g.arboreum_cottongen_reftransV1_0018382, g.arboreum_cottongen_reftransV1_0018382 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0018382
Unique Nameg.arboreum_cottongen_reftransV1_0018382
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length331
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr9chromosomeg.arboreum_cottongen_reftransV1_0018382:1..331 .
Chr9:89763607..89763937 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: A0A0B0NET2_GOSAR (Phytochrome OS=Gossypium arboreum GN=F383_07338 PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 2.472e-66
Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL
Sbjct:  573 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 682          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: A0A0D2UNN6_GOSRA (Phytochrome OS=Gossypium raimondii GN=B456_011G040900 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 5.115e-63
Identity = 105/110 (95.45%), Postives = 109/110 (99.09%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDSF+DMEESGSKELACGQQNDTETEGINEI SVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDS+EVY+NLIGRAL
Sbjct:  573 IHSLQLIMRDSFQDMEESGSKELACGQQNDTETEGINEIISVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSREVYENLIGRAL 682          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: A0A061GE12_THECC (Phytochrome E isoform 2 OS=Theobroma cacao GN=TCM_029563 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.636e-46
Identity = 80/110 (72.73%), Postives = 95/110 (86.36%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDSF+ ME+SGSK L   +QNDTE +G+ E+SSV YEMVRLIET TAP+FGV+TAG+INGWNAK+AELTGLQAD A+G+SL +EVVHEDS EV  NL+ RAL
Sbjct:  575 IHSLQLIMRDSFQGMEDSGSKGLVYARQNDTEMQGMGELSSVTYEMVRLIETATAPIFGVNTAGLINGWNAKIAELTGLQADDAMGRSLVNEVVHEDSHEVIANLLRRAL 684          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: A0A061GL48_THECC (Phytochrome OS=Theobroma cacao GN=TCM_029563 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 6.183e-46
Identity = 80/110 (72.73%), Postives = 95/110 (86.36%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDSF+ ME+SGSK L   +QNDTE +G+ E+SSV YEMVRLIET TAP+FGV+TAG+INGWNAK+AELTGLQAD A+G+SL +EVVHEDS EV  NL+ RAL
Sbjct:  575 IHSLQLIMRDSFQGMEDSGSKGLVYARQNDTEMQGMGELSSVTYEMVRLIETATAPIFGVNTAGLINGWNAKIAELTGLQADDAMGRSLVNEVVHEDSHEVIANLLRRAL 684          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: B9S180_RICCO (Phytochrome OS=Ricinus communis GN=RCOM_0634650 PE=3 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.319e-42
Identity = 75/110 (68.18%), Postives = 92/110 (83.64%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDSF+DME+S SK +   QQ DT+ +GI+E+SSVA EMVRLIET TAP+FGVD+AG +NGWNAK+AELTGLQA  A+GKSL  EVVH+DS E  ++L+ RAL
Sbjct:  570 IHSLQLIMRDSFQDMEDSASKAMVNAQQTDTDVQGIDELSSVACEMVRLIETATAPIFGVDSAGSVNGWNAKIAELTGLQASEAMGKSLVREVVHKDSYEFVESLLCRAL 679          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: A0A067JEN0_JATCU (Phytochrome OS=Jatropha curcas GN=JCGZ_21669 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.453e-41
Identity = 74/110 (67.27%), Postives = 93/110 (84.55%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDSF+DME+SGSK +   ++ D E +GI+E+SSVA EMVRLIET TAP+FGVD+AG+INGWN+KVAELTGLQ   A+GKSL  E+VHEDS+ V ++L+ RAL
Sbjct:  570 IHSLQLIMRDSFQDMEDSGSKAIVYDRRTDIEMQGIDELSSVACEMVRLIETATAPIFGVDSAGLINGWNSKVAELTGLQTSAAMGKSLVHEIVHEDSRGVVESLLCRAL 679          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: F6HMG7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_10s0003g02680 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 5.225e-39
