g.arboreum_cottongen_reftransV1_0010435, g.arboreum_cottongen_reftransV1_0010435 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0010435
Unique Nameg.arboreum_cottongen_reftransV1_0010435
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1632
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr4chromosomeg.arboreum_cottongen_reftransV1_0010435:1..1632 .
Chr4:109710506..109714107 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: A0A0B0NA55_GOSAR (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase-like protein OS=Gossypium arboreum GN=F383_13650 PE=4 SV=1)

HSP 1 Score: 972.615 bits (2513), Expect = 0.000e+0
Identity = 484/484 (100.00%), Postives = 484/484 (100.00%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYAKQN 1452
            RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAITTESSVVSVLTSITKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYAKQN
Sbjct:  250 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAITTESSVVSVLTSITKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYAKQN 733          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: A0A0D2SL89_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G283500 PE=4 SV=1)

HSP 1 Score: 939.873 bits (2428), Expect = 0.000e+0
Identity = 468/484 (96.69%), Postives = 473/484 (97.73%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYAKQN 1452
            RFPRYNDPLKLVETR GRCGEWANCFTLYCRAFGYESRLVLDFTDH WTECYSEALGRWMHLDP EAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRR ITTESSVVSVLTSITKECRRNCTSQVLSILEE DNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRIC DEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNS+VGTSLVHQLLPSFKELLNAL+LKSE DSNGILSVCLAG+PVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEE NGAKGCWIMYK SANMQELVAYELMSANDAPERDPMDWVVEGSNDGG SWHVLDERRSEMFDKRF+RKTYNVKS GFLSNMFRFRFLAVRDVKSTS+LQVGSIDLYAKQN
Sbjct:  250 RFPRYNDPLKLVETRKGRCGEWANCFTLYCRAFGYESRLVLDFTDHAWTECYSEALGRWMHLDPCEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRTITTESSVVSVLTSITKECRRNCTSQVLSILEEHDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICCDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSIVGTSLVHQLLPSFKELLNALTLKSELDSNGILSVCLAGNPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEHNGAKGCWIMYKRSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGSSWHVLDERRSEMFDKRFQRKTYNVKSAGFLSNMFRFRFLAVRDVKSTSQLQVGSIDLYAKQN 733          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: A0A0D2SSI3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G283500 PE=4 SV=1)

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 442/457 (96.72%), Postives = 446/457 (97.59%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFR 1371
            RFPRYNDPLKLVETR GRCGEWANCFTLYCRAFGYESRLVLDFTDH WTECYSEALGRWMHLDP EAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRR ITTESSVVSVLTSITKECRRNCTSQVLSILEE DNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRIC DEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNS+VGTSLVHQLLPSFKELLNAL+LKSE DSNGILSVCLAG+PVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEE NGAKGCWIMYK SANMQELVAYELMSANDAPERDPMDWVVEGSNDGG SWHVLDERRSEMFDKRF+RKTYNVKS GFLSNMFR
