g.arboreum_cottongen_reftransV1_0013641, g.arboreum_cottongen_reftransV1_0013641 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0013641
Unique Nameg.arboreum_cottongen_reftransV1_0013641
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2146
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr10chromosomeg.arboreum_cottongen_reftransV1_0013641:1..2146 .
Chr10:32082330..32087719 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: A0A0D2R8W0_GOSRA (Uncharacterized protein (Fragment) OS=Gossypium raimondii GN=B456_002G188300 PE=4 SV=1)

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 623/654 (95.26%), Postives = 640/654 (97.86%), Query Frame = 3
Query:    3 ETKRRPNNKVHLWVFFKFPQTSKMETARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGIDVRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKT-FLKRNDNSFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLGILNATIAIADDNNEKYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 1961
            ETKRRPN+K HLWVFFKFPQTSKMETARLRLVFEDPNILSKSQK+QGLKRSWFILKPQHQTIFDLSSDLLHIFDL+KSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKS EIIKAGNGMNYLEELETMERLPV TGVKHLANEEFDKETGGYKSELEEDEQELAPLED+AQVESTPIENMVSKKRKARDKLPSSRKKKSKLA+A+KYPVSGDDGIDVRP+KSKSSHKKKVS NDKVVGKDKPADIQGEPENSS+PEIDETGD+KTNLGRS+QLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEK QSKELLGKDD++SPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEE+AEQA Q+SQISVKTFQWNGITSKKKGQKWGMEKT FL+RNDN+FSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHY+AESNRIMLTPVPGYPNA  KKTDEEASELPDTSLYGEDGSLE  YSSLIDVRLVKLG  NATIAIADDNNE YAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI
Sbjct:   14 ETKRRPNSKGHLWVFFKFPQTSKMETARLRLVFEDPNILSKSQKKQGLKRSWFILKPQHQTIFDLSSDLLHIFDLRKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSAEIIKAGNGMNYLEELETMERLPVKTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDQAQVESTPIENMVSKKRKARDKLPSSRKKKSKLASAEKYPVSGDDGIDVRPKKSKSSHKKKVSINDKVVGKDKPADIQGEPENSSTPEIDETGDDKTNLGRSAQLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEKPQSKELLGKDDQQSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEEDAEQAIQHSQISVKTFQWNGITSKKKGQKWGMEKTPFLRRNDNNFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYDAESNRIMLTPVPGYPNASGKKTDEEASELPDTSLYGEDGSLEAYYSSLIDVRLVKLGNSNATIAIADDNNENYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 667          
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: A0A0B0P2W2_GOSAR (Coilin OS=Gossypium arboreum GN=F383_24878 PE=4 SV=1)

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 630/655 (96.18%), Postives = 630/655 (96.18%), Query Frame = 3
Query:   72 METARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGIDVRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKTFLKRNDNSFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASELPDTSLYGEDGSLE-------------------------IDYSSLIDVRLVKLGILNATIAIADDNNEKYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 1961
            METARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPSSRKKKSKLATAKKYPVSGDDGIDVRPRKSKSSHKKKVSTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKTFLKRNDNSFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASELPDTSLYGEDGSLE                         IDYSSLIDVRLVKLGILNATIAIADDNNEKYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI
Sbjct:    1 METARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPSSRKKKSKLATAKKYPVSGDDGIDVRPRKSKSSHKKKVSTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKTFLKRNDNSFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASELPDTSLYGEDGSLEAYIEACEVGSQLRLVQSFNIHLCHMIDYSSLIDVRLVKLGILNATIAIADDNNEKYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 655          
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: A0A0D2QFC4_GOSRA (Uncharacterized protein (Fragment) OS=Gossypium raimondii GN=B456_002G188300 PE=4 SV=1)

HSP 1 Score: 1163.67 bits (3009), Expect = 0.000e+0
Identity = 625/687 (90.98%), Postives = 642/687 (93.45%), Query Frame = 3
Query:    3 ETKRRPNNKVHLWVFFKFPQTSKMETARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILS---------------------------------MDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGIDVRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKT-FLKRNDNSFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLGILNATIAIADDNNEKYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 1961
            ETKRRPN+K HLWVFFKFPQTSKMETARLRLVFEDPNILSKSQK+QGLKRSWFILKPQHQTIFDLSSDLLHIFDL+KSCPNGLILS                                 MDGFVLPPFEPTCILKDKDIVSVKMKGGKS EIIKAGNGMNYLEELETMERLPV TGVKHLANEEFDKETGGYKSELEEDEQELAPLED+AQVESTPIENMVSKKRKARDKLPSSRKKKSKLA+A+KYPVSGDDGIDVRP+KSKSSHKKKVS NDKVVGKDKPADIQGEPENSS+PEIDETGD+KTNLGRS+QLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEK QSKELLGKDD++SPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEE+AEQA Q+SQISVKTFQWNGITSKKKGQKWGMEKT FL+RNDN+FSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHY+AESNRIMLTPVPGYPNA  KKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLG  NATIAIADDNNE YAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI
Sbjct:   14 ETKRRPNSKGHLWVFFKFPQTSKMETARLRLVFEDPNILSKSQKKQGLKRSWFILKPQHQTIFDLSSDLLHIFDLRKSCPNGLILSVCLSTSLFPSRTRHALIYIYILLPCYAIDFSLQMDGFVLPPFEPTCILKDKDIVSVKMKGGKSAEIIKAGNGMNYLEELETMERLPVKTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDQAQVESTPIENMVSKKRKARDKLPSSRKKKSKLASAEKYPVSGDDGIDVRPKKSKSSHKKKVSINDKVVGKDKPADIQGEPENSSTPEIDETGDDKTNLGRSAQLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEKPQSKELLGKDDQQSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEEDAEQAIQHSQISVKTFQWNGITSKKKGQKWGMEKTPFLRRNDNNFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYDAESNRIMLTPVPGYPNASGKKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLGNSNATIAIADDNNENYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 700          
