g.arboreum_cottongen_reftransV1_0015123, g.arboreum_cottongen_reftransV1_0015123 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0015123
Unique Nameg.arboreum_cottongen_reftransV1_0015123
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1529
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr12chromosomeg.arboreum_cottongen_reftransV1_0015123:3..1529 .
Chr12:55260877..55263082 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: A0A0D2VX22_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G084400 PE=4 SV=1)

HSP 1 Score: 862.448 bits (2227), Expect = 0.000e+0
Identity = 418/426 (98.12%), Postives = 419/426 (98.36%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDNNACEDATVI VDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSM CAISDPKRLS IKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTV+TMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTK GKAKDTFYVTDVTGN VDPKIIDSIRAQIGHTALQVK NSSLAPK PHQETTMGHFFGNLFKARTFQNFKLIR
Sbjct:   15 PRVVIDNNACEDATVIQVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMSCAISDPKRLSMIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVVTMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKGGKAKDTFYVTDVTGNPVDPKIIDSIRAQIGHTALQVKCNSSLAPKLPHQETTMGHFFGNLFKARTFQNFKLIR 440          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: A0A0B0NYE3_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_22441 PE=4 SV=1)

HSP 1 Score: 840.877 bits (2171), Expect = 0.000e+0
Identity = 406/406 (100.00%), Postives = 406/406 (100.00%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTM 1218
            PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTM
Sbjct:   15 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTM 420          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: A0A061ECZ0_THECC (ACT domain repeat 6 OS=Theobroma cacao GN=TCM_017260 PE=4 SV=1)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 395/426 (92.72%), Postives = 411/426 (96.48%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDNN+ EDATVI VDSVN+HGILLEVVQVLTDMNL ITKAYISSDGGWFMDVFNVVDNDGNKI DKEV+DYIQ RIETSAGFVPSRRGSVGVMP+EEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDS GCAI+DPKRLSTIKELL NVLKGSD+LKTAKT LSAPGVMHRERRLHQIMFADRDYERVE+AGVRAVE+GSSRPQV+LLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGR+EAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGL LELCT+DRLGLLSDITRIFRENSLCI+RALISTK GKAKDTFYVTDVTGN VDPKIIDSIR QIG +ALQVK NS+L PKPPHQETTMG+FFGNLFKARTFQNFKL+R
Sbjct:   15 PRVVIDNNSSEDATVIQVDSVNRHGILLEVVQVLTDMNLVITKAYISSDGGWFMDVFNVVDNDGNKIGDKEVIDYIQRRIETSAGFVPSRRGSVGVMPSEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAINDPKRLSTIKELLYNVLKGSDELKTAKTMLSAPGVMHRERRLHQIMFADRDYERVERAGVRAVEDGSSRPQVSLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRMEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLMLELCTEDRLGLLSDITRIFRENSLCIKRALISTKGGKAKDTFYVTDVTGNPVDPKIIDSIRRQIGQSALQVKHNSNLTPKPPHQETTMGYFFGNLFKARTFQNFKLVR 440          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: A0A0D2Q393_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G043900 PE=4 SV=1)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 386/427 (90.40%), Postives = 404/427 (94.61%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRN-SSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDNNACEDATVI VDSVNKHGILLEVVQVLTDMNLTI KAYI+SDGGWFMDVFNVVDNDGNKIRDKE++DYIQ RIETSAGFVPS+RGSVGVMP+EEHTSIELAGTDRPGLLSEVCAVLADL CNVVNAEIWTHN RAAAVVHVTDDS GCAI+DPKRL  IK+LLCNVLKG+DDLKTAKT LSAPGVMHRERRLHQIMFADRDYERVEK GVRAVEE SS+PQV LLNIEKDYTVITMR+KDRPKLLFDI+CTLTDMQYVVFHGMVNT R++A QEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCT+DRLGLLSDITRIFRENSLCI+RALISTK GKAKDTFYVTD+TGN VDPKIIDSI  QIG +ALQVK N SSLAPKPPHQETTM + FGNLFKARTFQNFKLIR