Sbjct:  250 RFPRYNDPLKLVETRKGRCGEWANCFTLYCRAFGYESRLVLDFTDHAWTECYSEALGRWMHLDPCEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRTITTESSVVSVLTSITKECRRNCTSQVLSILEEHDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICCDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSIVGTSLVHQLLPSFKELLNALTLKSELDSNGILSVCLAGNPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEHNGAKGCWIMYKRSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGSSWHVLDERRSEMFDKRFQRKTYNVKSAGFLSNMFR 706          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: A0A061F345_THECC (Peptide n-glycanase, putative isoform 1 OS=Theobroma cacao GN=TCM_026377 PE=4 SV=1)

HSP 1 Score: 855.514 bits (2209), Expect = 0.000e+0
Identity = 419/484 (86.57%), Postives = 451/484 (93.18%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYAKQN 1452
            RFPRYNDPLKLVETR GRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSE LGRWMHLDP E IYD+PLLYEKGW KKLNYVIAIAKDGV+DVTKRYTRKW+EVLSRR I TESS+VSVLTS+ +ECRRN TS++LS+LEERDNIERE +ERDL STDDA ISLPGRQSGDKQWRIARSE GTDSLS SSC VRIC DEHVT+IYNAF +IL KFVEDSL  SKGVEVLKILRAT+VDLKKLPYKKRRASLK NS+VGTSLVHQLLPSF ELLNA+SLKSE D+NG +SVCLAGDPV+TALALPVALHALDELISDLSKCDNFSK SLSFPLLRLNRICSGAVLASGEELP GIATAAFDGTRMSKWEEPNGA+GC IMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGG SWHVLD++ S++F+KRF+RKTY ++STGF SN FRFRFLA RD++STSRLQVGSIDLYA+++
Sbjct:  251 RFPRYNDPLKLVETRKGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEVLGRWMHLDPCEPIYDQPLLYEKGWDKKLNYVIAIAKDGVHDVTKRYTRKWHEVLSRRTIITESSLVSVLTSMRRECRRNYTSEILSVLEERDNIERETMERDLHSTDDASISLPGRQSGDKQWRIARSEHGTDSLSLSSCPVRICRDEHVTRIYNAFCAILRKFVEDSLIVSKGVEVLKILRATIVDLKKLPYKKRRASLKSNSIVGTSLVHQLLPSFGELLNAISLKSELDANGSVSVCLAGDPVKTALALPVALHALDELISDLSKCDNFSKDSLSFPLLRLNRICSGAVLASGEELPVGIATAAFDGTRMSKWEEPNGARGCSIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGSSWHVLDKQTSQVFNKRFQRKTYKIRSTGFSSNTFRFRFLAARDIQSTSRLQVGSIDLYARES 734          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: A0A061F2G7_THECC (Peptide n-glycanase, putative isoform 2 OS=Theobroma cacao GN=TCM_026377 PE=4 SV=1)

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 419/484 (86.57%), Postives = 451/484 (93.18%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYAKQN 1452
            RFPRYNDPLKLVETR GRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSE LGRWMHLDP E IYD+PLLYEKGW KKLNYVIAIAKDGV+DVTKRYTRKW+EVLSRR I TESS+VSVLTS+ +ECRRN TS++LS+LEERDNIERE +ERDL STDDA ISLPGRQSGDKQWRIARSE GTDSLS SSC VRIC DEHVT+IYNAF +IL KFVEDSL  SKGVEVLKILRAT+VDLKKLPYKKRRASLK NS+VGTSLVHQLLPSF ELLNA+SLKSE D+NG +SVCLAGDPV+TALALPVALHALDELISDLSKCDNFSK SLSFPLLRLNRICSGAVLASGEELP GIATAAFDGTRMSKWEEPNGA+GC IMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGG SWHVLD++ S++F+KRF+RKTY ++STGF SN FRFRFLA RD++STSRLQVGSIDLYA+++
Sbjct:  105 RFPRYNDPLKLVETRKGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEVLGRWMHLDPCEPIYDQPLLYEKGWDKKLNYVIAIAKDGVHDVTKRYTRKWHEVLSRRTIITESSLVSVLTSMRRECRRNYTSEILSVLEERDNIERETMERDLHSTDDASISLPGRQSGDKQWRIARSEHGTDSLSLSSCPVRICRDEHVTRIYNAFCAILRKFVEDSLIVSKGVEVLKILRATIVDLKKLPYKKRRASLKSNSIVGTSLVHQLLPSFGELLNAISLKSELDANGSVSVCLAGDPVKTALALPVALHALDELISDLSKCDNFSKDSLSFPLLRLNRICSGAVLASGEELPVGIATAAFDGTRMSKWEEPNGARGCSIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGSSWHVLDKQTSQVFNKRFQRKTYKIRSTGFSSNTFRFRFLAARDIQSTSRLQVGSIDLYARES 588          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: A0A0D2TN07_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G283500 PE=4 SV=1)

