g.arboreum_cottongen_reftransV1_0010110, g.arboreum_cottongen_reftransV1_0010110 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0010110
Unique Nameg.arboreum_cottongen_reftransV1_0010110
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1930
Homology
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: A0A0D2PW54_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G241000 PE=4 SV=1)

HSP 1 Score: 994.956 bits (2571), Expect = 0.000e+0
Identity = 483/495 (97.58%), Postives = 486/495 (98.18%), Query Frame = -1
Query:  314 MDGSGGRGA---DSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1780
            MDGSGGRG    D+VL NYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQE+EARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFN IHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHN+HY   ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ
Sbjct:   83 MDGSGGRGGSGVDNVLPNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEEEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNHIHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNNHYFGDELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 577          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: A0A0D2Q1M7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G013500 PE=4 SV=1)

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 459/492 (93.29%), Postives = 474/492 (96.34%), Query Frame = -1
Query:  314 MDGSGGRGADSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1780
            MDGSGGRGAD+VLSNYKLGKTLGIGSFGKVKIAEH  TG+KVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPD+MQQA+KIDEEILQEV+RMGF+RNHLVESLRNRIQNEGTVAYYLLLDN FRVSSGYLGAEFQETMESGFNRIHP+EPT PAVGHRL G+ADYQ MGLRGLERKWALGLQSRAHPREIMTEVLKA QELNV WKKIGHYNMKCRWL SIPGLNEG++N    N+HY   E TI+ENDGV++ PNVVKFEVQLYKTREEKYLLDLQRV+GPQ
Sbjct:    1 MDGSGGRGADNVLSNYKLGKTLGIGSFGKVKIAEHSSTGYKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDTMQQARKIDEEILQEVVRMGFERNHLVESLRNRIQNEGTVAYYLLLDNRFRVSSGYLGAEFQETMESGFNRIHPSEPTSPAVGHRLLGFADYQAMGLRGLERKWALGLQSRAHPREIMTEVLKALQELNVCWKKIGHYNMKCRWLPSIPGLNEGMLN----NNHYFGDESTIVENDGVTKLPNVVKFEVQLYKTREEKYLLDLQRVQGPQ 488          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: A0A0B0NJD8_GOSAR (SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Gossypium arboreum GN=F383_16814 PE=4 SV=1)

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 476/509 (93.52%), Postives = 490/509 (96.27%), Query Frame = -1
Query:  263 MDGSGGRGADSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQXXXXXXXXXXXXXLRVL 1780
            MDGSGGRGADSVLSNYKLGKTLGIGSFGKVKIAEH  TG+KVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPD+MQQA+KIDEEILQEV+RMGF+RNHLVESLRNRIQNEGTVAYYLLLDN FRVSSGYLGAEFQETMESGFNRIHP+EPT PAVGHRL G+ADYQ MGLRGLERKWALGLQSRAHPREIMTEVLKA QELNV WKKIGHYNMKCRWL SI GLNEG++N    N+HY   E TI+ENDGV++ PNVVKFEVQLYKTREEKYLLDLQRV+GPQFLFLDLCAAFLAQLRVL
Sbjct:    1 MDGSGGRGADSVLSNYKLGKTLGIGSFGKVKIAEHSSTGYKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDTMQQARKIDEEILQEVVRMGFERNHLVESLRNRIQNEGTVAYYLLLDNRFRVSSGYLGAEFQETMESGFNRIHPSEPTSPAVGHRLPGFADYQAMGLRGLERKWALGLQSRAHPREIMTEVLKALQELNVCWKKIGHYNMKCRWLPSITGLNEGMLN----NNHYFGDESTIVENDGVTKLPNVVKFEVQLYKTREEKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL 505          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: A0A061EF40_THECC (SNF1 kinase OS=Theobroma cacao GN=TCM_018660 PE=4 SV=1)

HSP 1 Score: 934.865 bits (2415), Expect = 0.000e+0
Identity = 450/484 (92.98%), Postives = 465/484 (96.07%), Query Frame = -1
Query:  314 ADSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1756
             D+VL NYKLGKTLGIGSFGKVKIAEH LTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVV+PMKRMTIPEIRQHPWFQAHLPRYLAVPPPD+MQQAKKIDEEILQEV+RMGF+RN LVESLRNRIQNEGTVAYYLLLDN FRVSSGYLGAEFQETMESGFNR+HP+EPT PAVGHRL+GY DYQ +GLRGLERKWALGLQSRAHPREIMTEVLKA QELNV WKKIGHYNMKCRWL SIPG +EG+V+NPV+N+HY   E TIIENDGV + PNVVKFEVQLYKTREEKYLLDLQRV GPQ
Sbjct:   12 VDNVLPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVEPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDTMQQAKKIDEEILQEVVRMGFERNQLVESLRNRIQNEGTVAYYLLLDNRFRVSSGYLGAEFQETMESGFNRMHPSEPTAPAVGHRLSGYGDYQAVGLRGLERKWALGLQSRAHPREIMTEVLKALQELNVCWKKIGHYNMKCRWLPSIPGHHEGMVDNPVNNNHYFGDESTIIENDGVIKTPNVVKFEVQLYKTREEKYLLDLQRVNGPQ 495          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: A0A0A0K9T5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G077450 PE=4 SV=1)

