analyses
This contig is derived from or has results from the following analyses
Homology
BLAST of g.arboreum_cottongen_reftransV1_0017230 vs. ExPASy TrEMBL
Match: A0A0B0NTE4_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_05837 PE=4 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 4.579e-10 Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 1 Query: 442 MSWNGSLNKSLVNSTLTAXXXXXXXXXWGYNLLVAYMFFWIS 567 MSWNGSLNKSLVNSTLTALFCFF FLFWGYNLLVAYMFFWIS Sbjct: 1 MSWNGSLNKSLVNSTLTALFCFFSFLFWGYNLLVAYMFFWIS 42 The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0017230 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL) Total hits: 1
BLAST of g.arboreum_cottongen_reftransV1_0017230 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt) Total hits: 0
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
Sequences
The
following sequences are available for this feature:
contig sequence >g.arboreum_cottongen_reftransV1_0017230 ID=g.arboreum_cottongen_reftransV1_0017230; Name=g.arboreum_cottongen_reftransV1_0017230; organism=Gossypium arboreum; type=contig; length=801bpback to top |