Sbjct:   15 PRVVIDNNACEDATVIQVDSVNKHGILLEVVQVLTDMNLTIRKAYIASDGGWFMDVFNVVDNDGNKIRDKEIIDYIQRRIETSAGFVPSQRGSVGVMPSEEHTSIELAGTDRPGLLSEVCAVLADLRCNVVNAEIWTHNTRAAAVVHVTDDSTGCAITDPKRLLMIKDLLCNVLKGNDDLKTAKTMLSAPGVMHRERRLHQIMFADRDYERVEKTGVRAVEERSSKPQVNLLNIEKDYTVITMRAKDRPKLLFDIICTLTDMQYVVFHGMVNTTRMDANQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTEDRLGLLSDITRIFRENSLCIKRALISTKGGKAKDTFYVTDMTGNPVDPKIIDSICRQIGRSALQVKHNRSSLAPKPPHQETTMSYLFGNLFKARTFQNFKLIR 441          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: A0A0B0MC48_GOSAR ([Protein-PII] uridylyltransferase OS=Gossypium arboreum GN=F383_02170 PE=4 SV=1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 378/430 (87.91%), Postives = 397/430 (92.33%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMD---VFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRN-SSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDNNACEDATVI VDSVNKHGILLE+VQVLTDMNLTI KAYI+SDGG  +     FNVVDNDGNKIRDKE++DYIQ RIETSAGFV SRRGSVGVMP+EEHTSIELAGTDRPGLLSEVCAVLADL CNVVNAEIWTHN RAAAVVHVTDDS GCAI+D KRL  IK+LLCNVLKG+DDLKTAKT LSAPGVMHRERRLHQIMFADRDYERVE+ GVRAVEE SSRPQV LLNIEKDYTVITMR+KDRPKLLFDI+CTLTDMQYVVFHGMVNT R++A QEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCT+DRLGLLSDITRIFRENSLCI+RALISTK GKAKDTFYVTD+T N VDPKIIDSI  QIG +ALQVK N SSLAPKPPHQETTM + FGNLFKARTFQNFKLIR
Sbjct:   15 PRVVIDNNACEDATVIQVDSVNKHGILLELVQVLTDMNLTIRKAYIASDGGCIVSHVSFFNVVDNDGNKIRDKEIIDYIQRRIETSAGFVSSRRGSVGVMPSEEHTSIELAGTDRPGLLSEVCAVLADLRCNVVNAEIWTHNTRAAAVVHVTDDSTGCAITDLKRLLMIKDLLCNVLKGNDDLKTAKTMLSAPGVMHRERRLHQIMFADRDYERVERTGVRAVEERSSRPQVNLLNIEKDYTVITMRAKDRPKLLFDIICTLTDMQYVVFHGMVNTTRMDANQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTEDRLGLLSDITRIFRENSLCIKRALISTKGGKAKDTFYVTDMTENSVDPKIIDSICRQIGRSALQVKHNRSSLAPKPPHQETTMSYLFGNLFKARTFQNFKLIR 444          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: B9P4Y4_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s33460g PE=4 SV=1)

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 358/426 (84.04%), Postives = 386/426 (90.61%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDN+ACE+ATVI VDSVNKHGILL+VVQVLTDMNL ITKAYISSDG WFMDVFNVVD DG KIRDKEVMDYIQ R+E++A F PS RGSVGVMP+EEHT+IEL GTDRPGLLSEVCAVL DLHCNVVNAEIWTHN RAAAVVHVTDDS GCAI DPKRLSTI+ELLCNVLKG+DD KTA TTLS PGV  RERRLHQIMFADRDYERVE+AG+   E+ SSRP VT+LNIE+DYTV++MRSKDRPKLLFDIVCTLTDM+YVVFHGMV+TGR+EAYQEFYIRHVDGLP+SS+AER RV+QCLEAAIERRASEGLELELCT+DR+GLLSDITRIFRENSLCI+RA I TK GKAKDTFYVTDVTGN VDPKIIDSI  QIG T L VKRNS L+PKPP QETTMG+ FGNLFKART   FKLIR
Sbjct:   15 PRVVIDNDACEEATVIQVDSVNKHGILLKVVQVLTDMNLVITKAYISSDGDWFMDVFNVVDQDGKKIRDKEVMDYIQRRLESNASFAPSLRGSVGVMPSEEHTAIELTGTDRPGLLSEVCAVLTDLHCNVVNAEIWTHNTRAAAVVHVTDDSTGCAIKDPKRLSTIRELLCNVLKGNDDSKTATTTLSPPGVTSRERRLHQIMFADRDYERVERAGLARFEDKSSRPHVTVLNIERDYTVVSMRSKDRPKLLFDIVCTLTDMEYVVFHGMVSTGRMEAYQEFYIRHVDGLPVSSDAERERVVQCLEAAIERRASEGLELELCTEDRVGLLSDITRIFRENSLCIKRAEILTKGGKAKDTFYVTDVTGNPVDPKIIDSICRQIGQTKLLVKRNSILSPKPP-QETTMGYIFGNLFKART---FKLIR 436          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: A0A0D2NLV2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G043900 PE=4 SV=1)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 361/427 (84.54%), Postives = 379/427 (88.76%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRN-SSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDNNACEDATVI VDSVNKHGILLEVVQVLTDMNLTI KAYI+SDGGWFMDVFNVVDNDGNKIRDKE++DYIQ RIETSAGFVPS+RGSVGVMP+EEHTSIELAGTDRPGLLSEVCAVLADL CNVVNAEIWTHN RAAAVVHVTDDS GCAI+DPKRL  IK+LLCNVLKG+DDLKTAKT LSAPGVMHRERRLHQIMFADRDYERVEK GVRAVEE SS+PQV LLNIEKDYTVITMR+KDRPKLLFDI+CTLTDMQYVVFHGMVNT R++A QEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCT+DRLGLLSDITRIFRENSLCI+RALISTK G+                             +ALQVK N SSLAPKPPHQETTM + FGNLFKARTFQNFKLIR