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 400/412 (97.09%), Postives = 403/412 (97.82%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQELVAYELMSANDAPERDPMDW 1236
            RFPRYNDPLKLVETR GRCGEWANCFTLYCRAFGYESRLVLDFTDH WTECYSEALGRWMHLDP EAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRR ITTESSVVSVLTSITKECRRNCTSQVLSILEE DNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRIC DEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNS+VGTSLVHQLLPSFKELLNAL+LKSE DSNGILSVCLAG+PVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEE NGAKGCWIMYK SANMQELVAYELMSANDAPERDPMDW
Sbjct:  250 RFPRYNDPLKLVETRKGRCGEWANCFTLYCRAFGYESRLVLDFTDHAWTECYSEALGRWMHLDPCEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRTITTESSVVSVLTSITKECRRNCTSQVLSILEEHDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICCDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSIVGTSLVHQLLPSFKELLNALTLKSELDSNGILSVCLAGNPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEHNGAKGCWIMYKRSANMQELVAYELMSANDAPERDPMDW 661          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: V4SF08_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10000348mg PE=4 SV=1)

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 349/485 (71.96%), Postives = 408/485 (84.12%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTD---SLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSAN-MQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYA 1443
            RFPRYNDPLKLVET+ GRCGEWANCFTLYCRAFGYESRL+LDFTDHVWTEC+S++LGRWMHLDP E IYDRPLLYEKGW KKLNYVIAI+KDGV+DVTKRYTRKW+EVLSRR I TE +V +VL  +T+ECRR+  S+ LS LE+RD  EREA+ERDL STDDAP+SLPGRQSGDK+WRI+RSE G+D   SLS SSC VR+C DEHVT IYNAFSS+L  FVE+++  S  +E+LKIL+  + DLKK PYK RR SL      G  +V QLLPS   LL  LSLKSE +++G + + LAGDPV+T+L+LPV   ALD++I DL+ CDNF KGS S PLL+LNRI SG+VLASGEE PFGI T+AFDGTR SKWEEPNGA+GCWI+YK++ N M ELVAYELMSANDAPERDPMDWV++GSNDGG SWHVLD++ S+MF+ RF+RKT+ +KSTGFLSN FRFRFL VRDV STSR+Q+GSIDLYA
Sbjct:  293 RFPRYNDPLKLVETKRGRCGEWANCFTLYCRAFGYESRLILDFTDHVWTECFSQSLGRWMHLDPCEGIYDRPLLYEKGWNKKLNYVIAISKDGVFDVTKRYTRKWHEVLSRRNIATEQTVSAVLAEMTRECRRSFASETLSTLEDRDKCEREAMERDLYSTDDAPVSLPGRQSGDKEWRISRSEIGSDDNCSLSCSSCPVRVCIDEHVTTIYNAFSSVLSHFVENNVPKSGAIELLKILKGILGDLKKSPYKTRRVSLNSVPNNGQKIVPQLLPSIGHLLRVLSLKSELNTDGRVDIVLAGDPVKTSLSLPVVFKALDDMIHDLNNCDNFGKGSFSLPLLKLNRIHSGSVLASGEEFPFGIVTSAFDGTRPSKWEEPNGARGCWIIYKVADNKMHELVAYELMSANDAPERDPMDWVLDGSNDGGSSWHVLDKQTSQMFENRFQRKTFKIKSTGFLSNAFRFRFLKVRDVNSTSRMQIGSIDLYA 777          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: A0A067JLF1_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_23486 PE=4 SV=1)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 344/486 (70.78%), Postives = 401/486 (82.51%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTD---SLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSAN-MQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYAK 1446
            RFPRYNDPLKLVETR GRCGEWANCFTLYCRAFGYESRL+LDFTDHVWTEC+S  LGRWMHLDP EA+YD+PLLYEKGWGKKLNYVIAIAKDGV+DVTKRYTRKW EVLSRR I TE  +   LT++TK+CRRN TSQVLS+LE+RD  E E LER L S DD  +SLPGRQSGDK+WRI RSE G++   S S S+C VR+C D HVT+IYNAFS +L +FVE+SL+ S+ VE+LKI +  +VDL+  PYK RR S+ P        V   LP F ELLNALSLKSE DS+  ++VCLAGDPV+T+LALPVAL ALD++I  L+KCD  +K  LS PL+RLNRI SG+V ASGEELPFGIAT+AFDG R +KWEEPNGAKG WI+YKL  N M ELVAY+LMSANDAPERDPMDW+VEG+NDGG SW VLD++ S++FD RF+R+++ ++S GFL N FRFRFLAVRDV+STSRLQ+GSIDLYAK