HSP 1 Score: 906.36 bits (2341), Expect = 0.000e+0
Identity = 438/498 (87.95%), Postives = 464/498 (93.17%), Query Frame = -1
Query:  314 MDGSGGR---GADSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRG---LERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1780
            MDG  GR   G D  + NYKLGKTLGIGSFGKVKIAEH LTGHKVAIKILNRRKIKN++MEEKVRREIKILRLFMHPHIIRLYEVIET +DI+VVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLS GAR+LIP MLVVDPMKR+TIPEIRQHPWFQAHLPRYLAVPPPD+MQQAKKIDE+ILQEV++MGFDRN LVESLRNRIQNE TVAYYLLLDN FRVSSGYLGAEFQETME+GFNR+HP++PT PAVGHRL GY DYQ MGLR    +ERKWALGLQSRAHPREIMTEVLKA +ELNV WKKIGHYNMKCRWL  IPG +EG++NNPVH++HY   E TIIENDGV ++PNV+KFEVQLYKTREEKYLLDLQRV+GPQ
Sbjct:    1 MDGPTGRSGGGMDMNVPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNLDMEEKVRREIKILRLFMHPHIIRLYEVIETPSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSSGARELIPSMLVVDPMKRITIPEIRQHPWFQAHLPRYLAVPPPDTMQQAKKIDEDILQEVVKMGFDRNQLVESLRNRIQNEATVAYYLLLDNRFRVSSGYLGAEFQETMETGFNRMHPSDPTNPAVGHRLPGYMDYQGMGLRAQFPVERKWALGLQSRAHPREIMTEVLKALRELNVAWKKIGHYNMKCRWLPGIPGHHEGMINNPVHSNHYFGDESTIIENDGVVKSPNVIKFEVQLYKTREEKYLLDLQRVQGPQ 498          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: A0A067K4L4_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_19884 PE=4 SV=1)

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 453/514 (88.13%), Postives = 476/514 (92.61%), Query Frame = -1
Query:  263 MDGSGGRGADSV---LSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLR---GLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY--ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQXXXXXXXXXXXXXLRVL 1780
            MDGS  R + SV   L NYKLGKTLGIGSFGKVKIAEH LTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIET TDI+VVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQA LPRYLAVPPPD+MQQAKKIDEEILQEV++MGFDR  L+ESL NRIQN+ TVAYYLLLDN FRVS+GYLGAEFQE MESGFNR+H NEPT PAVGHRL GY D+   GL+    ++RKWALGLQSRAHPREIMTEVLKA QELNV WKKIGHYNMKCRW+  IPG +EG+VN+PVHN+ +  E +IIENDGV ++PNVVKFEVQLYKTREEKYLLDLQRV+GPQFLFLDLCAAFLAQLRVL
Sbjct:    1 MDGSNHRSSSSVDVFLPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPTDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQARLPRYLAVPPPDTMQQAKKIDEEILQEVVKMGFDRKQLIESLSNRIQNDATVAYYLLLDNRFRVSNGYLGAEFQEIMESGFNRMHANEPTSPAVGHRLPGYMDFPGTGLKSQFAVDRKWALGLQSRAHPREIMTEVLKALQELNVCWKKIGHYNMKCRWIPGIPGHHEGIVNDPVHNNFFGDESSIIENDGVIKSPNVVKFEVQLYKTREEKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL 514          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: P93113_CUCSA (SNF1-related protein kinase OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 897.886 bits (2319), Expect = 0.000e+0
Identity = 431/486 (88.68%), Postives = 458/486 (94.24%), Query Frame = -1
Query:  314 DSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRG---LERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1753
            D  + NYKLGKTLGIGSFGKVKIAEH LTGHKVAIKILNRRKIKN++MEEKVRREIKILRLFMHPHIIRLYEVIET +DI+VVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLS GAR+LIP MLVVDPMKR+TIPEIRQHPWFQAHLPRYLAVPPPD+MQQAKKIDE+ILQEV++MGFDRN LVESLRNRIQNE TVAYYLLLDN FRVSSGYLGAEFQETME+GFNR+HP++PT PAVGHRL GY DYQ MGLR    +ERKWALGLQSRAHPREIMTEVLKA +ELNV WKKIGHYNMKCRWL  IPG +EG++NNPVH++HY   + TIIENDGV ++PNV+KFEVQLYKTREEKYLLDLQRV+GPQ
Sbjct:    2 DMNVPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNLDMEEKVRREIKILRLFMHPHIIRLYEVIETPSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSSGARELIPSMLVVDPMKRITIPEIRQHPWFQAHLPRYLAVPPPDTMQQAKKIDEDILQEVVKMGFDRNQLVESLRNRIQNEATVAYYLLLDNRFRVSSGYLGAEFQETMETGFNRMHPSDPTNPAVGHRLPGYMDYQGMGLRAQFPVERKWALGLQSRAHPREIMTEVLKALRELNVAWKKIGHYNMKCRWLPGIPGHHEGMINNPVHSNHYFGDKSTIIENDGVVKSPNVIKFEVQLYKTREEKYLLDLQRVQGPQ 487          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: A0A067GBB0_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g010208mg PE=4 SV=1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 435/498 (87.35%), Postives = 458/498 (91.97%), Query Frame = -1
Query:  314 MDGSGGR---GADSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRG---LERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1780
            MDG+  R   G D  L NYKLGKTLGIGSFGKVKIAEH LTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIET +DI+VVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSK NVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRML+VDPMKR+TIPEIRQHPWFQAHLPRYLAVPPPD+MQQAKKIDEEIL+EV++MGFD+N LVESLRNR+QNE TVAYYLLLDN FRVSSGYLGAEFQETMESGFNR+HP EP V  V HR  G+ DYQ MGLRG    ERKWALGLQSRAHPREIMTEVLKA QELNV WKKIGHYNMKCRW+  I G +EG+VNNP+H++HY   E  IIENDGV ++PNVVKFEVQLYKTR+EKYLLDLQRV+GPQ
Sbjct:    1 MDGASNRSSSGVDMFLPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKWNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLIVDPMKRITIPEIRQHPWFQAHLPRYLAVPPPDTMQQAKKIDEEILKEVVKMGFDQNQLVESLRNRLQNEATVAYYLLLDNRFRVSSGYLGAEFQETMESGFNRLHPIEPAVSPVAHRAPGFMDYQGMGLRGQLPYERKWALGLQSRAHPREIMTEVLKALQELNVGWKKIGHYNMKCRWIPGISGHHEGMVNNPLHSNHYFGDESAIIENDGVVKSPNVVKFEVQLYKTRDEKYLLDLQRVQGPQ 498          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: A0A0E3T4L5_9ROSI (SNF-1 related protein kinase KIN10b OS=Dimocarpus longan GN=KIN10b PE=2 SV=1)