Sbjct:   15 PRVVIDNNACEDATVIQVDSVNKHGILLEVVQVLTDMNLTIRKAYIASDGGWFMDVFNVVDNDGNKIRDKEIIDYIQRRIETSAGFVPSQRGSVGVMPSEEHTSIELAGTDRPGLLSEVCAVLADLRCNVVNAEIWTHNTRAAAVVHVTDDSTGCAITDPKRLLMIKDLLCNVLKGNDDLKTAKTMLSAPGVMHRERRLHQIMFADRDYERVEKTGVRAVEERSSKPQVNLLNIEKDYTVITMRAKDRPKLLFDIICTLTDMQYVVFHGMVNTTRMDANQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTEDRLGLLSDITRIFRENSLCIKRALISTKGGR-----------------------------SALQVKHNRSSLAPKPPHQETTMSYLFGNLFKARTFQNFKLIR 412          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: B9GF51_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s33460g PE=4 SV=1)

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 358/428 (83.64%), Postives = 386/428 (90.19%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQS--RIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDN+ACE+ATVI VDSVNKHGILL+VVQVLTDMNL ITKAYISSDG WFMDVFNVVD DG KIRDKEVMDYIQ   R+E++A F PS RGSVGVMP+EEHT+IEL GTDRPGLLSEVCAVL DLHCNVVNAEIWTHN RAAAVVHVTDDS GCAI DPKRLSTI+ELLCNVLKG+DD KTA TTLS PGV  RERRLHQIMFADRDYERVE+AG+   E+ SSRP VT+LNIE+DYTV++MRSKDRPKLLFDIVCTLTDM+YVVFHGMV+TGR+EAYQEFYIRHVDGLP+SS+AER RV+QCLEAAIERRASEGLELELCT+DR+GLLSDITRIFRENSLCI+RA I TK GKAKDTFYVTDVTGN VDPKIIDSI  QIG T L VKRNS L+PKPP QETTMG+ FGNLFKART   FKLIR
Sbjct:   15 PRVVIDNDACEEATVIQVDSVNKHGILLKVVQVLTDMNLVITKAYISSDGDWFMDVFNVVDQDGKKIRDKEVMDYIQRVRRLESNASFAPSLRGSVGVMPSEEHTAIELTGTDRPGLLSEVCAVLTDLHCNVVNAEIWTHNTRAAAVVHVTDDSTGCAIKDPKRLSTIRELLCNVLKGNDDSKTATTTLSPPGVTSRERRLHQIMFADRDYERVERAGLARFEDKSSRPHVTVLNIERDYTVVSMRSKDRPKLLFDIVCTLTDMEYVVFHGMVSTGRMEAYQEFYIRHVDGLPVSSDAERERVVQCLEAAIERRASEGLELELCTEDRVGLLSDITRIFRENSLCIKRAEILTKGGKAKDTFYVTDVTGNPVDPKIIDSICRQIGQTKLLVKRNSILSPKPP-QETTMGYIFGNLFKART---FKLIR 438          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: V4TIN1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10015110mg PE=4 SV=1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 358/426 (84.04%), Postives = 376/426 (88.26%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDNN C DATVI VDSVNKHGILL+V+QVL D+NL I KAYISSDGGWFMDVFNV+D DG KIRDKEV+DYIQ R+ET A F PS R SVGVMP EEHTSIE  GTDRPGL SEVCAVLADLHCNVVNAEIWTHN RAAAVVHVTD S GCAI DPKRLSTIKELL NVL+G DD + AKT+LS PG+M+RERRLHQIMF DRDYERVEKA V  VE+ SSRPQVT+LNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGR EAYQEFYIRHVDGLPISSEAER RVIQCLEAAIERRASEGLELELCT+DR+GLLSDITRIFRENSL I+RA IST  GK KDTFYVTDVTGN VDPKIIDSIR QIGHT LQVK N+ LAPKPP +ETT G F GN FKARTFQ FKLIR
Sbjct:   15 PRVVIDNNTCADATVIKVDSVNKHGILLQVIQVLNDVNLVIKKAYISSDGGWFMDVFNVIDCDGKKIRDKEVIDYIQQRLETDASFAPSLRSSVGVMPTEEHTSIEFTGTDRPGLFSEVCAVLADLHCNVVNAEIWTHNDRAAAVVHVTDHSTGCAIKDPKRLSTIKELLFNVLRGYDDFRKAKTSLSPPGIMNRERRLHQIMFDDRDYERVEKA-VGRVEDKSSRPQVTVLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRTEAYQEFYIRHVDGLPISSEAERERVIQCLEAAIERRASEGLELELCTEDRVGLLSDITRIFRENSLSIKRAEISTIGGKVKDTFYVTDVTGNPVDPKIIDSIRRQIGHTKLQVKHNTILAPKPP-KETTTGFFLGNFFKARTFQTFKLIR 438          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Match: B9RH43_RICCO (Amino acid binding protein, putative OS=Ricinus communis GN=RCOM_1447090 PE=4 SV=1)

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 352/427 (82.44%), Postives = 384/427 (89.93%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRI-EAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDN+ CEDATVI VDSVNKHGILL+VVQVLTDMNL I KAYISSDGGWFMDVFNV+D DGNKIRDKEV+ YIQ R+E++A F PS RGSVGVMP+E+HTSIEL+G DRPGLLSEVCAVLADL CNVVNAEIWTHNARAAAVVHVTDDS GCA+ DPKRLSTIKELLCNVLKG++DLK AK TLS PG+  RERRLHQIMFADRDYERV++ G+  +E+ SSRP VT+LNIEKDY+VITMRSKDRPKLLFDIVCTLTDM+YVVFHGMVN GR  EAYQEFYIRHVDGLPISS+AER RVIQCLEAAIERRASEGLELELCT+DR+GLLSDITR FRENSLCI+RA ISTK G AKDTFYVTDVTG+ VDPKI+DSI  QIG T LQVK+N +L+PKP  QETTMG+  G LFKARTFQNFKLIR