Sbjct:  246 RFPRYNDPLKLVETRRGRCGEWANCFTLYCRAFGYESRLILDFTDHVWTECFSPYLGRWMHLDPCEAVYDKPLLYEKGWGKKLNYVIAIAKDGVHDVTKRYTRKWLEVLSRRNIITEPLLSVALTNMTKDCRRNLTSQVLSLLEDRDKNESEELERLLHSVDDDAVSLPGRQSGDKEWRILRSEIGSNEDYSFSCSTCAVRLCVDVHVTRIYNAFSPVLSQFVENSLSKSRAVEILKIFKGILVDLRNSPYKTRRTSINP-------FVLHFLPYFDELLNALSLKSEIDSDEKVNVCLAGDPVKTSLALPVALDALDDMIFSLNKCDCLNKALLSSPLMRLNRIHSGSVFASGEELPFGIATSAFDGLRTTKWEEPNGAKGGWIVYKLPDNQMHELVAYDLMSANDAPERDPMDWLVEGTNDGGSSWLVLDKQTSQVFDNRFQRRSFKIRSEGFLCNTFRFRFLAVRDVQSTSRLQLGSIDLYAK 724          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: W9RI70_9ROSA (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Morus notabilis GN=L484_024591 PE=4 SV=1)

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 342/482 (70.95%), Postives = 399/482 (82.78%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQ-ELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYA 1443
            RFPRYNDPLKLVETR GRCGEWANCFTLYCRAFGYESRL+LDFTDHVWTEC+S  LGRWMHLDP E +YD+PLLYE+GW KKLNYVIAIAKDGV DVTKRYTRKW+EVLSRR I TES++ SVL  ITKECR   TSQVLS LE+R+  ER+ALERDL S DDA ISLPGRQSGDK+WR  RSE G+DSLS SSC VR+C DEHV++IY+AF  +L  FV++ L  S+ +EVL IL+  ++DL+K P++ RR SL+  S    S VHQLLPSF ELLNALSL S+ D++G + +CLAG+PV T+LALPVAL A D+ I +L  C N SK SLS PLL+ NRI SG+VLASGEE+PFGIAT+AFDG R +KWEEPNGA+GCWI+YKLS N + +LVAYELMSANDAPERDPMDWV+EGS+DGG SWH+LD++ S+ FD RF+R+TY V S+   SN FRFRFLAVRDV STSRLQ+GSIDLY 
Sbjct:  238 RFPRYNDPLKLVETRRGRCGEWANCFTLYCRAFGYESRLILDFTDHVWTECFSPFLGRWMHLDPCEGVYDKPLLYEQGWNKKLNYVIAIAKDGVCDVTKRYTRKWHEVLSRRKIITESALSSVLIKITKECRSGFTSQVLSALEDRNERERQALERDLHSKDDASISLPGRQSGDKEWRKLRSELGSDSLSCSSCPVRVCIDEHVSRIYDAFLPLLSYFVKEELARSRALEVLGILKGILLDLQKSPFRSRRTSLESGSNTSQSFVHQLLPSFDELLNALSL-SKVDTDGRIDICLAGNPVHTSLALPVALDAADDTIRNLKSCGNLSKDSLSLPLLKSNRIHSGSVLASGEEIPFGIATSAFDGIRTTKWEEPNGARGCWIIYKLSDNQKHKLVAYELMSANDAPERDPMDWVLEGSDDGGSSWHILDKQTSQKFDGRFQRRTYKVASSCLPSNAFRFRFLAVRDVHSTSRLQIGSIDLYV 718          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Match: D7TUL1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0030g01930 PE=4 SV=1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 336/487 (68.99%), Postives = 399/487 (81.93%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSS---CTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNGILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYKLSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLYAKQN 1452
            RFPRYNDPLKLVETR GRCGEWANCFTLYCRAFGYESRL+LDFTDHVWTEC+S   GRWMHLDP EAI+D PLLYEKGW KKLNY+IAIAKDGVYDVTKRYTRKW+EVLSRR ITTE+ + +VL  ITK+CR+  TSQVLS LEERD  E EA+ER+  S D A   LPGRQSGDK+WRI+RSEFG+D  SS S   C VR+C DEHVT++YNA   +L+ F+ +SL+ S+ VE+LK+ +  VV+L+  P++ R+ S+K +S  G   V Q+LPSF ELL ALSLKSE  ++G + +CLAGDPV+T+LALPV L  LD+ I + S C+NF K SLS PL++LNRICSG VLASGEELPFGIAT+AFDG + SKWEEPNGA+GCWI+YK++  MQELVAYELMSANDAPERDPMDWVVEGSNDGG SW VLDE+ S+ F+ RF+RKT+ + S G  SN FRFRFL VRDV++TSRLQ+GSIDLYA+ +