Identity = 70/110 (63.64%), Postives = 89/110 (80.91%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDSF+D+E+S  K +   Q+ D+E +G+NE+ SVA EMV+LIET TAP+FGVD++G INGWNAK+AELTGLQA  A+GKSL DE+VHED +    NL+ RAL
Sbjct:  500 IHSLQLIMRDSFQDIEDSSGKVMVHTQKYDSEMQGLNELGSVACEMVKLIETATAPIFGVDSSGCINGWNAKIAELTGLQAKEAMGKSLVDEIVHEDLRGAVDNLLCRAL 609          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: D2KVY3_9ERIC (Phytochrome E (Fragment) OS=Pieris nana GN=PHYE PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 5.716e-39
Identity = 69/110 (62.73%), Postives = 91/110 (82.73%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDS+R +E+SG K L   Q +D++ +G++E+SSVA EMVRLIET +AP+FGVD+AG+INGWNAK+ ELTGLQA  AIGKSL +++V EDS+ V +NL+ RA 
Sbjct:  547 IHSLQLIMRDSYRMIEDSGPKGLVYTQIHDSKVQGLDELSSVACEMVRLIETASAPIFGVDSAGLINGWNAKIVELTGLQASEAIGKSLLNDIVREDSRGVVENLMCRAF 656          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: D2KVY1_9ERIC (Phytochrome E (Fragment) OS=Pieris nana GN=PHYE PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 5.774e-39
Identity = 69/110 (62.73%), Postives = 91/110 (82.73%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDS+R +E+SG K L   Q +D++ +G++E+SSVA EMVRLIET +AP+FGVD+AG+INGWNAK+ ELTGLQA  AIGKSL +++V EDS+ V +NL+ RA 
Sbjct:  547 IHSLQLIMRDSYRMIEDSGPKGLVYTQIHDSKVQGLDELSSVACEMVRLIETASAPIFGVDSAGLINGWNAKIVELTGLQASEAIGKSLLNDIVREDSRGVVENLMCRAF 656          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Match: D2KVY5_9ERIC (Phytochrome E (Fragment) OS=Pieris nana GN=PHYE PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 5.833e-39
Identity = 69/110 (62.73%), Postives = 91/110 (82.73%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDS+R +E+SG K L   Q +D++ +G++E+SSVA EMVRLIET +AP+FGVD+AG+INGWNAK+ ELTGLQA  AIGKSL +++V EDS+ V +NL+ RA 
Sbjct:  547 IHSLQLIMRDSYRMIEDSGPKGLVYTQIHDSKVQGLDELSSVACEMVRLIETASAPIFGVDSAGLINGWNAKIVELTGLQASEAIGKSLLNDIVREDSRGVVENLMCRAF 656          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHYE_IPONI (Phytochrome E OS=Ipomoea nil GN=PHYE PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 7.049e-37
Identity = 65/110 (59.09%), Postives = 86/110 (78.18%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLIMRDS + + E+  K ++  QQND++     E+SS+A E+VRL+ET T P+FGVD++G+INGWNAK+AELTGLQA+ AIGK L D+V HEDS E +K L+ RAL
Sbjct:  557 IHSLQLIMRDSLQGIGENYMKSVSSPQQNDSDGVRFYELSSMALELVRLVETATVPIFGVDSSGLINGWNAKIAELTGLQANVAIGKYLIDDVTHEDSHETFKALMCRAL 666          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHYB_SORBI (Phytochrome B OS=Sorghum bicolor GN=PHYB PE=3 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 2.977e-34
Identity = 66/114 (57.89%), Postives = 85/114 (74.56%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEE--SGSKELACGQQN--DTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLI+RDSFRD  E  S SK +  GQ    + E  GINE+SSVA EMVRLIET T P+F VDT G INGWNAK+AELTGL  + A+GKSL ++++ ++S+E+ + L+ RAL
Sbjct:  623 IHSLQLILRDSFRDAAEGTSNSKAIVNGQVQLGELELRGINELSSVAREMVRLIETATVPIFAVDTDGCINGWNAKIAELTGLSVEEAMGKSLVNDLIFKESEEIVEKLLSRAL 736          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHYB_SOLTU (Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 1.043e-33
Identity = 63/110 (57.27%), Postives = 82/110 (74.55%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLI+RDSF+D E S SK +      + E +GI+E+SSVA EMVRLIET TAP+F VD  G INGWNAKVAELTG+  + A+GKSL  ++V+++SQE  + L+  AL
Sbjct:  580 IHSLQLILRDSFKDAEASNSKAIVHAHLGEMELQGIDELSSVAREMVRLIETATAPIFAVDVEGRINGWNAKVAELTGVSVEEAMGKSLVHDLVYKESQETAEKLLYNAL 689          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHYB_ORYSI (Phytochrome B OS=Oryza sativa subsp. indica GN=PHYB PE=3 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 3.458e-33