Sbjct:   15 PRVVIDNDVCEDATVIQVDSVNKHGILLQVVQVLTDMNLVIKKAYISSDGGWFMDVFNVIDQDGNKIRDKEVIGYIQRRLESNASFAPSLRGSVGVMPSEDHTSIELSGNDRPGLLSEVCAVLADLRCNVVNAEIWTHNARAAAVVHVTDDSTGCAVKDPKRLSTIKELLCNVLKGNNDLKAAKMTLSPPGITSRERRLHQIMFADRDYERVDRVGLGRLEDKSSRPHVTVLNIEKDYSVITMRSKDRPKLLFDIVCTLTDMEYVVFHGMVNAGRKEEAYQEFYIRHVDGLPISSDAERERVIQCLEAAIERRASEGLELELCTEDRVGLLSDITRTFRENSLCIKRAEISTKGGIAKDTFYVTDVTGSPVDPKIVDSICRQIGQTRLQVKQNLTLSPKPA-QETTMGYLLGTLFKARTFQNFKLIR 440          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: ACR6_ARATH (ACT domain-containing protein ACR6 OS=Arabidopsis thaliana GN=ACR6 PE=2 SV=1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 306/424 (72.17%), Postives = 346/424 (81.60%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAG-FVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSL------APKPPHQETTMGHFFGNLFKAR 1251
            PRVVIDNNA +DATVI VDSVNKHG LLEVVQVLTDMNL I KAYISSDGGWFMDVF V+D DGNKIRD +V+DYIQ RIE++AG F+P  R SVGVMP +E+TSIELAGTDRPGLLSEV AVL DLHCNVVNAEIWTHN RAAAV+HVTD+S   AI+DP RLSTIKELLCNV++ +   + AKT  S     HRERRLHQIMF DRDYE     GV+     +SRP VTL+NIEKDYTV+TMRSKDRPKL+FD+VCTLTDMQYVVFHGMV+T  +EAYQEFYIRHVDGLPI+SEAE+ RVIQCLEAAIERRASEGLELEL  +DR+GLLSDITR FRENSL I RA IST+ GKAKDTFYVTDVTGN V+ KI++SIR QIG + L+VK+            +P H+ TTMG+   N+FK +
Sbjct:   16 PRVVIDNNASDDATVIQVDSVNKHGTLLEVVQVLTDMNLVIKKAYISSDGGWFMDVFKVIDQDGNKIRDTQVLDYIQKRIESNAGWFIPPLRSSVGVMPTDEYTSIELAGTDRPGLLSEVSAVLTDLHCNVVNAEIWTHNTRAAAVIHVTDNSTHSAITDPIRLSTIKELLCNVVRTNSGSRAAKTVFSCSDT-HRERRLHQIMFDDRDYE-----GVKRARTSASRPSVTLMNIEKDYTVVTMRSKDRPKLVFDVVCTLTDMQYVVFHGMVSTEPVEAYQEFYIRHVDGLPINSEAEQERVIQCLEAAIERRASEGLELELSAEDRVGLLSDITRTFRENSLTIVRAEISTREGKAKDTFYVTDVTGNPVESKIVESIRQQIGVSKLKVKKKEKEHCSVLGTSRPSHETTTMGYLLSNIFKPK 433          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: ACR4_ARATH (ACT domain-containing protein ACR4 OS=Arabidopsis thaliana GN=ACR4 PE=2 SV=1)

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 267/430 (62.09%), Postives = 326/430 (75.81%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLN-IEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRN---SSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDN++C+ ATVI VDS N++GILLEVVQ+LTD+NLTITKAYISSDGGWFMDVFNV D DGNK+ D+ V+DYIQ  +   A F  S R SVGV+P+ + T IEL G DRPGLLSE+ AVL  L C+V+NAEIWTHN RAAAV+ VTDD  GC ISDP+RLS IK LL NVLKGS+  + AKT +S  G +H +RRLHQ+MF DRDYE        ++++   RP V + N ++KDY+V+T+R KDRPKLLFD VCTLTDMQYVVFHG V+T   EA+QE+Y+RH+DG P+ SEAE+ RVIQCLEAAI+RR SEGL+LELCT DR+GLLS++TRIFRENSL + RA + TK GKA +TFYV+D +G  +D K IDSIR  IG T L+VK N        K P  E+     FG LFK+++F NF L+R
Sbjct:   21 PRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMR-SVGVIPSTDSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISDPERLSRIKNLLRNVLKGSNTPREAKTVVSH-GEVHTDRRLHQMMFEDRDYEHRLVDDDSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAFQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQQQRQKSPSHESPTRFLFGGLFKSKSFVNFGLVR 448          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: ACR5_ARATH (ACT domain-containing protein ACR5 OS=Arabidopsis thaliana GN=ACR5 PE=2 SV=2)

HSP 1 Score: 488.419 bits (1256), Expect = 3.525e-167
Identity = 253/433 (58.43%), Postives = 316/433 (72.98%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRI--ETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDD---LKTAKTTLS-APGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNI-EKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKPPHQETTMGHFFGNLFKARTFQNFKLIR 1278