HSP 1 Score: 894.034 bits (2309), Expect = 0.000e+0
Identity = 431/497 (86.72%), Postives = 458/497 (92.15%), Query Frame = -1
Query:  314 MDGS--GGRGADSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLR---GLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1780
            MDGS  G  G D +L NYKLGKTLGIGSFGKVKIAEH LTGHKVAIKILNRRKI+NMEMEEKVRREIKILRLFMHPHIIRLYEVIET +DI+VVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVV+PMKR+TIP+IRQHPWFQAHLPRYLAVPPPD+MQQAKKIDEEIL+EV++MGF +N ++ESLRNR+QNE TVAYYLLLDN FRVSSGYLGAEFQETMES FNR+HP+E   PAVG RL GY DYQ + +R   G ERKWALGLQSRAHPREIMTEVLKA QELNV WKKIGHYNMKCRW+  IPG +EG+  NPVH++HY   E TIIENDG  ++PNVVKFEVQLYKTREEKYLLDLQRV+GPQ
Sbjct:    1 MDGSNRGSGGVDMILPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIRNMEMEEKVRREIKILRLFMHPHIIRLYEVIETQSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVEPMKRITIPDIRQHPWFQAHLPRYLAVPPPDTMQQAKKIDEEILKEVVKMGFAQNQVIESLRNRMQNEATVAYYLLLDNRFRVSSGYLGAEFQETMESSFNRMHPSEAGAPAVGQRLPGYMDYQGISMRAQGGFERKWALGLQSRAHPREIMTEVLKALQELNVGWKKIGHYNMKCRWIPGIPGHHEGMAKNPVHSNHYFGDESTIIENDGPIKSPNVVKFEVQLYKTREEKYLLDLQRVQGPQ 497          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Match: B9H0G4_POPTR (SNF1-related protein kinase KIN10 OS=Populus trichocarpa GN=POPTR_0004s11500g PE=4 SV=1)

HSP 1 Score: 891.723 bits (2303), Expect = 0.000e+0
Identity = 451/515 (87.57%), Postives = 475/515 (92.23%), Query Frame = -1
Query:  263 MDGSGGRGADSV---LSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRG---LERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQXXXXXXXXXXXXXLRVL 1780
            MDGS  RG+ SV   L+NYKLGKTLGIGSFGKVKIAEH LTGHKVAIKILNRRKIKNM+MEEKVRREIKILRLFMHPHIIRLYEVIET TDI+VVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSK NVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQH WFQA LPRYLAVPPPD+MQQAKKIDEEILQEVI+MGFDRN L+ESLRNR+QNEGTVAYYLLLDN FRVS+GYLGAEFQETME  FN +H NE + PA GHRL G+ DYQ MGL+    +ERKWALGLQSRAHPREIMTEVLKA QELNV WKKIG YNMKCRW+   PG +EG+VN+PVH +H+   E TIIENDGV+ +PNVVKFEVQLYKTR+EKYLLDLQRV+GPQFLFLDLCAAFLAQLRVL
Sbjct:    1 MDGSSYRGSSSVDMYLANYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNMDMEEKVRREIKILRLFMHPHIIRLYEVIETPTDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKWNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHQWFQARLPRYLAVPPPDTMQQAKKIDEEILQEVIKMGFDRNQLIESLRNRMQNEGTVAYYLLLDNRFRVSNGYLGAEFQETMECAFNGMHQNESSSPAGGHRLPGFMDYQGMGLKSQFLVERKWALGLQSRAHPREIMTEVLKALQELNVSWKKIGQYNMKCRWIPGTPGHHEGMVNDPVHTNHFFGDEPTIIENDGVTNSPNVVKFEVQLYKTRDEKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL 515          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: KIN10_ARATH (SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2)