Sbjct:  240 RFPRYNDPLKLVETRKGRCGEWANCFTLYCRAFGYESRLILDFTDHVWTECFSHCFGRWMHLDPCEAIFDNPLLYEKGWNKKLNYIIAIAKDGVYDVTKRYTRKWHEVLSRRNITTEAELSAVLAIITKDCRKGFTSQVLSTLEERDRNEMEAIEREYHSKDYASTLLPGRQSGDKEWRISRSEFGSDDNSSLSSSSCPVRMCIDEHVTRVYNALYPVLYSFILNSLSKSRAVEILKMFKRIVVELRDSPFRMRKTSIKSDSSSGKFFVDQMLPSFGELLEALSLKSELGTDGRVEICLAGDPVKTSLALPVVLDGLDDAIHNFSNCENFGKDSLSLPLVKLNRICSGFVLASGEELPFGIATSAFDGIQKSKWEEPNGARGCWIIYKVNNKMQELVAYELMSANDAPERDPMDWVVEGSNDGGSSWRVLDEQFSQRFETRFQRKTFKINSVGLSSNAFRFRFLKVRDVEATSRLQLGSIDLYARSS 726          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: PNG1_ARATH (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Arabidopsis thaliana GN=PNG1 PE=2 SV=1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 316/485 (65.15%), Postives = 393/485 (81.03%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDS---LSSSSCTVRICSDEHVTKIYNAFSSILHKFVEDSLTASKGVEVLKILRATVVDLKKLPYKKRRASLKPNSVVGTSLVHQLLPSFKELLNALSLKSERDSNG-ILSVCLAGDPVQTALALPVALHALDELISDLSKCDNFSKGSLSFPLLRLNRICSGAVLASGEELPFGIATAAFDGTRMSKWEEPNGAKGCWIMYK-LSANMQELVAYELMSANDAPERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVRDVKSTSRLQVGSIDLY 1440
            RFPRYNDPLKLVET+ GRCGEWANCFTLYCR FGY+SRL++DFTDHVWTECYS +L RW+HLDP E +YD+P+LYEKGW KKLNYVIAI+KDGV DVTKRYT+KW+EVLSRR +TTESS+   L ++T+E RR+   + LS LE RD  E+E LER+L S D+A +SLPGRQSGD++WRI RSEFG+D    +SSSSC VR C D+HVT IY++F  IL +FVED L  ++  EVLK+++  +VDLK  PYK R+A L  +S   +S   Q LP+  +LL ALSLKSERD+NG  +++ + G   +TA+ALPVAL AL EL++DLSK  N +K SLSFPL++ NR+CSG+VLASGEELP GIATAAFDG + SKWEEPNGAKGCWI+YK L   M +L+AYELMSANDAPERDP DW++EGSNDGG +W VLD++ S++F++RF+RK+Y + + GF +N+FRFRFL+VRDV STSRLQ+GSIDLY
Sbjct:  233 RFPRYNDPLKLVETKKGRCGEWANCFTLYCRTFGYDSRLIMDFTDHVWTECYSHSLKRWIHLDPCEGVYDKPMLYEKGWNKKLNYVIAISKDGVCDVTKRYTKKWHEVLSRRTLTTESSLQDGLRTLTRERRRSLMFESLSKLELRDRNEQEELERNLHSADNASVSLPGRQSGDREWRIMRSEFGSDENSSVSSSSCPVRKCVDDHVTNIYDSFLPILTQFVEDGLPVARTNEVLKMIKQVLVDLKNAPYKTRKARLTLDSDNSSSFPEQFLPALGDLLLALSLKSERDTNGKSVTISVDGKLTKTAIALPVALDALRELVADLSKYQNLNKDSLSFPLVKQNRVCSGSVLASGEELPSGIATAAFDGIQESKWEEPNGAKGCWIVYKTLYNQMHQLIAYELMSANDAPERDPKDWILEGSNDGGSTWCVLDKQTSQVFEERFQRKSYKITTPGFQANLFRFRFLSVRDVNSTSRLQLGSIDLY 717          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: PNG1_ORYSJ (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Oryza sativa subsp. japonica GN=PNG1 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.461e-73
Identity = 126/194 (64.95%), Postives = 147/194 (75.77%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSS 582
            RFPRYNDP KL+ETR GRCGEWANCFT YCR+FGYE+RL+LDFTDHVWTEC+S   GRWMHLDP E +YD PLLYEKGW KKL+YVIAI+KDGV DVTKRYTRKW+EVLSRR IT+E +V ++L+SIT + R   +   L+ LE RD  E E L +      D  ISLPGRQSG  +WR A  +  T  LS +S
Sbjct:  249 RFPRYNDPYKLLETRKGRCGEWANCFTFYCRSFGYEARLILDFTDHVWTECFSNLYGRWMHLDPCEGVYDNPLLYEKGWNKKLDYVIAISKDGVRDVTKRYTRKWHEVLSRRIITSEDTVSAILSSITGKYRSGLSIDGLTALENRDKKESEELSKAAYLEVDTSISLPGRQSGSVEWRKASQKCSTYILSITS 442          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: NGLY1_CHICK (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Gallus gallus GN=NGLY1 PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.789e-50
Identity = 106/226 (46.90%), Postives = 142/226 (62.83%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSD-EHVTKIYNAFSSILHKFVEDSLT 675
            RFPRYN+P KL+ETR GRCGEWANCFTL CRA G+E+R V D+TDHVWTE YS +  RW+H DP E + D+PLLYE GWGKKL+YVIA +KD V DVT RY+ K  EVL+RR   +E+ +   + +I K+ +++ +      L ER  +E   L   +      P    GR SG   WRIAR E G++        + I S+ E  +K+++    +++  VEDS T
Sbjct:  287 RFPRYNNPEKLLETRRGRCGEWANCFTLCCRAVGFEARYVRDWTDHVWTEVYSASQKRWLHCDPCENVCDKPLLYEIGWGKKLSYVIAFSKDEVVDVTWRYSCKHQEVLTRRTALSEAKLRETINAINKKKQQSLSEGRRKELLERTIVE---LAEFISPKTPKPGEFGGRTSGSMAWRIARGETGSEERKE---VIFIPSEKEKASKLFH----LMYNVVEDSYT 502          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: NGLY1_HUMAN (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Homo sapiens GN=NGLY1 PE=1 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.226e-46