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: A0A0D2NQ02_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G188300 PE=4 SV=1)

HSP 1 Score: 1135.17 bits (2935), Expect = 0.000e+0
Identity = 604/631 (95.72%), Postives = 620/631 (98.26%), Query Frame = 3
Query:   72 METARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGIDVRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKT-FLKRNDNSFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLGILNATIAIADDNNEKYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 1961
            METARLRLVFEDPNILSKSQK+QGLKRSWFILKPQHQTIFDLSSDLLHIFDL+KSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKS EIIKAGNGMNYLEELETMERLPV TGVKHLANEEFDKETGGYKSELEEDEQELAPLED+AQVESTPIENMVSKKRKARDKLPSSRKKKSKLA+A+KYPVSGDDGIDVRP+KSKSSHKKKVS NDKVVGKDKPADIQGEPENSS+PEIDETGD+KTNLGRS+QLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEK QSKELLGKDD++SPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEE+AEQA Q+SQISVKTFQWNGITSKKKGQKWGMEKT FL+RNDN+FSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHY+AESNRIMLTPVPGYPNA  KKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLG  NATIAIADDNNE YAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI
Sbjct:    1 METARLRLVFEDPNILSKSQKKQGLKRSWFILKPQHQTIFDLSSDLLHIFDLRKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSAEIIKAGNGMNYLEELETMERLPVKTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDQAQVESTPIENMVSKKRKARDKLPSSRKKKSKLASAEKYPVSGDDGIDVRPKKSKSSHKKKVSINDKVVGKDKPADIQGEPENSSTPEIDETGDDKTNLGRSAQLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEKPQSKELLGKDDQQSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEEDAEQAIQHSQISVKTFQWNGITSKKKGQKWGMEKTPFLRRNDNNFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYDAESNRIMLTPVPGYPNASGKKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLGNSNATIAIADDNNENYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 631          
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: A0A0D2Q8P4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G188300 PE=4 SV=1)

HSP 1 Score: 1129.39 bits (2920), Expect = 0.000e+0
Identity = 603/631 (95.56%), Postives = 619/631 (98.10%), Query Frame = 3
Query:   72 METARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGIDVRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKT-FLKRNDNSFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLGILNATIAIADDNNEKYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 1961
            METARLRLVFEDPNILSKSQK+QGLKRSWFILKPQHQTIFDLSSDLLHIFDL+KSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKS EIIKAGNGMNYLEELETMERLPV TGVKHLANEEFDKETGGYKSELEEDEQELAPLED+AQVESTPIENMVSKKRKARDKLPSSRKKKSKLA+A+KYPVSGDDGIDVRP+KSKSSHKKKVS NDKVVGKDKPADIQGEPENSS+PEIDETGD+KTNLGRS+QLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEK QSKELLGKDD++SPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPL EE+AEQA Q+SQISVKTFQWNGITSKKKGQKWGMEKT FL+RNDN+FSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHY+AESNRIMLTPVPGYPNA  KKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLG  NATIAIADDNNE YAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI
Sbjct:    1 METARLRLVFEDPNILSKSQKKQGLKRSWFILKPQHQTIFDLSSDLLHIFDLRKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSAEIIKAGNGMNYLEELETMERLPVKTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDQAQVESTPIENMVSKKRKARDKLPSSRKKKSKLASAEKYPVSGDDGIDVRPKKSKSSHKKKVSINDKVVGKDKPADIQGEPENSSTPEIDETGDDKTNLGRSAQLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEKPQSKELLGKDDQQSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPL-EEDAEQAIQHSQISVKTFQWNGITSKKKGQKWGMEKTPFLRRNDNNFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYDAESNRIMLTPVPGYPNASGKKTDEEASELPDTSLYGEDGSLEIDYSSLIDVRLVKLGNSNATIAIADDNNENYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI 630          
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: A0A0D2MCX0_GOSRA (Uncharacterized protein (Fragment) OS=Gossypium raimondii GN=B456_002G188300 PE=4 SV=1)

HSP 1 Score: 852.432 bits (2201), Expect = 0.000e+0
Identity = 462/485 (95.26%), Postives = 478/485 (98.56%), Query Frame = 3
Query:    3 ETKRRPNNKVHLWVFFKFPQTSKMETARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGIDVRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKT-FLKRNDNSFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRV 1454
            ETKRRPN+K HLWVFFKFPQTSKMETARLRLVFEDPNILSKSQK+QGLKRSWFILKPQHQTIFDLSSDLLHIFDL+KSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKS EIIKAGNGMNYLEELETMERLPV TGVKHLANEEFDKETGGYKSELEEDEQELAPLED+AQVESTPIENMVSKKRKARDKLPSSRKKKSKLA+A+KYPVSGDDGIDVRP+KSKSSHKKKVS NDKVVGKDKPADIQGEPENSS+PEIDETGD+KTNLGRS+QLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEK QSKELLGKDD++SPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEE+AEQA Q+SQISVKTFQWNGITSKKKGQKWGMEKT FL+RNDN+FSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRV
Sbjct:   14 ETKRRPNSKGHLWVFFKFPQTSKMETARLRLVFEDPNILSKSQKKQGLKRSWFILKPQHQTIFDLSSDLLHIFDLRKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSAEIIKAGNGMNYLEELETMERLPVKTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDQAQVESTPIENMVSKKRKARDKLPSSRKKKSKLASAEKYPVSGDDGIDVRPKKSKSSHKKKVSINDKVVGKDKPADIQGEPENSSTPEIDETGDDKTNLGRSAQLQNTGKGSADELITTTEVKKLPSRSARRKKAKRRWLREQAKLVKEKPQSKELLGKDDQQSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEEDAEQAIQHSQISVKTFQWNGITSKKKGQKWGMEKTPFLRRNDNNFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRV 498          
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: A0A061E6T2_THECC (Sphere organelles protein-related, putative isoform 1 OS=Theobroma cacao GN=TCM_010599 PE=4 SV=1)

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 464/640 (72.50%), Postives = 537/640 (83.91%), Query Frame = 3