Identity = 66/114 (57.89%), Postives = 83/114 (72.81%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEE--SGSKELACGQQN--DTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLI+RDSFRD  E  S SK +  GQ    + E  GI+E+SSVA EMVRLIET T P+F VDT G INGWNAKVAELTGL  + A+GKSL ++++ ++S+E    L+ RAL
Sbjct:  616 IHSLQLILRDSFRDSAEGTSNSKAIVNGQVQLGELELRGIDELSSVAREMVRLIETATVPIFAVDTDGCINGWNAKVAELTGLSVEEAMGKSLVNDLIFKESEETVNKLLSRAL 729          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHYB_ORYSJ (Phytochrome B OS=Oryza sativa subsp. japonica GN=PHYB PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.595e-33
Identity = 66/114 (57.89%), Postives = 83/114 (72.81%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEE--SGSKELACGQQN--DTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLI+RDSFRD  E  S SK +  GQ    + E  GI+E+SSVA EMVRLIET T P+F VDT G INGWNAKVAELTGL  + A+GKSL ++++ ++S+E    L+ RAL
Sbjct:  616 IHSLQLILRDSFRDSAEGTSNSKAIVNGQVQLGELELRGIDELSSVAREMVRLIETATVPIFAVDTDGCINGWNAKVAELTGLSVEEAMGKSLVNDLIFKESEETVNKLLSRAL 729          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHY_ADICA (Phytochrome 1 OS=Adiantum capillus-veneris GN=PHY1 PE=2 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 1.117e-32
Identity = 59/110 (53.64%), Postives = 85/110 (77.27%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLI+R SF+D+++S +K +   + ND + +G++E+S+VA EMVRLIET TAP+  VD  G+INGWN KVAELTGL  + A+GKSLA E+VHE+S+ + + ++  AL
Sbjct:  565 IHSLQLILRGSFQDIDDSNTKTMIHARLNDLKLQGLDELSTVASEMVRLIETATAPILAVDGQGLINGWNGKVAELTGLSFETAMGKSLAKELVHEESKTIVERVLHLAL 674          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHYB_TOBAC (Phytochrome B OS=Nicotiana tabacum GN=PHYB PE=2 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 2.679e-32
Identity = 64/110 (58.18%), Postives = 81/110 (73.64%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+ LI+RDSF+D E S SK +   Q  + E +GI+E+SSVA EMVRLIET TAP+F VD  G INGWNAKVAELT L  + A+GKSL  ++VH++SQE  + L+  AL
Sbjct:  583 IHSL-LILRDSFKDAEASNSKAVVHAQLGEMELQGIDELSSVAREMVRLIETATAPIFAVDVEGRINGWNAKVAELTDLSVEEAMGKSLVHDLVHKESQETAEKLLFNAL 691          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHYB_SOYBN (Phytochrome B OS=Glycine max GN=PHYB PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.285e-31
Identity = 58/108 (53.70%), Postives = 79/108 (73.15%), Query Frame = -1
Query:    8 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGR 331
            IHS+QLI+RDSF+D E   SK +     ++ E +G++E+SSVA EMVRLIET TAP+F VD  G +NGWNAKV+ELTGL  + A+GKSL  ++V ++S+E    L+ R
Sbjct:  605 IHSLQLILRDSFKDAEHRNSKAVVDPHVSEQELQGVDELSSVAREMVRLIETATAPIFAVDVDGHVNGWNAKVSELTGLPVEEAMGKSLVHDLVFKESEETVNKLLSR 712          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHYB1_SOLLC (Phytochrome B1 OS=Solanum lycopersicum GN=PHYB1 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.123e-31
Identity = 65/112 (58.04%), Postives = 83/112 (74.11%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKEL--ACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLI+RDSF+D E S SK +  A G+    E +GI+E+SSVA EMVRLIET TAP+FGVD  G INGWN KV ELTGL A+ A GKSL  ++++++SQE  + L+  AL
Sbjct:  582 IHSLQLILRDSFKDAEASNSKAIVHALGEM---ELQGIDELSSVAREMVRLIETATAPIFGVDVNGRINGWNEKVVELTGLSAEEAKGKSLVHDLLYKESQESAEKLLYNAL 690          
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Match: PHY_PINSY (Phytochrome OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.308e-30
Identity = 59/110 (53.64%), Postives = 79/110 (71.82%), Query Frame = -1
Query:    2 IHSIQLIMRDSFRDMEESGSKELACGQQNDTETEGINEISSVAYEMVRLIETGTAPVFGVDTAGIINGWNAKVAELTGLQADHAIGKSLADEVVHEDSQEVYKNLIGRAL 331