Identity = 97/207 (46.86%), Postives = 125/207 (60.39%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTDSLSSSSCTVRICSDEHVTK 621
            RFPRYN+P KL+ETR GRCGEWANCFTL CRA G+E+R V D+TDHVWTE YS +  RW+H D  E + D+PLLYE GWGKKL+YVIA +KD V DVT RY+ K  EV++RR    E+ +   +  + K+ +   +      L +R  +E   L   +      P  L GR SG   WR+AR E G   L         C +E ++K
Sbjct:  291 RFPRYNNPEKLLETRCGRCGEWANCFTLCCRAVGFEARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCDKPLLYEIGWGKKLSYVIAFSKDEVVDVTWRYSCKHEEVIARRTKVKEALLRDTINGLNKQRQLFLSENRRKELLQRIIVE---LVEFISPKTPKPGELGGRISGSVAWRVARGEMG---LQRKETLFIPCENEKISK 491          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: NGLY1_MOUSE (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Mus musculus GN=Ngly1 PE=1 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 4.525e-46
Identity = 93/188 (49.47%), Postives = 120/188 (63.83%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFGTD 564
            RFPRYN+P KL+ETR GRCGEWANCFTL CRA G+E+R V D+TDHVWTE YS +  RW+H D  E + D+PLLYE GWGKKL+Y+IA +KD V DVT RY+ K +EV+SRR    E  +   +  + K+ + + +      L +R  +E   L   +      P  L GR SG   WR+AR E G +
Sbjct:  288 RFPRYNNPEKLLETRCGRCGEWANCFTLCCRALGFEARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCDKPLLYEIGWGKKLSYIIAFSKDEVVDVTWRYSCKHDEVMSRRTKVKEELLRETINGLNKQRQLSLSESRRKELLQRIIVE---LVEFISPKTPRPGELGGRVSGSLAWRVARGETGLE 472          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: NGLY1_MACFA (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Macaca fascicularis GN=NGLY1 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 6.923e-46
Identity = 96/193 (49.74%), Postives = 117/193 (60.62%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERD-------LRSTDDAPISLPGRQSGDKQWRIARSEFG 558
            RFPRYN+P KL+ETR GRCGEWANCFTL CRA G+E+R V D+TDHVWTE YS +  RW+H D  E + D+PLLYE GWGKKL+YVIA +KD V DVT RY+ K  EV++RR          V  ++ +E       Q    L E  N  +E L+R        +      P  L GR SG   WR+AR E G
Sbjct:  291 RFPRYNNPEKLLETRCGRCGEWANCFTLCCRALGFEARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCDKPLLYEIGWGKKLSYVIAFSKDEVVDVTWRYSCKHEEVIARRT--------KVKEALLRETINGLNKQRQLFLSE--NRRKELLQRIIVELVEFISPKTPKPGELGGRISGSVAWRVARGEMG 473          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: NGLY1_DANRE (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Danio rerio GN=ngly1 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.658e-45
Identity = 94/186 (50.54%), Postives = 119/186 (63.98%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSEFG 558
            RFPRYN+P KL+ETR GRCGEWANCFTL CRA G E+R + D TDHVWTE YS++  RW+H DP E   D+PLLYE GWGKKL+Y++A +KD V DVT RY+ K  EVLSRR    E+ ++ +L  +  E ++   ++    L +R  +E   L   +      P  L GR SG   WR AR E G
Sbjct:  276 RFPRYNNPEKLLETRKGRCGEWANCFTLLCRALGLEARYIWDSTDHVWTEVYSQSQRRWIHCDPCENACDKPLLYEVGWGKKLSYILAFSKDQVADVTWRYSCKHPEVLSRRTQVQETWLLHMLNKLNAERQQFLGAERKQQLLQRLLVE---LVEFISPKSPQPGELGGRMSGSLAWRAARGETG 458          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: NGLY1_RAT (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Rattus norvegicus GN=Ngly1 PE=2 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 1.368e-44