Query:   72 METARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGIDVRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKT-FLKRNDN-SFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASEL-PDTSLYGEDGSLEIDYSSLIDVRLVKLGILNATIAIADDNNEKYAQNQDVL-TRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQNGI*GMAPA 1979
            MET RLRL+FED NIL+KSQK+QGLKRSW +LKPQHQTI DLSS LL++F L +SCP+GLILSMD FVLPPFE TCI KDKDI+SVK KGGK TEIIK G+G+N LEELE +E+ PVNTGVK LA++EFDK+TGGY+SE EEDEQEL PLE+   VESTPI+N+VSKKRKA +KLP  ++KKSKL+ A K PVS D+G DV  +KSKSSH++ V   +KV+GKD P DIQGEPE  S+PE DE+ D+ TN+GR  QLQ TGKGS     TT+E KK PSRSARRKKAKRRWLREQA + KEKL SK+LLGKD+++SPAKENL+ SEE LQ + N+ V+D VVP+V+RPGHIRFEPLE E+AE+A Q SQISV+TFQWNGITSKKKGQKWG EKT FLKRND+ SFS VS+EMV + +KAT+T+DMDFDKLMPYSSLPKEGD VAYRLVELSS+WTPELCSFRVG+IS Y+AESNRI+LTPVP YPNA EKK DE+ SEL  DTSLYGEDGSLEIDY+SLIDVRL+K G  NA I++A   +E  A++ +VL  RQPNGSKEA  VSA   AQANG VN WEEI+QALSAKK ELSKEDGWS+ DSSGRS+WS+RALRRSALGPTMAFLRAQNGI G +P 
Sbjct:    1 METTRLRLLFEDRNILNKSQKKQGLKRSWILLKPQHQTILDLSSHLLYVFHLHRSCPHGLILSMDSFVLPPFESTCIFKDKDIISVKKKGGKRTEIIKVGDGLNSLEELEIVEQPPVNTGVKLLASKEFDKQTGGYESEPEEDEQELEPLENEEHVESTPIQNIVSKKRKASEKLPRPKRKKSKLSRAGKSPVSVDNGNDVHHKKSKSSHQRTVLPEEKVIGKDNPVDIQGEPEKLSNPETDESSDDDTNVGRFPQLQETGKGSVVVSQTTSEAKKPPSRSARRKKAKRRWLREQAIIEKEKLPSKQLLGKDNQQSPAKENLEVSEEHLQPVGNSSVKDYVVPVVIRPGHIRFEPLETEDAERAVQQSQISVETFQWNGITSKKKGQKWGKEKTPFLKRNDDKSFSQVSTEMVAIEEKATITDDMDFDKLMPYSSLPKEGDFVAYRLVELSSSWTPELCSFRVGKISDYDAESNRIILTPVPEYPNASEKKIDEDESELQSDTSLYGEDGSLEIDYTSLIDVRLIKHGNSNAIISVAGGISENCAEDPNVLKNRQPNGSKEAVLVSAPPLAQANGVVNGWEEISQALSAKKVELSKEDGWSQTDSSGRSSWSYRALRRSALGPTMAFLRAQNGILGASPT 640          
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: A0A061E6X3_THECC (Sphere organelles protein-related, putative isoform 2 OS=Theobroma cacao GN=TCM_010599 PE=4 SV=1)

HSP 1 Score: 518.079 bits (1333), Expect = 4.863e-174
Identity = 314/448 (70.09%), Postives = 369/448 (82.37%), Query Frame = 3
Query:   72 METARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGIDVRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSSSPEIDETGDNKTNLGRSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKEKLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLE-EENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKT-FLKRNDN-SFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRL 1406
            MET RLRL+FED NIL+KSQK+QGLKRSW +LKPQHQTI DLSS LL++F L +SCP+GLILSMD FVLPPFE TCI KDKDI+SVK KGGK TEIIK G+G+N LEELE +E+ PVNTGVK LA++EFDK+TGGY+SE EEDEQEL PLE+   VESTPI+N+VSKKRKA +KLP  ++KKSKL+ A K PVS D+G DV  +KSKSSH++ V   +KV+GKD P DIQGEPE  S+PE DE+ D+ TN+GR  QLQ TGKGS     TT+E KK PSRSARRKKAKRRWLREQA + KEKL SK+LLGKD+++SPAKENL+ SEE LQ + N+ V+D VVP+V+RPGHIRFEPLE  E+AE+A Q SQISV+TFQWNGITSKKKGQKWG EKT FLKRND+ SFS VS+EMV + +KAT+T+DMDFDKLMPYSSLPK G      L