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 414/499 (82.97%), Postives = 450/499 (90.18%), Query Frame = -1
Query:  314 KMDGSGG---RGADSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRG---LERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHY---ELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1783
            +MDGSG     G +S+L NYKLG+TLGIGSFG+VKIAEH LTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIET TDI++VMEYV SGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKR+TIPEIRQHPWFQAHLPRYLAVPPPD++QQAKKIDEEILQEVI MGFDRNHL+ESLRNR QN+GTV YYL+LDN FR SSGYLGAEFQETME G  R+HP E     V HRL G  +YQ +GLR    +ERKWALGLQSRAHPREIMTEVLKA Q+LNV WKKIGHYNMKCRW+ +     +G+++N +H+++Y   E +IIEN+   ++PNVVKFE+QLYKTR++KYLLDLQRV+GPQ
Sbjct:   23 RMDGSGTGSRSGVESILPNYKLGRTLGIGSFGRVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPTDIYLVMEYVNSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRVTIPEIRQHPWFQAHLPRYLAVPPPDTVQQAKKIDEEILQEVINMGFDRNHLIESLRNRTQNDGTVTYYLILDNRFRASSGYLGAEFQETME-GTPRMHPAESVASPVSHRLPGLMEYQGVGLRSQYPVERKWALGLQSRAHPREIMTEVLKALQDLNVCWKKIGHYNMKCRWVPNSSA--DGMLSNSMHDNNYFGDESSIIENEAAVKSPNVVKFEIQLYKTRDDKYLLDLQRVQGPQ 518          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: KIN11_ARATH (SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1)

