g.arboreum_cottongen_reftransV1_0019357, g.arboreum_cottongen_reftransV1_0019357 (contig) Gossypium arboreum
Overview
Analyses
This contig is derived from or has results from the following analyses
Homology
BLAST of g.arboreum_cottongen_reftransV1_0019357 vs. ExPASy TrEMBL
Match: A0A078E6P8_BRANA (BnaC02g30340D protein OS=Brassica napus GN=BnaC02g30340D PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 4.666e-7 Identity = 33/44 (75.00%), Postives = 36/44 (81.82%), Query Frame = -2 Query: 277 SSEEADADDEWT-ESTRECASGIAASGMSSDERNQKQVSARDLM 405 SS+EADADDE T +ST+E AS A SGMSSDERNQKQ SAR LM Sbjct: 204 SSDEADADDELTDKSTKEAASSRATSGMSSDERNQKQNSARALM 247
BLAST of g.arboreum_cottongen_reftransV1_0019357 vs. ExPASy TrEMBL
Match: A0A0D3D8Q0_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 5.875e-7 Identity = 32/44 (72.73%), Postives = 35/44 (79.55%), Query Frame = -2 Query: 277 SSEEADADDEWT-ESTRECASGIAASGMSSDERNQKQVSARDLM 405 SS+EADADDE T +ST+E AS SGMSSDERNQKQ SAR LM Sbjct: 207 SSDEADADDELTDKSTKEAASSRPTSGMSSDERNQKQNSARALM 250
BLAST of g.arboreum_cottongen_reftransV1_0019357 vs. ExPASy TrEMBL
Match: M4EY03_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis GN=Bra033693 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 7.079e-7 Identity = 33/44 (75.00%), Postives = 36/44 (81.82%), Query Frame = -2 Query: 277 SSEEADADDEWT-ESTRECASGIAASGMSSDERNQKQVSARDLM 405 SS+EADADDE T +ST+E AS A SGMSSDERNQKQ SAR LM Sbjct: 208 SSDEADADDELTDKSTKEAASSRATSGMSSDERNQKQNSARALM 251 The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0019357 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL) Total hits: 23
Pages
BLAST of g.arboreum_cottongen_reftransV1_0019357 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt) Total hits: 0
Sequences
The
following sequences are available for this feature:
contig sequence >g.arboreum_cottongen_reftransV1_0019357 ID=g.arboreum_cottongen_reftransV1_0019357; Name=g.arboreum_cottongen_reftransV1_0019357; organism=Gossypium arboreum; type=contig; length=406bpback to top |