Sbjct:    1 METTRLRLLFEDRNILNKSQKKQGLKRSWILLKPQHQTILDLSSHLLYVFHLHRSCPHGLILSMDSFVLPPFESTCIFKDKDIISVKKKGGKRTEIIKVGDGLNSLEELEIVEQPPVNTGVKLLASKEFDKQTGGYESEPEEDEQELEPLENEEHVESTPIQNIVSKKRKASEKLPRPKRKKSKLSRAGKSPVSVDNGNDVHHKKSKSSHQRTVLPEEKVIGKDNPVDIQGEPEKLSNPETDESSDDDTNVGRFPQLQETGKGSVVVSQTTSEAKKPPSRSARRKKAKRRWLREQAIIEKEKLPSKQLLGKDNQQSPAKENLEVSEEHLQPVGNSSVKDYVVPVVIRPGHIRFEPLETAEDAERAVQQSQISVETFQWNGITSKKKGQKWGKEKTPFLKRNDDKSFSQVSTEMVAIEEKATITDDMDFDKLMPYSSLPKGGRFCCISL 448          
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: D7SMC6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0137g00610 PE=4 SV=1)

HSP 1 Score: 479.559 bits (1233), Expect = 4.298e-156
Identity = 309/663 (46.61%), Postives = 409/663 (61.69%), Query Frame = 3
Query:   72 METARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMNYLEELETMERLPVNTGVKHLANEEFDKETGGYKSELEEDEQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGID-VRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSSSPEIDETGDN----KTNLGRSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKE--KLQSKELLGKDDEKSPAKENLKFSEECLQAISNNDVEDNV-VPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEKTFLKRND-NSFSHVSSEMVDVNDKATVTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASEL---PDTSLYGEDGSLEIDYSSLIDVRLVKLG------ILNATIAIADDNNEKYA------QNQDVLTRQPNGSKEANSVSAA-----------SPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQN 1955
            MET R+R+V EDP++L+K+Q  +GL+RSW +LKPQH+TI DLSS LL IF+L   CPNGL+LSMDGFVLP FE TCILKDK+I+SVK KGG   ++++ G+  N  E+   +E   ++ GVK LANEEFDKETGGY+SE EEDE +    E+  QVE+    N  SKKRKA  KL S ++KK+K    +K PV  +D  + V   ++KS            + K K +++ G+P+ + +  IDE  ++      N  R  +LQ  G           EV   P  + +      R  + + K ++E  K++ KE+  +   +SP KE  K S E  Q   N+D +D V VPIV+RPGHIRFEPL     +Q  Q + +SV+TFQWNG TSKKKGQKWG EK   +RND   F+   SE   V +     + MDFDKL   +S PKEGD++AYRL+ELSSTWTPEL +FRVG+IS Y+ ESN+++L  VP  P   E + DE+AS L   PDTSLY EDGSLEID+SSLIDVR++K G       + A +    D  +  +      +N  + T  P G      VS A           +P   NG VN W+EI++ LSAKKA+LS+EDG S+ +S GRS WS++ALR SALGPTM+FLRAQN
Sbjct:    3 METVRVRVVLEDPDLLNKTQNSEGLRRSWLLLKPQHKTISDLSSYLLRIFNLHDFCPNGLLLSMDGFVLPSFESTCILKDKEIISVKRKGGAVIDLLEVGDETNCSEDEAIVENQHIHRGVKLLANEEFDKETGGYESESEEDEPDQP--EETVQVETASAGNAGSKKRKASRKLKSPKRKKNKYTRLEKCPVVLEDVENGVCEEQTKSCDDCTALPKKGSLKKHKSSNVNGKPDKARTLNIDERSNDVDESSPNAKRCGELQENGSQGV-------EVANPPDGTQKYPSRSARRKKAKRKWLRELAKVEKKEMHQR---QSPEKEVQKNSLEHQQPDQNSDTDDAVIVPIVIRPGHIRFEPL---GKDQTIQQNPVSVETFQWNGTTSKKKGQKWGKEKMSCRRNDYKDFNQQHSETFAVEEGTPPKDPMDFDKLPSLTSSPKEGDMIAYRLIELSSTWTPELSTFRVGKISSYDPESNKLILISVPESPIVAETRIDEDASALEPDPDTSLYREDGSLEIDFSSLIDVRIIKSGNSHLEKAVTARVEAPVDTQDAVSGVKPNNKNSGMSTSLPGGELNITQVSVAGVEHNINREMTAPPPENGKVNAWDEIDKVLSAKKAQLSQEDGSSKKESPGRSPWSYKALRGSALGPTMSFLRAQN 650          
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Match: B9SVN1_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0794230 PE=4 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 3.094e-148
Identity = 305/647 (47.14%), Postives = 417/647 (64.45%), Query Frame = 3