HSP 1 Score: 797.734 bits (2059), Expect = 0.000e+0
Identity = 386/491 (78.62%), Postives = 426/491 (86.76%), Query Frame = -1
Query:  314 GGRGADSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRG---LERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEG---LVNNPVHNSHYELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1768
            G  G +S+L NYKLGKTLGIGSFGKVKIAEH++TGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIR YEVIET +DI+VVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDS+CN+KIADFGLSN+MRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLS  ARDLIPRML+VDP+KR+TIPEIRQH WFQ HLPRYLAV PPD+++QAKKI+EEI+QEV+ MGFDRN ++ESLRNR QN+ TV YYLLLDN FRV SGYL +EFQET +SG N +   E     VGH +  + D+  +G R    ++RKWALGLQS AHPREIM EVLKA QELNV WKKIGHYNMKCRW   +PGL +G   +VNN +H    E +IIE+D    +P V+KFE+QLYK REEKYLLD+QRV GPQ
Sbjct:    9 GNNGVESILPNYKLGKTLGIGSFGKVKIAEHVVTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRQYEVIETTSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSRCNIKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSSEARDLIPRMLIVDPVKRITIPEIRQHRWFQTHLPRYLAVSPPDTVEQAKKINEEIVQEVVNMGFDRNQVLESLRNRTQNDATVTYYLLLDNRFRVPSGYLESEFQETTDSGSNPMRTPEAGASPVGHWIPAHVDHYGLGARSQVPVDRKWALGLQSHAHPREIMNEVLKALQELNVCWKKIGHYNMKCRW---VPGLADGQNTMVNNQLHFRD-ESSIIEDDCAMTSPTVIKFELQLYKAREEKYLLDIQRVNGPQ 495          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: RKIN1_SECCE (Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 332/498 (66.67%), Postives = 385/498 (77.31%), Query Frame = -1
Query:  314 MDGSGGRGADSVLSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFM---HPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVIRMGFDRNHLVESLRNRIQNEGTVAYYLLLDNLFRVSSGYLGAEFQETMESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRG---LERKWALGL-QSRAHPREIMTEVLKAFQELNVYWKKIGH-YNMKCRWLASIPGLNEGLVNNPVHNSHYELTIIEN-DGVSRAPNVVKFEVQLYKTREEKYLLDLQRVEGPQ 1780
            MDG G       L NY LGK LG+G+F KV IAEH  T HKVAIK+LNRR+++  EMEEK +REIKILRLF+   HPHIIR+YEVI T  DIFVVMEY ++G+L DYI+EK RLQEDEAR  FQQIIS VEYCHRN VVHRDLKPENLLLDSK NVK+ADFGLSN+M DGHFLKTSCGS NYAAPEVISGKLYAGPE+DVWSCGVILYALLCG +PFDD+NIPNLFKKIKGG Y LP +LS   RDLI RML+VDPMKR+TI EIR+H WFQ  LPRYLAVPPPD MQQAK IDE+ L++V+++G+D++H+ ESL NR+QNE TVAYYLLLDN FR +SGYLGA +Q+ MES            P+    L G  D Q  GLR    +ERKWALGL QSRA PR IM EVLKA +ELNV WKK G  YNMKCRW    P +++ L++   H+   +  I +N D  SR P V+KFE+QLYKT+++KYLLD+QRV GPQ
Sbjct:    1 MDGGGEHS--EALKNYYLGKILGVGTFAKVIIAEHKHTRHKVAIKVLNRRQMRAPEMEEKAKREIKILRLFIDLIHPHIIRVYEVIVTPKDIFVVMEYCQNGDLLDYILEKRRLQEDEARRTFQQIISAVEYCHRNKVVHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSLNYAAPEVISGKLYAGPEIDVWSCGVILYALLCGAVPFDDDNIPNLFKKIKGGTYILPIYLSDLVRDLISRMLIVDPMKRITIGEIRKHSWFQNRLPRYLAVPPPDMMQQAKMIDEDTLRDVVKLGYDKDHVCESLCNRLQNEETVAYYLLLDNRFRATSGYLGAHYQQPMESA----------SPSTRSYLPGSNDSQGSGLRPYYRVERKWALGLQQSRAPPRAIMIEVLKALKELNVCWKKNGDCYNMKCRWCPGFPRVSDMLLDAN-HSFVDDCAIKDNGDANSRLPAVIKFEIQLYKTKDDKYLLDMQRVTGPQ 485          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: AAPK2_RAT (5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 4.621e-147
Identity = 235/492 (47.76%), Postives = 316/492 (64.23%), Query Frame = -1
Query:  323 LSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVI-RMGFDRNHLVESLRN-RIQNEGTVAYYLLLDN---LFRVSSGYLGA-----EFQETMESGF--------NRIHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHYELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVE 1744
            + +Y LG TLG+G+FGKVKI EH LTGHKVA+KILNR+KI+++++  K++REI+ L+LF HPHII+LY+VI T TD F+VMEYV  GELFDYI + GR++E EAR  FQQI+S V+YCHR+MVVHRDLKPEN+LLD++ N KIADFGLSN+M DG FL+TSCGSPNYAAPEVISG+LYAGPEVD+WSCGVILYALLCGTLPFDDE++P LFKKI+GG++ +P +L+     L+  ML VDP+KR TI +IR+H WF+  LP YL   P D    A  ID+E ++EV  +     + ++ SL +   Q++  VAY+L++DN   + + S  YL +      F + M             R+ P     P     L      +   L   + KW LG++S++ P +IM EV +A ++L+  WK +  Y+++ R              NPV                   N VK  +QLY      YLLD + ++
Sbjct:   13 IGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSIATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLF--PEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDMAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRR------------KNPVTG-----------------NYVKMSLQLYLVDNRSYLLDFKSID 473          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: AAPK2_PONAB (5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 1.117e-146
Identity = 234/492 (47.56%), Postives = 315/492 (64.02%), Query Frame = -1
Query:  323 LSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVI-RMGFDRNHLVESLRN-RIQNEGTVAYYLLLDN---------LFRVSSGYLGAEFQET-------MESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHYELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVE 1744
            + +Y LG TLG+G+FGKVKI EH LTGHKVA+KILNR+KI+++++  K++REI+ L+LF HPHII+LY+VI T TD F+VMEYV  GELFDYI + GR++E EAR  FQQI+S V+YCHR+MVVHRDLKPEN+LLD+  N KIADFGLSNIM DG FL+TSCGSPNYAAPEVISG+LYAGPEVD+WSCGVILYALLCGTLPFDDE++P LFKKI+GG++ +P +L+     L+  ML VDP+KR TI +IR+H WF+  LP YL   P D    A  ID+E ++EV  +     + ++ SL +   Q++  VAY+L++DN          +  SS   G+   ++       ++    R+ P     P     L      +   L   + KW LG++S++ P +IM EV +A ++L+  WK +  Y+++ R              NPV                   N VK  +QLY      YLLD + ++
Sbjct:   13 IGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNIMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLF--PEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRR------------KNPVTG-----------------NYVKMSLQLYLVDNRSYLLDFKSID 473          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: AAPK1_HUMAN (5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4)

HSP 1 Score: 444.121 bits (1141), Expect = 1.690e-146
Identity = 231/486 (47.53%), Postives = 313/486 (64.40%), Query Frame = -1
Query:  323 LSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVI-RMGFDRNHLVESLRNR-IQNEGTVAYYLLLDN---LFRVSSGYLGAEFQETM--ESGFNRIHPNE-----PTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHYELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVE 1744
            + +Y LG TLG+G+FGKVK+ +H LTGHKVA+KILNR+KI+++++  K+RREI+ L+LF HPHII+LY+VI T +DIF+VMEYV  GELFDYI + GRL E E+R  FQQI+SGV+YCHR+MVVHRDLKPEN+LLD+  N KIADFGLSN+M DG FL+TSCGSPNYAAPEVISG+LYAGPEVD+WS GVILYALLCGTLPFDD+++P LFKKI  GI+  P +L+P    L+  ML VDPMKR TI +IR+H WF+  LP+YL   P D    +  ID+E L+EV  +       ++  L NR  Q+   VAY+L++DN   +      YL     ++   +    R HP          P   H L      ++      + KW LG++S++ P +IM EV +A ++L+  WK +  Y ++ R              NPV +++ ++++                 QLY+     YLLD + ++
Sbjct:   24 IGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLF--PEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRR------------KNPVTSTYSKMSL-----------------QLYQVDSRTYLLDFRSID 478          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: AAPK1_PONAB (5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2)

