g.raimondii_cottongen_reftransV1_0001141, g.raimondii_cottongen_reftransV1_0001141 (contig) Gossypium raimondii
Overview
Alignments
The following features are aligned
Analyses
This contig is derived from or has results from the following analyses
Homology
BLAST of g.raimondii_cottongen_reftransV1_0001141 vs. ExPASy TrEMBL
Match: V4UUF7_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10010178mg PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.552e-7 Identity = 42/84 (50.00%), Postives = 59/84 (70.24%), Query Frame = 3 Query: 123 MEPRGACRSNRSS-FEKWVAIVLTFLAVVSPLYVN-QKPTELELEEQSMDFTSXXXXXXXXXXXXXXXXXXXNQSFTRFDRHWI 368 MEP R RSS + + VAI+LT LAV SPLY++ ++ ++LELEEQ ++FT L LL ++L+LA L +QSF+RFD +WI Sbjct: 1 MEPITTYRIRRSSSYGRLVAIILTVLAVFSPLYIDRRRESDLELEEQPINFTFLLPLLLLVLILAITLSLCFDQSFSRFDPYWI 84 The following BLAST results are available for this feature:
BLAST of g.raimondii_cottongen_reftransV1_0001141 vs. ExPASy TrEMBL
Analysis Date: 2016-11-09 (Homology Analysis for Gossypium raimondii CottonGen RefTrans V1 vs TrEMBL) Total hits: 11
Pagesback to top
BLAST of g.raimondii_cottongen_reftransV1_0001141 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-09 (Homology Analysis for Gossypium raimondii CottonGen RefTrans V1 vs SwissProt) Total hits: 0
InterPro
Analysis Name: InterProScan analysis for Gossypium raimondii CottonGen RefTrans V1
Date Performed: 2016-11-09
Sequences
The
following sequences are available for this feature:
contig sequence >g.raimondii_cottongen_reftransV1_0001141 ID=g.raimondii_cottongen_reftransV1_0001141; Name=g.raimondii_cottongen_reftransV1_0001141; organism=Gossypium raimondii; type=contig; length=994bpback to top |