Query:   72 METARLRLVFEDPNILSKSQKQQGLKRSWFILKPQHQTIFDLSSDLLHIFDLQKSCPNGLILSMDGFVLPPFEPTCILKDKDIVSVKMKGGKSTEIIKAGNGMN-YLEELETMERLP-VNTGVKHLANEEFDKETGGYKSELEED-----EQELAPLEDRAQVESTPIENMVSKKRKARDKLPXXXXXXXXXXXXXXYPVSGDDGIDVRPRXXXXXXXXXXXTNDKVVGKDKPADIQGEPENSS-SPEIDETGDNKTNLG---RSSQLQNTGKGSADELITTTEVXXXXXXXXXXXXXXXXXXXEQAKLVKEKLQSKELLGKDD----EKSPAKENLKFSEECLQAISNNDVEDNVVPIVVRPGHIRFEPLEEENAEQANQYSQISVKTFQWNGITSKKKGQKWGMEK-TFLKRNDNSFSHVSSEMVDVNDKAT--VTNDMDFDKLMPYSSLPKEGDLVAYRLVELSSTWTPELCSFRVGEISHYNAESNRIMLTPVPGYPNAFEKKTDEEASELPDTSL-YGEDGSLEIDYSSLIDVRLVKLGILNATIAIADDNNEKYAQNQDVLTRQPNGSKEANSVSAASPAQANGAVNVWEEINQALSAKKAELSKEDGWSRADSSGRSAWSFRALRRSALGPTMAFLRAQN 1955
            MET RLRLVF+   ILSK Q  QGLKR W +LKPQHQTI DLSS LL++F+LQ  CP+GL+L M+GF LP FE T ILKDKDI+ V+  GG S+EI+  G+ +N  LE +E +E  P V TG+  LANEEF+KE+GGY+S+ EED     E+ +  +E+ ++V++      +SKKRKA   L S ++KK+K A A+K+                             V +D   ++ GE   +S +P+ DE  ++   L    R SQ Q  G  S D   +T+  KKLPSRSARRK+AKRRWLRE+ +  +++  S+ L  K +    E+ P     +  E+  Q   ++D+ED++VPIV+RPGHIRFEPL +  A QA Q + I V+ F WNGITSKKKGQKWG EK T  KRND+   +VS E  +V       V + +DF+KL  Y++LPKEGD++AYRL+ELS +WTPE+ S+RVG+IS Y+ +SNR+ L PVPGYP    K+T ++AS  P  ++ Y +DGSL I+++SLI+VRLV  G  N+  ++A + ++   ++QD  T    G +  N   +   AQ NG  N WEEI++AL+AKKAEL++ED W++  SSGR  WS++ALR SALGPTMA LRAQN
Sbjct:    1 METVRLRLVFD--QILSKVQNTQGLKRCWILLKPQHQTISDLSSYLLNVFNLQNHCPHGLLLLMEGFALPGFECTSILKDKDIIRVEKNGGVSSEIVMVGDDVNNALEVVEIVETQPLVTTGMNLLANEEFEKESGGYQSDEEEDVPKQEEEAVHVVENASEVKT------ISKKRKAMKDLKSPKRKKTKSARAEKHAA---------------------------VLEDMGNNVTGEQNGTSCTPKFDERSESSKALSKAKRISQPQENGDASVDASPSTSGTKKLPSRSARRKQAKRRWLREKLRAERKEQSSQTLAEKGNNGVFEELPESGGEEPQEDDQQPDKDSDLEDDIVPIVIRPGHIRFEPLSKAGANQAEQQTHIPVEIFHWNGITSKKKGQKWGKEKATSYKRNDHR--NVSQECSEVRKDGGRPVYDRVDFEKLEFYTTLPKEGDVIAYRLIELSPSWTPEISSYRVGKISRYDMQSNRVRLVPVPGYP-VTHKETGDDASAAPSETIPYAKDGSLWIEFASLIEVRLVTRGNSNSVKSVAGEIDKVPVRDQDNRT----GCRSNNGNESHVSAQENGKGNAWEEISEALNAKKAELAQEDNWNKPGSSGRRPWSYKALRGSALGPTMALLRAQN 605          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2R8W0_GOSRA0.000e+095.26Uncharacterized protein (Fragment) OS=Gossypium ra... [more]
A0A0B0P2W2_GOSAR0.000e+096.18Coilin OS=Gossypium arboreum GN=F383_24878 PE=4 SV... [more]
A0A0D2QFC4_GOSRA0.000e+090.98Uncharacterized protein (Fragment) OS=Gossypium ra... [more]
A0A0D2NQ02_GOSRA0.000e+095.72Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2Q8P4_GOSRA0.000e+095.56Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2MCX0_GOSRA0.000e+095.26Uncharacterized protein (Fragment) OS=Gossypium ra... [more]
A0A061E6T2_THECC0.000e+072.50Sphere organelles protein-related, putative isofor... [more]
A0A061E6X3_THECC4.863e-17470.09Sphere organelles protein-related, putative isofor... [more]
D7SMC6_VITVI4.298e-15646.61Putative uncharacterized protein OS=Vitis vinifera... [more]