HSP 1 Score: 443.736 bits (1140), Expect = 1.910e-146
Identity = 231/486 (47.53%), Postives = 313/486 (64.40%), Query Frame = -1
Query:  323 LSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVI-RMGFDRNHLVESLRNR-IQNEGTVAYYLLLDN---LFRVSSGYLGAEFQETM--ESGFNRIHPNE-----PTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHYELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVE 1744
            + +Y LG TLG+G+FGKVK+ +H LTGHKVA+KILNR+KI+++++  K+RREI+ L+LF HPHII+LY+VI T +DIF+VMEYV  GELFDYI + GRL E E+R  FQQI+SGV+YCHR+MVVHRDLKPEN+LLD+  N KIADFGLSN+M DG FL+TSCGSPNYAAPEVISG+LYAGPEVD+WS GVILYALLCGTLPFDD+++P LFKKI  GI+  P +L+P    L+  ML VDPMKR TI +IR+H WF+  LP+YL   P D    +  ID+E L+EV  +       ++  L NR  Q+   VAY+L++DN   +      YL     ++   +    R HP          P   H L      ++      + KW LG++S++ P +IM EV +A ++L+  WK +  Y ++ R              NPV +++ ++++                 QLY+     YLLD + ++
Sbjct:   19 IGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLF--PEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRR------------KNPVTSTYSKMSL-----------------QLYQVDSRTYLLDFRSID 473          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: AAPK2_PIG (5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2)

HSP 1 Score: 443.351 bits (1139), Expect = 2.614e-146
Identity = 233/492 (47.36%), Postives = 316/492 (64.23%), Query Frame = -1
Query:  323 LSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVI-RMGFDRNHLVESLRN-RIQNEGTVAYYLLLDN---------LFRVSSGYLGAEFQET-------MESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHYELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVE 1744
            + +Y LG TLG+G+FGKVKI EH LTGHKVA+KILNR+KI+++++  K++REI+ L+LF HPHII+LY+VI T TD F+VMEYV  GELFDYI + GR++E EAR  FQQI+S V+YCHR+MVVHRDLKPEN+LLD++ N KIADFGLSN+M DG FL+TSCGSPNYAAPEVISG+LYAGPEVD+WSCGVILYALLCGTLPFDDE++P LFKKI+GG++ +P +L+     L+  ML VDP+KR TI +IR+H WF+  LP YL   P D    A  ID+E ++EV  +     + ++ SL +   Q++  VAY+L++DN          +  SS   G+   ++       ++    R+ P     P     L      +   L   + KW LG++S++ P +IM EV +A ++L+  WK +  Y+++ R              NPV                   N VK  +QLY      YLLD + ++
Sbjct:   13 IGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLF--PEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLVIDNRRIMNQASEFYLASSPPTGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRR------------KNPVTG-----------------NYVKMSLQLYLVDNRSYLLDFKSID 473          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: AAPK2_HUMAN (5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2)

HSP 1 Score: 442.965 bits (1138), Expect = 3.611e-146
Identity = 233/492 (47.36%), Postives = 315/492 (64.02%), Query Frame = -1
Query:  323 LSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVI-RMGFDRNHLVESLRN-RIQNEGTVAYYLLLDN---------LFRVSSGYLGAEFQET-------MESGFNRIHPNEPTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHYELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVE 1744
            + +Y LG TLG+G+FGKVKI EH LTGHKVA+KILNR+KI+++++  K++REI+ L+LF HPHII+LY+VI T TD F+VMEYV  GELFDYI + GR++E EAR  FQQI+S V+YCHR+MVVHRDLKPEN+LLD+  N KIADFGLSN+M DG FL+TSCGSPNYAAPEVISG+LYAGPEVD+WSCGVILYALLCGTLPFDDE++P LFKKI+GG++ +P +L+     L+  ML VDP+KR TI +IR+H WF+  LP YL   P D    A  ID+E ++EV  +     + ++ SL +   Q++  VAY+L++DN          +  SS   G+   ++       ++    R+ P     P     L      +   L   + KW LG++S++ P +IM EV +A ++L+  WK +  Y+++ R              NPV                   N VK  +QLY      YLLD + ++
Sbjct:   13 IGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLF--PEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRR------------KNPVTG-----------------NYVKMSLQLYLVDNRSYLLDFKSID 473          
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Match: AAPK1_RAT (5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2)