            IHS+QLI+R SFRD+++SG+K +   + N    +GI+E+SSVA EMVRLIET TAP+  VD  G++NGWNAKVAELTGL    A+G SL  ++V E S E  + ++  AL
Sbjct:  580 IHSLQLILRCSFRDIDDSGTKTMVHSRLNYLRLQGIDELSSVASEMVRLIETATAPILAVDYNGLVNGWNAKVAELTGLPVGEAMGMSLVQDLVFEQSVERVEKMLHNAL 689          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NET2_GOSAR2.472e-66100.00Phytochrome OS=Gossypium arboreum GN=F383_07338 PE... [more]
A0A0D2UNN6_GOSRA5.115e-6395.45Phytochrome OS=Gossypium raimondii GN=B456_011G040... [more]
A0A061GE12_THECC1.636e-4672.73Phytochrome E isoform 2 OS=Theobroma cacao GN=TCM_... [more]
A0A061GL48_THECC6.183e-4672.73Phytochrome OS=Theobroma cacao GN=TCM_029563 PE=3 ... [more]
B9S180_RICCO3.319e-4268.18Phytochrome OS=Ricinus communis GN=RCOM_0634650 PE... [more]
A0A067JEN0_JATCU2.453e-4167.27Phytochrome OS=Jatropha curcas GN=JCGZ_21669 PE=3 ... [more]
F6HMG7_VITVI5.225e-3963.64Putative uncharacterized protein OS=Vitis vinifera... [more]
D2KVY3_9ERIC5.716e-3962.73Phytochrome E (Fragment) OS=Pieris nana GN=PHYE PE... [more]
D2KVY1_9ERIC5.774e-3962.73Phytochrome E (Fragment) OS=Pieris nana GN=PHYE PE... [more]
D2KVY5_9ERIC5.833e-3962.73Phytochrome E (Fragment) OS=Pieris nana GN=PHYE PE... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0018382 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
PHYE_IPONI7.049e-3759.09Phytochrome E OS=Ipomoea nil GN=PHYE PE=2 SV=1[more]
PHYB_SORBI2.977e-3457.89Phytochrome B OS=Sorghum bicolor GN=PHYB PE=3 SV=2[more]
PHYB_SOLTU1.043e-3357.27Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3 SV... [more]
PHYB_ORYSI3.458e-3357.89Phytochrome B OS=Oryza sativa subsp. indica GN=PHY... [more]
PHYB_ORYSJ3.595e-3357.89Phytochrome B OS=Oryza sativa subsp. japonica GN=P... [more]
PHY_ADICA1.117e-3253.64Phytochrome 1 OS=Adiantum capillus-veneris GN=PHY1... [more]
PHYB_TOBAC2.679e-3258.18Phytochrome B OS=Nicotiana tabacum GN=PHYB PE=2 SV... [more]
PHYB_SOYBN1.285e-3153.70Phytochrome B OS=Glycine max GN=PHYB PE=3 SV=1[more]
PHYB1_SOLLC2.123e-3158.04Phytochrome B1 OS=Solanum lycopersicum GN=PHYB1 PE... [more]
PHY_PINSY1.308e-3053.64Phytochrome OS=Pinus sylvestris PE=2 SV=1[more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001294PhytochromePRINTSPR01033PHYTOCHROMEcoord: 57..72
score: 80.13
coord: 38..54
score: 73.15
IPR000014PAS domainSMARTSM00091pas_2coord: 37..103
e-value: 2.8E-5
score: 33.5
IPR000014PAS domainTIGRFAMTIGR00229TIGR00229coord: 42..102
e-value: 1.7E-8
score: 32.6
IPR000014PAS domainPROSITEPS50112PAScoord: 35..103
score: 19.02
IPR000014PAS domainSUPERFAMILY55785PYP-like sensor domain (PAS domain)coord: 41..101
IPR013767PAS foldPFAMPF00989PAScoord: 38..98
e-value: 3.6E-16
score: 59.0
NoneNo IPR availableGENE3D3.30.450.20coord: 42..96
e-value: 2.8E-10
score: 39.6
NoneNo IPR availablePANTHERPTHR24423TWO-COMPONENT SENSOR HISTIDINE KINASEcoord: 35..103
NoneNo IPR availablePANTHERPTHR24423:SF563PHYTOCHROME Ecoord: 35..103

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0018382 ID=g.arboreum_cottongen_reftransV1_0018382|Name=g.arboreum_cottongen_reftransV1_0018382|organism=Gossypium arboreum|type=contig|length=331bp
GCAAAGCTCTTCCTATGAGATTTTTGTACACTTCTTGAGAATCTTCGTGA
ACAACTTCATCAGCTAGGGATTTCCCGATTGCATGATCGGCTTGTAAACC
TGTCAATTCTGCAACTTTTGCATTCCAACCATTTATGATACCGGCTGTAT
CAACTCCAAAGACTGGAGCTGTTCCAGTCTCAATCAATCTAACCATTTCA
TATGCCACTGAGCTGATTTCATTGATTCCCTCCGTCTCAGTATCATTTTG
CTGGCCACAAGCTAACTCCTTGGAGCCACTCTCTTCCATGTCTCGAAATG
AATCTCTCATTATTAGCTGTATAGAGTGAAT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR001294Phytochrome
IPR000014PAS
IPR013767PAS_fold
Vocabulary: Biological Process
TermDefinition
GO:0009584detection of visible light
GO:0006355regulation of transcription, DNA-dependent