B9SVN1_RICCO3.094e-14847.14Putative uncharacterized protein OS=Ricinus commun... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0013641 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 573..593
NoneNo IPR availablePANTHERPTHR15197COILIN P80coord: 1..630
IPR031722Coilin, N-terminal domainPFAMPF15862Coilin_Ncoord: 5..192
e-value: 2.1E-17
score: 63.1
IPR024822CoilinPANTHERPTHR15197:SF0COILINcoord: 1..630

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0013641 ID=g.arboreum_cottongen_reftransV1_0013641|Name=g.arboreum_cottongen_reftransV1_0013641|organism=Gossypium arboreum|type=contig|length=2146bp
ATGAAACGAAACGAAGGCCAAATAACAAAGTTCACCTTTGGGTTTTCTTC
AAATTTCCTCAGACTTCGAAAATGGAGACGGCAAGGCTCCGTTTGGTGTT
CGAGGATCCGAACATTCTCAGCAAGTCTCAGAAGCAACAAGGCCTAAAGC
GAAGCTGGTTTATCCTTAAACCCCAACATCAAACCATCTTCGATCTTTCC
TCCGATCTTCTCCACATTTTCGACCTCCAAAAGTCTTGCCCTAATGGCCT
CATACTCTCCATGGATGGCTTTGTTTTGCCACCTTTCGAGCCAACTTGTA
TTTTAAAAGATAAAGATATTGTCAGTGTGAAGATGAAAGGAGGGAAATCG
ACCGAGATTATTAAGGCTGGAAATGGTATGAATTATTTGGAAGAATTGGA
AACAATGGAGCGACTGCCCGTTAATACCGGCGTCAAGCATCTAGCCAATG
AGGAGTTTGATAAGGAAACCGGGGGATACAAAAGCGAACTGGAAGAAGAT
GAGCAAGAACTTGCGCCATTGGAGGATCGAGCACAAGTTGAAAGCACACC
AATTGAAAACATGGTTTCAAAGAAAAGAAAGGCACGGGATAAACTTCCGA
GCTCTAGGAAGAAGAAAAGCAAATTGGCTACTGCTAAAAAATATCCGGTT
TCTGGAGATGATGGAATTGATGTTCGTCCAAGGAAAAGCAAAAGCTCTCA
TAAAAAAAAGGTTTCCACCAATGACAAGGTTGTTGGTAAGGACAAGCCAG
CTGACATTCAGGGAGAACCAGAGAATTCAAGCAGCCCTGAAATTGATGAA
ACTGGTGATAACAAAACCAATCTGGGGAGGTCCTCCCAGCTTCAAAACAC
TGGTAAAGGGAGTGCTGATGAACTTATTACAACTACTGAAGTTAAAAAGC
TCCCTAGCAGAAGTGCCCGACGTAAAAAGGCTAAAAGGCGATGGTTGAGG
GAGCAGGCCAAACTTGTAAAGGAAAAGCTGCAGTCAAAAGAGCTGCTGGG
AAAAGATGATGAGAAATCACCTGCAAAAGAAAATCTCAAATTTTCGGAAG
AATGTCTACAAGCAATTAGCAATAATGATGTTGAGGATAACGTGGTTCCA
ATAGTAGTAAGGCCAGGACATATTCGCTTTGAGCCCCTTGAAGAAGAAAA
TGCTGAGCAAGCTAACCAATACAGTCAAATTTCAGTGAAAACCTTTCAAT
GGAATGGAATAACCAGCAAGAAGAAGGGTCAAAAATGGGGTATGGAGAAA
ACTTTTCTGAAAAGGAATGATAACAGTTTTAGCCATGTGAGTTCAGAAAT
GGTGGATGTTAACGATAAGGCCACTGTAACTAATGACATGGACTTTGACA
AGCTTATGCCCTATTCTAGCTTGCCTAAGGAGGGAGATTTAGTTGCATAT
CGCTTAGTTGAGCTATCTTCAACTTGGACCCCTGAGCTTTGCTCCTTCCG
GGTTGGAGAAATATCACATTATAATGCTGAATCCAACAGGATTATGCTGA
CACCAGTGCCAGGATATCCAAATGCCTTTGAGAAGAAAACAGATGAGGAG
GCTTCTGAACTACCAGATACATCTCTTTACGGAGAAGATGGGTCGTTAGA
GATAGATTATTCCTCTCTAATTGATGTCCGCCTCGTCAAGCTTGGCATTT
TGAATGCCACAATAGCAATTGCTGATGACAACAATGAAAAGTATGCACAA
AATCAAGATGTTTTAACAAGACAACCAAATGGCAGCAAGGAAGCAAACAG
TGTCTCAGCTGCATCTCCTGCACAAGCTAATGGTGCGGTCAATGTATGGG
AAGAAATTAACCAGGCTTTGAGTGCAAAGAAGGCTGAGCTCTCTAAAGAG
GATGGTTGGAGTCGAGCAGATAGTTCAGGTAGGAGCGCCTGGTCTTTTCG
GGCTCTCAGACGCAGTGCTCTTGGCCCAACTATGGCCTTCTTAAGAGCAC
AGAATGGGATCTGAGGAATGGCACCAGCATCAGTTTTAAGTGTAGTCTCT
CAATGTTTTTGAACCTCTGAAAGACGAGAGCAAGGCAATTTTGTTTTGGC
TTTTGCTTTGTCAAGTACACAAAATTTTCAAGTGTCGTCCAAAGTTAACG
TCTTTTTTGTAGCATGCGAAGCCGGTTTTCACTTGTTTTACTACAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR031722Coilin_N
IPR024822Coilin