Identity = 92/186 (49.46%), Postives = 118/186 (63.44%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALE--RDLRSTDDAPISLPGRQSGDKQWRIARSE 552
            RFPRYN+P KL+ETR GRCGEWANCFTL CRA G+E+R V D+TDHVWTE YS +  RW+H D  E + D+PLLYE GWGKKL+Y+IA +KD V DVT RY+ K  EV+SRR    E  +   +  + K+        +LS    ++ ++R  +E    +      P  L GR SG   WR+AR E
Sbjct:  288 RFPRYNNPEKLLETRCGRCGEWANCFTLCCRALGFEARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCDKPLLYEIGWGKKLSYIIAFSKDEVVDVTWRYSCKHEEVMSRRTKVKEELLRETINGLNKQ-----RQLLLSESRRKELLQRIIVELVEFISPKTPRPGELGGRVSGSLAWRVARGE 468          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: PNG1_YARLI (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PNG1 PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.034e-39
Identity = 86/191 (45.03%), Postives = 117/191 (61.26%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTD-DAP--ISLPGRQSGDKQWRIARSEFGTD 564
            RFPRYND  KL+ETR GRCGEWA CF  +CRA G  +R + +  DHVW+E YSE    W+H D  E  ++ P +Y +GWGKK++YV+  + DGV DVT+RY RK ++ L  R +  +    ++L SIT + R+N +      L+  D    EA ER+L S + D P    +P RQSG  +W  AR E G+D
Sbjct:  171 RFPRYNDLSKLMETRRGRCGEWAKCFAFFCRALGLRTRYIWNAEDHVWSEVYSERRKEWIHTDSCEEAWNSPTIYSQGWGKKMSYVVGFSGDGVTDVTRRYVRKADQQLP-RTMVPDEQFKTILNSITSDIRQNLSPSEKEELKRED----EAEERELASYNADEPQEAQMP-RQSGSVEWTKARGEGGSD 355          
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Match: NGLY1_DROME (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Drosophila melanogaster GN=Pngl PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 8.804e-39
Identity = 78/184 (42.39%), Postives = 114/184 (61.96%), Query Frame = 1
Query:    1 RFPRYNDPLKLVETRTGRCGEWANCFTLYCRAFGYESRLVLDFTDHVWTECYSEALGRWMHLDPGEAIYDRPLLYEKGWGKKLNYVIAIAKDGVYDVTKRYTRKWNEVLSRRAIXXXXXXXXXXXXXXKECRRNCTSQVLSILEERDNIEREALERDLRSTDDAPISLPGRQSGDKQWRIARSE 552
            +F RYND  +L+ +R GRCGE+ANCFT  CRA  Y++R+V    DHVWTE YSEA  RW+H+DP E + D PL+Y+ GW + ++Y++A ++D + DVT RYT    ++L  R +  E  +V  L +I  + R+NCT+     L +R+  E   L  + + T++    L GR SG   WR +R E
Sbjct:  278 KFYRYNDISQLLVSRKGRCGEYANCFTFLCRALDYDARIVHSHFDHVWTEVYSEAQMRWLHVDPSENVIDSPLMYQHGWKRHIDYILAYSRDDIQDVTWRYTNDHQKILHLRKLCGEKEMVQTLDAIRAKRRQNCTADRKLFLSQRNMYEVIGLTLERKPTEN---ELKGRSSGSLSWRQSRGE 458          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NA55_GOSAR0.000e+0100.00Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
A0A0D2SL89_GOSRA0.000e+096.69Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2SSI3_GOSRA0.000e+096.72Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061F345_THECC0.000e+086.57Peptide n-glycanase, putative isoform 1 OS=Theobro... [more]
A0A061F2G7_THECC0.000e+086.57Peptide n-glycanase, putative isoform 2 OS=Theobro... [more]
A0A0D2TN07_GOSRA0.000e+097.09Uncharacterized protein OS=Gossypium raimondii GN=... [more]
V4SF08_9ROSI0.000e+071.96Uncharacterized protein OS=Citrus clementina GN=CI... [more]
A0A067JLF1_JATCU0.000e+070.78Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
W9RI70_9ROSA0.000e+070.95Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
D7TUL1_VITVI0.000e+068.99Putative uncharacterized protein OS=Vitis vinifera... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0010435 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
PNG1_ARATH0.000e+065.15Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
PNG1_ORYSJ1.461e-7364.95Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