HSP 1 Score: 442.965 bits (1138), Expect = 3.954e-146
Identity = 232/486 (47.74%), Postives = 310/486 (63.79%), Query Frame = -1
Query:  323 LSNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETATDIFVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRMTIPEIRQHPWFQAHLPRYLAVPPPDSMQQAKKIDEEILQEVI-RMGFDRNHLVESLRNR-IQNEGTVAYYLLLDN---LFRVSSGYLGAEFQETM--ESGFNRIHPNE-----PTVPAVGHRLTGYADYQTMGLRGLERKWALGLQSRAHPREIMTEVLKAFQELNVYWKKIGHYNMKCRWLASIPGLNEGLVNNPVHNSHYELTIIENDGVSRAPNVVKFEVQLYKTREEKYLLDLQRVE 1744
            + +Y LG TLG+G+FGKVK+ +H LTGHKVA+KILNR+KI+++++  K+RREI+ L+LF HPHII+LY+VI T +DIF+VMEYV  GELFDYI + GRL E E+R  FQQI+SGV+YCHR+MVVHRDLKPEN+LLD+  N KIADFGLSN+M DG FL+TSCGSPNYAAPEVISG+LYAGPEVD+WS GVILYALLCGTLPFDD+++P LFKKI  GI+  P +L+P    L+  ML VDPMKR TI +IR+H WF+  LP+YL   P D    +  ID+E L+EV  +       ++  L NR  Q+   VAY+L++DN   +      YL     ++   +    R HP          P   H L      ++      + KW LG++S++ P +IM EV +A ++L+  WK +  Y ++ R              NPV ++                   K  +QLY+     YLLD + ++
Sbjct:   24 IGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLF--PEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRR------------KNPVTST-----------------FSKMSLQLYQVDSRTYLLDFRSID 478          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2PW54_GOSRA0.000e+097.58Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2Q1M7_GOSRA0.000e+093.29Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0NJD8_GOSAR0.000e+093.52SNF1-related protein kinase catalytic subunit alph... [more]
A0A061EF40_THECC0.000e+092.98SNF1 kinase OS=Theobroma cacao GN=TCM_018660 PE=4 ... [more]
A0A0A0K9T5_CUCSA0.000e+087.95Uncharacterized protein OS=Cucumis sativus GN=Csa_... [more]
A0A067K4L4_JATCU0.000e+088.13Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
P93113_CUCSA0.000e+088.68SNF1-related protein kinase OS=Cucumis sativus PE=... [more]
A0A067GBB0_CITSI0.000e+087.35Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A0E3T4L5_9ROSI0.000e+086.72SNF-1 related protein kinase KIN10b OS=Dimocarpus ... [more]
B9H0G4_POPTR0.000e+087.57SNF1-related protein kinase KIN10 OS=Populus trich... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0010110 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
KIN10_ARATH0.000e+082.97SNF1-related protein kinase catalytic subunit alph... [more]
KIN11_ARATH0.000e+078.62SNF1-related protein kinase catalytic subunit alph... [more]
RKIN1_SECCE0.000e+066.67Carbon catabolite-derepressing protein kinase OS=S... [more]
AAPK2_RAT4.621e-14747.765'-AMP-activated protein kinase catalytic subunit ... [more]
AAPK2_PONAB1.117e-14647.565'-AMP-activated protein kinase catalytic subunit ... [more]
AAPK1_HUMAN1.690e-14647.535'-AMP-activated protein kinase catalytic subunit ... [more]
AAPK1_PONAB1.910e-14647.535'-AMP-activated protein kinase catalytic subunit ... [more]
AAPK2_PIG2.614e-14647.365'-AMP-activated protein kinase catalytic subunit ... [more]
AAPK2_HUMAN3.611e-14647.365'-AMP-activated protein kinase catalytic subunit ... [more]
AAPK1_RAT3.954e-14647.745'-AMP-activated protein kinase catalytic subunit ... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015940Ubiquitin-associated domainSMARTSM00165uba_6coord: 319..356
e-value: 9.6E-7
score: 38.4
IPR015940Ubiquitin-associated domainPFAMPF00627UBAcoord: 318..354
e-value: 4.3E-7
score: 29.6
IPR015940Ubiquitin-associated domainPROSITEPS50030UBAcoord: 317..357
score: 14.234
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 44..296
e-value: 2.9E-112
score: 389.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 44..296
e-value: 1.2E-79
score: 267.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 44..296
score: 54.605
NoneNo IPR availableGENE3D1.10.8.10coord: 319..355
e-value: 2.6E-4
score: 20.0
NoneNo IPR availableGENE3D3.30.200.20coord: 37..141
e-value: 6.8E-37
score: 125.9
NoneNo IPR availableGENE3D1.10.510.10coord: 142..316
e-value: 2.6E-68
score: 229.5
NoneNo IPR availablePANTHERPTHR24343:SF156SUBFAMILY NOT NAMEDcoord: 1..454
NoneNo IPR availablePANTHERPTHR24343SERINE/THREONINE KINASEcoord: 1..454
IPR028375KA1 domain/Ssp2, C-terminalGENE3D3.30.310.80coord: 411..532
e-value: 0.001
score: 18.4
IPR028375KA1 domain/Ssp2, C-terminalSUPERFAMILY103243KA1-likecoord: 353..533
IPR001772Kinase associated domain 1 (KA1)PFAMPF02149KA1coord: 491..532
e-value: 3.8E-13
score: 48.9
IPR001772Kinase associated domain 1 (KA1)PROSITEPS50032KA1coord: 485..533
score: 16.048
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 163..175
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 50..73
IPR011009Protein kinase-like domainSUPERFAMILY56112Protein kinase-like (PK-like)coord: 41..314

