g.arboreum_cottongen_reftransV1_0012086, g.arboreum_cottongen_reftransV1_0012086 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0012086
Unique Nameg.arboreum_cottongen_reftransV1_0012086
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length504
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr6chromosomeg.arboreum_cottongen_reftransV1_0012086:1..501 .
Chr6:56744299..56744799 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: A0A0D2SQP1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G245000 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.031e-64
Identity = 98/101 (97.03%), Postives = 101/101 (100.00%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 304
            +KKHAEE+RIKSARGREKSSDDIF+CERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS
Sbjct:   25 KKKHAEEERIKSARGREKSSDDIFVCERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 125          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: A0A061DJX8_THECC (Uncharacterized protein isoform 1 OS=Theobroma cacao GN=TCM_001262 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 6.590e-62
Identity = 96/101 (95.05%), Postives = 99/101 (98.02%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 304
            +K+ AEEQRIKSARGREKSSDDIF+CERVCTSKRMLKKVGAFSKDPI DTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS
Sbjct:   64 KKRRAEEQRIKSARGREKSSDDIFVCERVCTSKRMLKKVGAFSKDPIRDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 164          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: A0A061DJ25_THECC (Uncharacterized protein isoform 2 OS=Theobroma cacao GN=TCM_001262 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 1.708e-61
Identity = 96/101 (95.05%), Postives = 99/101 (98.02%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 304
            +K+ AEEQRIKSARGREKSSDDIF+CERVCTSKRMLKKVGAFSKDPI DTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS
Sbjct:   25 KKRRAEEQRIKSARGREKSSDDIFVCERVCTSKRMLKKVGAFSKDPIRDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 125          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: A0A0A0KJ71_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G486990 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 4.215e-60
Identity = 88/101 (87.13%), Postives = 101/101 (100.00%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 304
            +++H+EEQRIK+ARGREK+SDDIF+CERVCTSKRMLKKVG+FSKDPIPDTCVTVCG+SELDAC+DACARTVCVNQHQVPNWND+CLRRCQSECL+LSAS+S
Sbjct:   25 KRRHSEEQRIKTARGREKNSDDIFVCERVCTSKRMLKKVGSFSKDPIPDTCVTVCGLSELDACTDACARTVCVNQHQVPNWNDVCLRRCQSECLKLSASYS 125          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: W9SAI8_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_008327 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.304e-60
Identity = 89/101 (88.12%), Postives = 100/101 (99.01%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 304
            +KKHAEEQR++SARGREK++D+IF+CERVCTSKRMLK+VGAFSKDPIPDTCVTVCG+SELDAC+DACARTVCVNQHQVPNWNDICLRRCQSECL+LSAS S
Sbjct:   24 KKKHAEEQRLQSARGREKTADEIFVCERVCTSKRMLKRVGAFSKDPIPDTCVTVCGISELDACADACARTVCVNQHQVPNWNDICLRRCQSECLKLSASRS 124          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: M1D319_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400031197 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 6.233e-60
Identity = 90/99 (90.91%), Postives = 98/99 (98.99%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSAS 298
            R+ HAEEQRIKSARGREKS+DDIF+CERVCTSKRMLKKVGAFSKDPIPDTC+TVCGVSELDACSDACARTVCVNQHQVPNWND+CLRRCQSECL+LS++
Sbjct:   25 RRNHAEEQRIKSARGREKSTDDIFVCERVCTSKRMLKKVGAFSKDPIPDTCITVCGVSELDACSDACARTVCVNQHQVPNWNDVCLRRCQSECLKLSSN 123          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: A0A0B0NIZ7_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_18594 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 9.537e-60
Identity = 91/101 (90.10%), Postives = 100/101 (99.01%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 304
            +K+HAE+Q+IKSARGREK++DD+F+CERVCTSKRMLKKVGAFSKDPI DTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSAS+S
Sbjct:   25 KKRHAEDQKIKSARGREKTADDVFVCERVCTSKRMLKKVGAFSKDPIRDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASNS 125          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: K4BSD0_SOLLC (Uncharacterized protein OS=Solanum lycopersicum GN=Solyc04g051710.1 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.622e-59
Identity = 89/99 (89.90%), Postives = 98/99 (98.99%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSAS 298
            ++ HAEEQRIKSARGREKS+DDIF+CERVCTSKRMLKKVGAFSKDPIPDTC+TVCGVSELDACSDACARTVCVNQHQVPNWND+CLRRCQSECL+LS++
Sbjct:   25 KRNHAEEQRIKSARGREKSTDDIFVCERVCTSKRMLKKVGAFSKDPIPDTCITVCGVSELDACSDACARTVCVNQHQVPNWNDVCLRRCQSECLKLSSN 123          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: A0A0D2T6G8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G114100 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.696e-59
Identity = 90/101 (89.11%), Postives = 100/101 (99.01%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASHS 304
            +K+HAE+Q++KSARGREK++DD+F+CERVCTSKRMLKKVGAFSKDPI DTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSAS+S
Sbjct:   25 KKRHAEDQKVKSARGREKTADDVFVCERVCTSKRMLKKVGAFSKDPIRDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASNS 125          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Match: A0A067KGP3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_09421 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.134e-59
Identity = 90/100 (90.00%), Postives = 97/100 (97.00%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRLSASH 301
            +KK AEEQR+KS RGREKSSDD+F+CERVCTSKRMLKKVGAFSKDPIPD C+TVCGVSELDACSDACARTVCVNQHQVP+WNDICLRRCQSECL+LSASH
Sbjct:   26 KKKRAEEQRMKSIRGREKSSDDVFVCERVCTSKRMLKKVGAFSKDPIPDNCLTVCGVSELDACSDACARTVCVNQHQVPDWNDICLRRCQSECLKLSASH 125          
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy Swiss-Prot
Match: Y5486_ARATH (Uncharacterized protein At5g64816 OS=Arabidopsis thaliana GN=At5g64816 PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 3.110e-59
Identity = 88/96 (91.67%), Postives = 94/96 (97.92%), Query Frame = 2
Query:    2 RKKHAEEQRIKSARGREKSSDDIFICERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVPNWNDICLRRCQSECLRL 289
            +K+H EE+RIKSARGREKSSD+IF+CERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQV NWNDICLRRCQSECL+L
Sbjct:   25 KKRHGEEERIKSARGREKSSDEIFVCERVCTSKRMLKKVGAFSKDPIPDTCVTVCGVSELDACSDACARTVCVNQHQVANWNDICLRRCQSECLKL 120          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2SQP1_GOSRA5.031e-6497.03Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061DJX8_THECC6.590e-6295.05Uncharacterized protein isoform 1 OS=Theobroma cac... [more]
A0A061DJ25_THECC1.708e-6195.05Uncharacterized protein isoform 2 OS=Theobroma cac... [more]
A0A0A0KJ71_CUCSA4.215e-6087.13Uncharacterized protein OS=Cucumis sativus GN=Csa_... [more]
W9SAI8_9ROSA5.304e-6088.12Uncharacterized protein OS=Morus notabilis GN=L484... [more]
M1D319_SOLTU6.233e-6090.91Uncharacterized protein OS=Solanum tuberosum GN=PG... [more]
A0A0B0NIZ7_GOSAR9.537e-6090.10Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
K4BSD0_SOLLC1.622e-5989.90Uncharacterized protein OS=Solanum lycopersicum GN... [more]
A0A0D2T6G8_GOSRA1.696e-5989.11Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A067KGP3_JATCU4.134e-5990.00Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0012086 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y5486_ARATH3.110e-5991.67Uncharacterized protein At5g64816 OS=Arabidopsis t... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR35548:SF1SUBFAMILY NOT NAMEDcoord: 1..68
NoneNo IPR availablePANTHERPTHR35548FAMILY NOT NAMEDcoord: 1..68

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0012086 ID=g.arboreum_cottongen_reftransV1_0012086|Name=g.arboreum_cottongen_reftransV1_0012086|organism=Gossypium arboreum|type=contig|length=504bp
GAGGAAAAAGCATGCCGAAGAACAGAGAATTAAGAGTGCCAGGGGAAGGG
AGAAGAGCTCGGATGACATTTTCATTTGCGAGAGAGTCTGCACGTCAAAG
AGAATGTTGAAAAAGGTCGGGGCATTTTCAAAGGATCCGATCCCTGACAC
TTGTGTAACTGTTTGCGGTGTGTCCGAGCTCGATGCTTGCTCCGATGCTT
GCGCTCGTACCGTTTGTGTCAACCAACATCAGGTACCTAACTGGAATGAT
ATTTGCCTTAGAAGGTGTCAAAGTGAATGCCTTAGGTTATCTGCATCTCA
TTCTCCTTAGTGTAGTTTCGATTACCTTATGTTTAGGACACTACATTCTA
CTTTTCTCTCATAATCTATGTCGCTTCGACTTTATCTGATGCTCGTGTTT
AACACATATCCGAATATCGGGTTTTGCCTCGTCCTGCATAATGTTGTCAA
TGACTCTTAAATGCTTATTTGCAATTGGAAATGAAAATTATGCTTAGGTC
AAAA
back to top