NGLY1_CHICK3.789e-5046.90Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
NGLY1_HUMAN4.226e-4646.86Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
NGLY1_MOUSE4.525e-4649.47Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
NGLY1_MACFA6.923e-4649.74Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
NGLY1_DANRE2.658e-4550.54Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
NGLY1_RAT1.368e-4449.46Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
PNG1_YARLI1.034e-3945.03Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
NGLY1_DROME8.804e-3942.39Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002931Transglutaminase-likeSMARTSM00460TG_5coord: 3..58
e-value: 6.0E-14
score: 62.3
IPR018325Rad4/PNGase transglutaminase-like foldPFAMPF03835Rad4coord: 38..146
e-value: 5.5E-10
score: 39.0
NoneNo IPR availablePANTHERPTHR12143:SF19PEPTIDE-N(4)-(N-ACETYL-BETA-GLUCOSAMINYL)ASPARAGINE AMIDASEcoord: 252..306
coord: 357..422
NoneNo IPR availablePANTHERPTHR12143PEPTIDE N-GLYCANASE PNGASE -RELATEDcoord: 1..222
NoneNo IPR availablePANTHERPTHR12143:SF19PEPTIDE-N(4)-(N-ACETYL-BETA-GLUCOSAMINYL)ASPARAGINE AMIDASEcoord: 1..222
NoneNo IPR availablePANTHERPTHR12143PEPTIDE N-GLYCANASE PNGASE -RELATEDcoord: 252..306
coord: 357..422
NoneNo IPR availableSUPERFAMILY54001Cysteine proteinasescoord: 2..142

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0010435 ID=g.arboreum_cottongen_reftransV1_0010435|Name=g.arboreum_cottongen_reftransV1_0010435|organism=Gossypium arboreum|type=contig|length=1632bp
CGGTTCCCACGCTACAATGATCCACTGAAGCTTGTAGAAACAAGGACGGG
GCGTTGTGGAGAGTGGGCTAATTGCTTCACATTGTACTGTCGTGCTTTCG
GTTATGAATCTCGTCTGGTCCTGGATTTTACAGACCATGTTTGGACAGAG
TGCTATTCAGAAGCTCTAGGAAGGTGGATGCATCTTGATCCTGGTGAAGC
AATATATGACAGACCACTATTATATGAAAAAGGGTGGGGAAAGAAATTAA
ATTATGTAATTGCTATTGCAAAAGATGGAGTTTATGATGTCACTAAACGT
TATACACGGAAGTGGAATGAGGTTTTGTCCCGGCGAGCCATTACCACAGA
GTCCTCTGTGGTGTCTGTTCTCACTTCAATTACCAAAGAATGCAGAAGGA
ACTGTACATCTCAAGTTCTTTCGATACTTGAAGAGCGTGACAACATTGAA
AGGGAAGCTCTAGAGAGAGATTTACGTTCTACTGATGATGCTCCAATCTC
CTTACCTGGGAGGCAAAGTGGGGATAAACAATGGCGCATTGCAAGATCAG
AATTTGGGACTGACTCTCTGAGTTCATCTTCTTGTACAGTTCGCATATGC
AGTGATGAGCATGTTACGAAAATATACAATGCATTTTCTTCTATCCTTCA
TAAGTTTGTTGAGGATTCCTTAACTGCATCAAAAGGTGTTGAAGTTCTCA
AGATTCTTAGAGCAACTGTTGTAGATCTCAAGAAATTACCGTATAAAAAA
AGGAGAGCTTCTTTAAAGCCTAACTCTGTTGTTGGAACATCTTTGGTGCA
TCAGTTGCTGCCCTCTTTTAAAGAGTTGCTTAATGCTCTTTCACTGAAGA
GTGAACGGGATAGCAATGGCATTCTCAGTGTATGCTTAGCTGGTGATCCT
GTTCAAACTGCCTTAGCGTTGCCTGTTGCCTTGCATGCTCTGGATGAACT
GATCAGTGATCTTAGCAAATGTGACAACTTTAGTAAAGGCTCACTATCCT
TTCCTCTTCTAAGATTGAATAGAATATGTTCTGGAGCAGTCCTTGCGAGT
GGTGAGGAGCTTCCTTTTGGGATTGCCACAGCAGCATTTGATGGAACTCG
CATGTCTAAATGGGAGGAACCTAATGGTGCTAAAGGTTGTTGGATTATGT
ACAAACTATCAGCGAATATGCAGGAACTTGTTGCATATGAGTTAATGTCT
GCCAATGATGCTCCTGAACGAGACCCAATGGATTGGGTGGTTGAGGGAAG
TAATGATGGAGGATTGAGCTGGCATGTTTTGGATGAACGAAGGTCCGAGA
TGTTTGACAAACGTTTTCGACGCAAAACTTATAATGTCAAATCCACAGGT
TTCTTATCAAATATGTTCAGATTTCGGTTCTTGGCGGTAAGAGATGTTAA
ATCAACGTCACGGCTGCAAGTAGGTAGTATTGACCTCTATGCTAAGCAAA
ATTGACAGTTTTCATTAATTAATTGAAGACAAACAGTTCCAACTTGTATT
CGTGGCTTTCCTGCCTCCAAGCCGCATTGTGTTGGTTAAGAATCTGGCTT
GAGTGGAGTATTTATTGATGTGCTAAATATTTTCCCCAAATTATGTCCTG
GAGCCAAAAAAAGAAAAGAAACACTAAACTAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002931Transglutaminase-like
IPR018325Rad4/PNGase_transGLS-fold