            PRVVIDN  C+D TVI VDS NKHGILLEVVQVLT++NLTI KAYISSDGGWFMDVFNV D DGNK+ D+ V++YI+  +  + S+ F PS R ++GV  + ++T +EL GTDRPGLLSE+CAVL DL CNVVNAEIWTH A+AAAV+ VTD+    AI+DP+RLS I++LL  VL G       +  KTT+S A    H +R+LHQ+MFADRDY+  E       + G   P V + N+ + DY+++ ++ KDRPKLLFD V TLTDM YVV H  ++    +AYQE+YIRH DG P+ SEAER RVI+CL+AAI+RR SEGL+LELCT DR+GLLSD+TRIFRENSL + RA + TK  KA +TFYV D +G  VD K I+SIR  IG T LQVK  ++ A KP  Q++  G  FG +FK+R+F NF LIR
Sbjct:   25 PRVVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTELNLTIKKAYISSDGGWFMDVFNVTDQDGNKVTDEIVLEYIRKSLGPDESSCFSPSMRSTIGVKQSVDYTVVELTGTDRPGLLSELCAVLMDLQCNVVNAEIWTHRAKAAAVLQVTDEETCSAITDPERLSKIRKLLGYVLTGGSSGRRFREPKTTVSSALNETHTDRKLHQLMFADRDYDEWENNVDDEDKCGRVIPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMNYVVSHASIDAEGPQAYQEYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSDRVGLLSDVTRIFRENSLTVTRAEVKTKGDKALNTFYVRDASGYQVDTKTIESIRQVIGQTILQVKGGNTDA-KPSPQDSPTGFLFG-VFKSRSFVNFGLIR 455          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: ACR3_ARATH (ACT domain-containing protein ACR3 OS=Arabidopsis thaliana GN=ACR3 PE=2 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 4.062e-137
Identity = 222/432 (51.39%), Postives = 292/432 (67.59%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRI------ETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSD--DLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNIE-KDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNS--SLAPKPPHQETTMG------HFFGNLFK 1245
            P V IDN +C++ T++ VDS+NK GILLEVVQVLTD++LTITKAYISSDGGWFMDVF+V D  GNK+ D + +DYI+  +        S    P +R  VGV    +HTSIE+   DRPGLLSEV AVLADL+ NVV AE WTHN R A V++V D++   A+ DP+RLS+++E L NVL+G +  D K A+T+LS  G  H +RRLHQ+ FADRDYE V K    A       P++T+ + E K Y+VI +  +DRPKL+FDIVCTLTDMQY+VFH  +++    A QE++IRH DG  + +E E+ RV++CLEAAI RR SEG  LELC  DR+GLLS++TRI RE+ L + RA ++T   +A + FYV D +GN VD K I+++R +IGH+ +   +N   S   K   Q  T G       FFGNL +
Sbjct:   23 PSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLDLTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGHASASQNTWPGKR--VGVHSLGDHTSIEIIARDRPGLLSEVSAVLADLNINVVAAEAWTHNRRIACVLYVNDNATSRAVDDPERLSSMEEQLNNVLRGCEEQDEKFARTSLSI-GSTHVDRRLHQMFFADRDYEAVTKLDDSA--SCGFEPKITVEHCEEKGYSVINVSCEDRPKLMFDIVCTLTDMQYIVFHATISSSGSHASQEYFIRHKDGCTLDTEGEKERVVKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVTRILREHGLSVSRAGVTTVGEQAVNVFYVKDASGNPVDVKTIEALRGEIGHSMMIDFKNKVPSRKWKEEGQAGTGGGWAKTSFFFGNLLE 449          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: ACR8_ARATH (ACT domain-containing protein ACR8 OS=Arabidopsis thaliana GN=ACR8 PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 2.430e-130
Identity = 219/433 (50.58%), Postives = 286/433 (66.05%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTA-KTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLNI-EKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPKP---PHQETTMGHF--FGNLFKARTFQNFKLIR 1278
            PRVVIDN  C  AT++ VDS  ++GILLE VQ+LTD+NL+I KAYISSDG W MDVF+V D +GNK+ D+ V+ YI+  IET   +        G+      T++EL GTDR GLLSE+ AVL+DL+C+VV+A++WTHN R A+V+++ D   G  I D  R+S I+  L NVL G +D+ +A KT ++   +MH ERRLHQ+MF DRDYER  K       E S    VT+ N  E+ Y+V+ +  +DR KLLFD+VCTLTDM+Y VFH  +NT   +A+ EFYIRH DG PISSEAER RVIQCLEAA+ERRA EG+ LEL   D+ GLL+++TR FREN L + R  IST S  A + FYVTD  G+  D K+I+S+R +IG   L+VK   ++  K      Q+ T       G+L   R   NF LI+
Sbjct:   20 PRVVIDNGVCSSATIVKVDSSRRNGILLEAVQILTDLNLSIKKAYISSDGTWNMDVFHVTDLNGNKLNDQSVLRYIEQSIETV--YYGENIEVNGL------TALELTGTDRIGLLSEMFAVLSDLNCDVVDAKLWTHNGRVASVIYLKDCISGAPILDSHRISKIEGRLKNVLNGDNDVNSAAKTCVTVDSMMHIERRLHQLMFEDRDYERRSKK-----HERSPMVVVTVQNWAERGYSVVNVHCRDRTKLLFDVVCTLTDMEYAVFHATINTAEDQAHLEFYIRHKDGSPISSEAERQRVIQCLEAAVERRALEGVRLELRHPDKQGLLAEVTRTFRENGLNVTRTEISTSSDMATNIFYVTDANGDEPDFKLIESVREKIGLECLRVKEMPTMYHKKGDGEEQQQTKAVLVSLGSLV-WRNLFNFGLIK 438          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: ACR7_ARATH (ACT domain-containing protein ACR7 OS=Arabidopsis thaliana GN=ACR7 PE=2 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 4.537e-125
Identity = 208/396 (52.53%), Postives = 266/396 (67.17%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETSAGFVPSRRGSVGVMPAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAI-SDPKRLSTIKELLCNVLKGSDDLKT-AKTTLSAPGVMHRERRLHQIMFADRDYER---VEKAGVRAVEEGSSRPQVTLLNIEK-DYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVK 1170
            PRVVIDN  C ++TV+ +DS    GILLE VQ+LTDMNL I KAYISSDG W MDVF+V D +G+K+ D+ ++ YI+  IETS        G  G+      T++EL GTDR GLLSEV AVLADL C+VV A+ WTHN R A++++V D + G  I  D  R+  ++  L N+LK  D  +   +T +S  G  H ERRLHQ MF DRDYE+   +EK+           P V++ N+ K  Y+V+ ++ KDR KLLFD+VCTLTDM Y+VFH  + T    A+ EFY+RH DG P+SSE ER R+IQCL+AAIERR  +G+ LELCT DR GLL+++TRI REN L I RA ISTK   A++ FYVTD  GNL+DP+II SIR +IG   L VK
Sbjct:   20 PRVVIDNGVCPNSTVVKIDSARSPGILLESVQLLTDMNLWIKKAYISSDGKWNMDVFHVSDLNGDKLTDENLIRYIEKSIETS--HYCKTEGYTGL------TALELTGTDRVGLLSEVFAVLADLECDVVEAKAWTHNGRIASMIYVKDGNSGTPIDGDSDRVQRVEGQLRNLLKADDGYQNDTRTCVSYGGNTHMERRLHQRMFMDRDYEKKFDIEKS-----------PIVSVQNLPKRGYSVVNLQCKDRMKLLFDVVCTLTDMAYIVFHAAIRTVGETAFLEFYVRHSDGHPVSSEPERQRLIQCLQAAIERRTVKGVRLELCTADRPGLLAEVTRILRENGLNIARAEISTKDSIARNVFYVTDANGNLIDPEIIKSIREKIGIDDLSVK 396          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: ACR2_ARATH (ACT domain-containing protein ACR2 OS=Arabidopsis thaliana GN=ACR2 PE=3 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 1.437e-118
Identity = 186/423 (43.97%), Postives = 279/423 (65.96%), Query Frame = 1
Query:    4 RVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETS---AGFVPSRRGSVGVMPAE-----EHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTL-------------SAPGVMHR--ERRLHQIMFADRDYER------VEKAGVRAVEEGSSRP-QVTLLNI----EKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVK 1170
            RV IDN++ +D TV+ V+S NK G+LLEVVQ+LTDMNL ITK+YISSDGGWFMDVF+V D  GNK+ DK V+++I+  I TS   + F+ +   +   +  +     EHT+IE+ GTDRPGL SE+ A  ADLHCNV+ A  W+HNAR A + +V+DD+    I DP RL++I++ L  V++ + D  +  T +                G M+   ERRLHQ+M + RD++               +E    +  + T+++I    E+ Y+++T++SKDR +L+FD +CTL DMQYV+FH  + +   +A+QE++IRH+DG  +++E E+ RVI+CLEAAIERR  EG++LELC ++R+GLLSDITR+ REN L + RA + T+  K+ + FYV D++GN +D + ++S++ ++    L+VK
Sbjct:   26 RVYIDNDSIQDCTVVKVNSENKQGLLLEVVQILTDMNLIITKSYISSDGGWFMDVFHVKDEHGNKLTDKSVINHIKHAIGTSRRESDFIKASEANNNSLEPQLADHGEHTAIEMTGTDRPGLFSEIFAAFADLHCNVMEAHAWSHNARLACIAYVSDDNTHTPIDDPSRLASIEDHLSTVIRATADPASNSTHVGHKENETDGFLAGQGKGCMNSNMERRLHQLMLSVRDFDEPFCEPSSLSLLSSKLEYCDHKERKTTIVSIGNCEERGYSIVTVKSKDRRRLMFDTICTLVDMQYVIFHAALRSDGADAFQEYFIRHIDGRALNTEGEKERVIKCLEAAIERRVCEGVKLELCAENRVGLLSDITRVLRENGLTVVRADVETQGQKSLNAFYVRDISGNKIDMEFVESVKKEMRPIHLEVK 448          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: ACR1_ARATH (ACT domain-containing protein ACR1 OS=Arabidopsis thaliana GN=ACR1 PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 1.768e-95
Identity = 168/418 (40.19%), Postives = 252/418 (60.29%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDNDGNKIRDKEVMDYIQSRIETS--AGFVPSRRGSVGVMPAE-----EHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKG----SDDLKTAKTTLSAPGV----MHRERRLHQIMFADRDYERV---EKAGVRAVEEGSSRPQVTLLNIE--KDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTDDRLGLLSDITRIFRENSLCIRRALISTKSGKAKDTFYVTDVTGNLVDPKIIDSIRAQIGHTALQVKRNSSLAPK 1194
            PRV +DN++  + T+I VDS NK+GILL++VQVL D++L I+K YISSDG WFMDVF+V D  GNK+ D+ ++ YIQ  I +S   G     + ++     +     EHT+ E+ G +RPGLLSE+ AVL+D+ C+V  A  WTH+ RAA V+++ D   G  I DP R + +K+ L  V++      D        + A GV     H ERRLH++M+ + DYE     +  G R       R +   + IE    Y+++ ++ +DRPKLLFD VC L ++Q+VVFH +       A QE++IR  +G  + +E +R R+  CL AAI RRAS+GL+LE+ T++++GLLSD+TR+ REN L I RA + T+   A  +FYVTDV G    P  ++++  ++G   +   +   + P+
Sbjct:   24 PRVCVDNDSDPECTLIKVDSANKYGILLDMVQVLADLDLVISKCYISSDGEWFMDVFHVTDQLGNKLTDRSLILYIQQAICSSRTGGITKEMQSNLKREVQQRHVSTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLEDGFNGGPIIDPIRKAQVKDHLDTVMEAHHIVGDVSHVVVRVVEAKGVPVGWAHTERRLHELMYGEGDYENCFDCDCFGDRCDALWRGRCERIHVTIEACNGYSMVNVKCRDRPKLLFDTVCALKELQFVVFHAVAGAKGSTAEQEYFIRKKNGGTLETEGQRERLRHCLVAAISRRASQGLKLEIRTENKMGLLSDVTRVVRENGLSITRAEMCTQGEIAVGSFYVTDVNGGETGPSEVEAVVRELGGAVVSAVKGVGMMPR 441          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: ACR12_ARATH (ACT domain-containing protein ACR12 OS=Arabidopsis thaliana GN=ACR12 PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.363e-9
Identity = 48/177 (27.12%), Postives = 83/177 (46.89%), Query Frame = 1
Query:    1 PRVVIDNNACEDATVIHVDSVNKHGILLEVVQVLTDMNLTITKAYISSDGGWFMDVFNVVDND-GNKIRDKEVMDYIQSRI------------------ETSAGFVPSRRGSVGVM---------PAEEHTSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVT 447
            P V+ID +A  +AT++ +   N+ G L++ ++ L D+ L + K  +S++G      F++   D G K+ D ++++ I+  I                  ET     P ++  V +          P      IE A  DRPGL+ E+  V+AD++ +V +AEI T    A    HV+
Sbjct:   95 PMVMIDQDADPEATIVQLSFGNRLGALIDTMRALKDLGLDVIKGTVSTEGSIKQTKFSITKRDTGRKVEDPDLLEQIRLTIINNLLKYHPECSEQLAMGETFGIKAPEKKIDVDIATHIHVKEDGPKRSLLVIETA--DRPGLVVEMIKVMADVNIDVESAEIDTEGLVAKDKFHVS 269          
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Match: GLND_RHORT (Bifunctional uridylyltransferase/uridylyl-removing enzyme OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=glnD PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 5.933e-9
Identity = 60/233 (25.75%), Postives = 102/233 (43.78%), Query Frame = 1
Query:  277 SVGVMPAEEH--TSIELAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSMGCAISDPKRLSTIKELLCNVLKGSDDLKTAKTTLSAPGVMHRERRLHQIMFADRDYERVEKAGVRAVEEGSSRPQVTLLN-IEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRIEAYQEFYIRHVDGLPISSEAERVRVIQCLEAAI----ERRASEGLE 954
            +V V+P  E   + + +A  D PGL S++   +A    N+++A+I T +   A  +       G AI   +R++ + + + +VL G   L+ A      P +  R R L                        +  P+V + N   K +TVI +  +DRP  L+ +   LTD+   +    V+T        FY++ V G+ I   A+  ++ + LEAAI     R+  EG E
Sbjct:  715 AVEVLPDPERAVSEVLVATDDHPGLFSKIAGAMALAGVNILDAKITTMSDGGALDIFTVQTLEGHAIEKEERIARLAKTVRDVLTGDLPLEKALRR-QPPRLPERTRHL------------------------TVPPRVIVDNQASKTHTVIEINGRDRPGFLYAVTRALTDVAVQISSARVSTYGERVVDSFYVKDVFGMKIVHRAKLAQIREALEAAITQTVPRKVEEGAE 922          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2VX22_GOSRA0.000e+098.12Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0NYE3_GOSAR0.000e+0100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A061ECZ0_THECC0.000e+092.72ACT domain repeat 6 OS=Theobroma cacao GN=TCM_0172... [more]
A0A0D2Q393_GOSRA0.000e+090.40Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MC48_GOSAR0.000e+087.91[Protein-PII] uridylyltransferase OS=Gossypium arb... [more]
B9P4Y4_POPTR0.000e+084.04Uncharacterized protein OS=Populus trichocarpa GN=... [more]
A0A0D2NLV2_GOSRA0.000e+084.54Uncharacterized protein OS=Gossypium raimondii GN=... [more]
B9GF51_POPTR0.000e+083.64Uncharacterized protein OS=Populus trichocarpa GN=... [more]
V4TIN1_9ROSI0.000e+084.04Uncharacterized protein OS=Citrus clementina GN=CI... [more]
B9RH43_RICCO0.000e+082.44Amino acid binding protein, putative OS=Ricinus co... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0015123 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
ACR6_ARATH0.000e+072.17ACT domain-containing protein ACR6 OS=Arabidopsis ... [more]
ACR4_ARATH0.000e+062.09ACT domain-containing protein ACR4 OS=Arabidopsis ... [more]
ACR5_ARATH3.525e-16758.43ACT domain-containing protein ACR5 OS=Arabidopsis ... [more]
ACR3_ARATH4.062e-13751.39ACT domain-containing protein ACR3 OS=Arabidopsis ... [more]
ACR8_ARATH2.430e-13050.58ACT domain-containing protein ACR8 OS=Arabidopsis ... [more]
ACR7_ARATH4.537e-12552.53ACT domain-containing protein ACR7 OS=Arabidopsis ... [more]
ACR2_ARATH1.437e-11843.97ACT domain-containing protein ACR2 OS=Arabidopsis ... [more]
ACR1_ARATH1.768e-9540.19ACT domain-containing protein ACR1 OS=Arabidopsis ... [more]
ACR12_ARATH4.363e-927.12ACT domain-containing protein ACR12 OS=Arabidopsis... [more]
GLND_RHORT5.933e-925.75Bifunctional uridylyltransferase/uridylyl-removing... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002912ACT domainPFAMPF01842ACTcoord: 77..124
e-value: 1.9E-9
score: 37.0
IPR002912ACT domainPROSITEPS51671ACTcoord: 77..161
score: 11.908
IPR002912ACT domainPROSITEPS51671ACTcoord: 291..370
score: 11.87
IPR002912ACT domainPROSITEPS51671ACTcoord: 1..67
score: 7.074
NoneNo IPR availableGENE3D3.30.70.260coord: 287..357
e-value: 1.0E-9
score: 37.7
coord: 72..145
e-value: 9.1E-19
score: 66.8
NoneNo IPR availablePANTHERPTHR31096FAMILY NOT NAMEDcoord: 1..402
NoneNo IPR availablePANTHERPTHR31096:SF22ACR6coord: 1..402
NoneNo IPR availableSUPERFAMILY55021ACT-likecoord: 2..50
NoneNo IPR availableSUPERFAMILY55021ACT-likecoord: 287..357
NoneNo IPR availableSUPERFAMILY55021ACT-likecoord: 72..146

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0015123 ID=g.arboreum_cottongen_reftransV1_0015123|Name=g.arboreum_cottongen_reftransV1_0015123|organism=Gossypium arboreum|type=contig|length=1529bp
CCCAGAGTTGTGATTGACAACAATGCTTGTGAGGATGCCACTGTTATCCA
TGTTGACAGTGTCAACAAACATGGGATTCTCCTGGAAGTTGTCCAAGTGC
TTACAGATATGAATCTTACAATAACAAAGGCATACATATCATCTGATGGA
GGATGGTTTATGGATGTCTTTAATGTTGTTGACAATGATGGCAACAAAAT
CAGAGATAAGGAAGTTATGGACTATATTCAGAGTAGAATTGAAACTAGTG
CTGGCTTTGTGCCATCACGGAGAGGCTCCGTAGGCGTGATGCCTGCAGAA
GAGCATACATCGATTGAACTTGCTGGCACTGATAGGCCTGGTCTATTATC
TGAAGTATGTGCAGTTCTTGCTGACCTCCATTGCAATGTTGTAAATGCTG
AGATATGGACCCATAATGCTAGGGCAGCTGCCGTAGTTCATGTGACAGAT
GATTCAATGGGCTGCGCAATCAGTGATCCAAAACGTCTCTCAACGATAAA
GGAATTGCTTTGTAATGTTCTCAAAGGAAGTGATGACTTGAAAACTGCAA
AGACAACACTTTCAGCTCCAGGTGTTATGCACAGGGAGAGAAGGTTGCAT
CAAATCATGTTCGCAGACAGGGACTATGAAAGGGTCGAGAAAGCAGGAGT
TAGGGCGGTAGAGGAAGGGAGTTCAAGACCTCAAGTCACTCTGTTGAATA
TCGAGAAAGATTACACTGTTATTACCATGAGGTCAAAAGATAGGCCGAAA
CTATTGTTTGATATAGTCTGCACTCTCACAGATATGCAATATGTTGTTTT
TCATGGAATGGTGAACACAGGAAGGATCGAAGCTTATCAGGAATTCTACA
TCAGACATGTAGATGGGCTCCCCATTAGCTCGGAAGCTGAGCGTGTTCGT
GTTATTCAATGTCTAGAAGCAGCCATTGAGAGGAGGGCATCTGAGGGGCT
GGAACTAGAATTGTGCACAGACGACAGACTTGGACTCCTGTCTGACATCA
CCCGTATATTCCGGGAAAACAGCTTGTGTATCAGGAGAGCATTAATTTCA
ACAAAGAGTGGCAAGGCCAAGGACACCTTCTATGTCACAGACGTGACAGG
AAATCTAGTTGATCCCAAGATCATCGATTCTATCCGTGCACAGATTGGAC
ATACCGCATTACAGGTGAAACGTAACTCAAGTCTTGCACCAAAACCACCT
CATCAGGAGACAACAATGGGTCATTTCTTTGGAAATCTATTCAAAGCTCG
AACTTTTCAGAATTTCAAGTTAATCAGATCTTACTCTTGAGACATCTCCT
CCTCTTTTAAGTAGATATATTTGTACAGGAATATCAGATATTAAACCAAA
AGATATACATAGGGAGAAAACACTGTAAATATTTAGCTTCTCCCTTGCTT
GGTTACCAATGTCCTGATACTGCAAAGGAAAAGAAAAAAAATCAGCCAGT
CACTATACTGTAAAAGTTACTGCTGGTATTTGTATATCTTCACTGTATCT
ATTGTAAGTAACATTTGTATAGTTTAATA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002912ACT_dom
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0016597amino acid binding