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0010110 ID=g.arboreum_cottongen_reftransV1_0010110|Name=g.arboreum_cottongen_reftransV1_0010110|organism=Gossypium arboreum|type=contig|length=1930bp
TTCATTTTCAGCTCAAATATCATATCATAATTCATAAAAACTCTCCTTTG
GTTACATACAACATTGTGGAAATTCTAATTATATCAAGGCATTGCCTTCA
GCCTCCACAATTACCCATCTAAAATTTAGGGTTATAAAACAAAAAAGGTT
TTAGTCAAAACTACCAAAAAATAGTTATTTACATAGAATATTCTCATTCT
TATTCACACGCTTCATAGGAGATTCATTGACAAGTCAATGGAAATATAAC
CTTCTCATGCTAGAGGACACGGAGCTGAGCGAGGAAAGCAGCGCAAAGGT
CCAAGAAGAGAAACTGTGGCCCCTCAACCCTCTGAAGATCCAGCAAATAC
TTTTCCTCGCGAGTTTTATAAAGCTGCACTTCAAACTTGACAACATTTGG
GGCCCTGGAAACACCATCATTTTCTATAATGGTCAATTCATAGTGACTGT
TGTGCACGGGATTGTTAACCAAGCCTTCATTAAGGCCAGGAATGCTAGCA
AGCCACCTACACTTCATGTTGTAATGACCAATTTTCTTCCAATACACATT
GAGTTCTTGAAAGGCTTTGAGAACTTCTGTCATGATTTCACGAGGGTGGG
CACGAGACTGAAGTCCAAGAGCCCACTTTCTTTCAAGGCCCCTTAAACCC
ATTGTTTGATAATCAGCATATCCTGTAAGGCGGTGTCCAACAGCTGGAAC
TGTAGGTTCATTTGGATGGATGCGATTGAAGCCAGATTCCATAGTTTCTT
GAAACTCAGCTCCAAGATAGCCACTGGAGACCCGGAACAGATTGTCCAAT
AGTAAGTAGTAAGCAACAGTTCCCTCATTTTGAATTCTGTTCCGAAGAGA
TTCGACCAAATGGTTCCGGTCGAATCCCATCCTAATCACTTCCTGAAGGA
TCTCCTCATCAATCTTTTTTGCTTGTTGCATTGAATCTGGTGGGGGGACA
GCTAAATATCTTGGAAGATGCGCTTGAAACCATGGGTGCTGGCGAATCTC
AGGAATGGTCATTCTCTTCATTGGATCAACTACAAGCATCCGTGGGATTA
AATCTCTAGCACCAGGAGATAAATGGCTTGGAAGAGTATATATGCCACCC
TTTATTTTCTTAAAGAGGTTGGGAATGTTTTCATCATCAAAAGGAAGAGT
GCCGCAAAGAAGGGCATACAATATAACACCACAGCTCCATACATCCACTT
CAGGTCCAGCATACAGTTTCCCAGAGATAACCTCTGGGGCAGCATAGTTT
GGGCTTCCACAACTTGTCTTCAGAAAATGACCATCTCTCATTATGTTGCT
CAAGCCAAAATCAGCAATCTTCACATTGCATTTGGAATCCAGAAGTAAAT
TTTCAGGCTTAAGGTCTCTATGAACCACCATGTTTCTGTGGCAGTACTCC
ACCCCAGAAATTATCTGCTGGAAAAAGTTGCGAGCCTCGTCCTCCTGCAA
CCTTCCTTTCTCTACAATATAATCAAAGAGTTCTCCAGACTTCACATACT
CCATAACCACAAAAATGTCAGTTGCTGTCTCTATCACCTCATAGAGTCGA
ATGATGTGAGGATGCATAAACAATCTCAAAATTTTAATCTCTCTTCTAAC
TTTTTCCTCCATCTCCATATTCTTAATCTTCCTTCGGTTAAGAATCTTAA
TGGCAACTTTGTGACCAGTCAAAATGTGCTCAGCAATTTTGACCTTTCCA
AAAGAACCAATTCCAAGCGTTTTTCCAAGCTTGTAATTCGATAATACACT
ATCCGCTCCTCTTCCTCCCGATCCATCCATTTTTCTTCCTTTTTTCTTAA
CTGATTCGATCGGAACTGCCTGTCTTAGGTTTTCTTTTGACGGAGAATCC
AATCGGAGGAACAAGCGAACGAGCGAGCGAACGAGCGAGAGAGAGAGTTT
TTTCTTATTGGTTAAAATTCTGACTTTTTT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR015940UBA
IPR000719Prot_kinase_dom
IPR028375KA1/Ssp2_C
IPR001772KA1_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation