g.arboreum_cottongen_reftransV1_0011016, g.arboreum_cottongen_reftransV1_0011016 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0011016
Unique Nameg.arboreum_cottongen_reftransV1_0011016
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2436
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr7chromosomeg.arboreum_cottongen_reftransV1_0011016:1..2436 .
Chr7:29256179..29258700 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: A0A0B0NUD9_GOSAR (Transmembrane C9orf5 OS=Gossypium arboreum GN=F383_21379 PE=4 SV=1)

HSP 1 Score: 1143.64 bits (2957), Expect = 0.000e+0
Identity = 652/653 (99.85%), Postives = 652/653 (99.85%), Query Frame = 3
Query:   69 MELVXXXXXXXXXXXXXXXXWQDMFRSASVRKPSPAPGNSDXXXXXXXXXXXXXXSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 2027
            MELVPYSSEPKPKPSSSTLPWQDMFRSASVRKPSPAPGNSDAPPNQPHAPPQVPNSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERIGGVGSLGIIVLGFVISTKNIDDSLSAVSSFRSNSFRRSRMSAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVITSTTSSSVRSTALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGA EIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD
Sbjct:    1 MELVPYSSEPKPKPSSSTLPWQDMFRSASVRKPSPAPGNSDAPPNQPHAPPQVPNSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERIGGVGSLGIIVLGFVISTKNIDDSLSAVSSFRSNSFRRSRMSAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVITSTTSSSVRSTALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGATEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 653          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: A0A0D2NKR8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G102500 PE=4 SV=1)

HSP 1 Score: 1143.26 bits (2956), Expect = 0.000e+0
Identity = 648/653 (99.23%), Postives = 650/653 (99.54%), Query Frame = 3
Query:   69 MELVXXXXXXXXXXXXXXXXWQDMFRSASVRKPSPAPGNSDXXXXXXXXXXXXXXSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 2027
            MELVPYSSEPKPKPSSSTLPWQDMFRSASVRKPSPAPGNSDAPPNQ HAPPQ PNSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERIGGVGSLGIIVLGFVISTKNIDDSL+AVSSFRSNSFRRSRMSAYFTTRILKRLDTIVAIGLIIG+FVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVITSTTSSSVRSTALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGA EIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD
Sbjct:    1 MELVPYSSEPKPKPSSSTLPWQDMFRSASVRKPSPAPGNSDAPPNQHHAPPQTPNSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERIGGVGSLGIIVLGFVISTKNIDDSLTAVSSFRSNSFRRSRMSAYFTTRILKRLDTIVAIGLIIGLFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVITSTTSSSVRSTALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGATEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 653          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: A0A0D2Q3K3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G102500 PE=4 SV=1)

HSP 1 Score: 1134.4 bits (2933), Expect = 0.000e+0
Identity = 646/653 (98.93%), Postives = 648/653 (99.23%), Query Frame = 3
Query:   69 MELVXXXXXXXXXXXXXXXXWQDMFRSASVRKPSPAPGNSDXXXXXXXXXXXXXXSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 2027
            MELVPYSSEPKPKPSSSTLPWQDMFRSASVRKPSPAPGNSDAPPNQ HAPPQ PNSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERIGGVGSLGIIVLGFVISTKNIDDSL+AVSSFRSNSFRRSRMSAYFTTRILKRLDTIVAIGLIIG+FVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVITSTTSSSVRSTALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGA EIQESIPGYSAYLTGLSIIGGMTLFPSA  GAIMGPLITTVVIALKDLYVEFVLEEPKKKD
Sbjct:    1 MELVPYSSEPKPKPSSSTLPWQDMFRSASVRKPSPAPGNSDAPPNQHHAPPQTPNSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERIGGVGSLGIIVLGFVISTKNIDDSLTAVSSFRSNSFRRSRMSAYFTTRILKRLDTIVAIGLIIGLFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVITSTTSSSVRSTALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGATEIQESIPGYSAYLTGLSIIGGMTLFPSA--GAIMGPLITTVVIALKDLYVEFVLEEPKKKD 651          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: A0A061F3M8_THECC (Uncharacterized protein isoform 1 OS=Theobroma cacao GN=TCM_030586 PE=4 SV=1)

HSP 1 Score: 1044.65 bits (2700), Expect = 0.000e+0
Identity = 573/653 (87.75%), Postives = 609/653 (93.26%), Query Frame = 3
Query:   69 MELVXXXXXXXXXXXXXXXXWQDMFRSASVRKPSPAPGNSDXXXXXXXXXXXXXXSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 2027
            MELVPYSSEP+ K S +TLPWQDMFRSAS+RKPSPAPG SDAPPNQ  APP  PNSTD DHKNSLSGDPQVRLALYIAMAHAGLAFTIFILY ICKLLQEY RPIQWAILCSIPLRGIQETLVGFW EPL+LGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKS LSRRKRSGF  LVRWLV+FAVFV+AYERIGGVGSL IIVLGF+ISTKN+D +LSAVSSFRS SFRRS +SAYFT  ILKRL+TIVAIGL+IGM VGFFAGATFFSYKIGVEGKDAV+SVK+HVEESNYAER+GVK+WMEENDVPGMVD+YT+Q YETVSEQID+LAMQYNMTEFVTGIKHFVITS TSSS  STALMTPSPYTEK L+LRKRVSNREWGQIYTEV AIFRELIITREDLV+KAKGFAVKGADVS++V AS ASVLGGGAKIM  +GNSI+ GAAEVFNFVSQ+MVFFWVLYYLITSESGGVTEQVMSMIPISK AR RCVEVLD AISGVLLATAEIAFFQGCLTWL+FRL++IHFVYMSTVLAFISPLLPIFPPWFATIPAA +L+LESRYI+A+ FSI HI LMDYG +EIQE IPGYSAYLT LSIIGGMTLFPSA+EGAIMGPLITTVVIALKDLY EFVLEEPKK+D
Sbjct:    1 MELVPYSSEPETKTSFTTLPWQDMFRSASIRKPSPAPGKSDAPPNQADAPPMAPNSTDSDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYGICKLLQEYLRPIQWAILCSIPLRGIQETLVGFWREPLKLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSTLSRRKRSGFSKLVRWLVSFAVFVVAYERIGGVGSLVIIVLGFMISTKNVDSTLSAVSSFRSTSFRRSAISAYFTRGILKRLNTIVAIGLMIGMIVGFFAGATFFSYKIGVEGKDAVISVKAHVEESNYAERIGVKKWMEENDVPGMVDQYTSQIYETVSEQIDSLAMQYNMTEFVTGIKHFVITSQTSSSAESTALMTPSPYTEKLLNLRKRVSNREWGQIYTEVAAIFRELIITREDLVEKAKGFAVKGADVSKQVFASGASVLGGGAKIMLVVGNSIISGAAEVFNFVSQMMVFFWVLYYLITSESGGVTEQVMSMIPISKSARFRCVEVLDNAISGVLLATAEIAFFQGCLTWLLFRLYKIHFVYMSTVLAFISPLLPIFPPWFATIPAATQLLLESRYILALTFSIIHIFLMDYGTSEIQEDIPGYSAYLTALSIIGGMTLFPSAIEGAIMGPLITTVVIALKDLYAEFVLEEPKKQD 653          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: B9S9X9_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0523330 PE=4 SV=1)

HSP 1 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 485/634 (76.50%), Postives = 553/634 (87.22%), Query Frame = 3
Query:  129 WQDMFRSASVRKPSPAPGNSDXXXXXXXXXXXXXXSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRR-KRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 2027
            WQDMFRSAS  KP+ +  +   PP    + P   NS +PD K +LSGDPQVRLALYIAMAHAGLAFTIFILY +CKLLQEY RPIQWA+LCSIPLRGIQETLV FW EPL LGLTETVLAVPVA+FKAF+GTLVDIK+V LRVFLK+ K++  RR +RSGF  LVRWLV+F VFVIAYERIGG+GSL I+ LGF+ S+K  D + SAVSSFR+NSFRRS + A+FT  I +RL T+VAIGLI+ M VGF AG  FFSYKIGVEGKDAV+S+KSHVEESNYAER+G+K+WMEENDVPGMVDKYTT  YETVS+QID+LAMQYNMTE VTGIKHFVI++  +SS +S+ALM+PSPYTEK LSLR +VSNR+WG+IY+E+DAIFRELIITREDLV+KAKGFA++G DVSQRV ASSASVLGGGAK+MF++GNSI+ GAAEVFNFVSQ MVFFWVLYYLITSESGGVTEQVM M+PI K A  RCVEVLD AISGVLLATAEIAFFQGCLTWL+FRL++IHF+Y+STVLAFISPL PIFP WFAT+PA ++L +ESRYI+A+  SI H+VLMDYGA+EI+E IPGYS YLT LSI+GGMTLFPSAVEGAIMGPLITTVVIALKDLY EFVLEE KK D
Sbjct:   20 WQDMFRSASFNKPTTS--HPPKPPPSSSSKPNSSNSNNPDRKTTLSGDPQVRLALYIAMAHAGLAFTIFILYFVCKLLQEYLRPIQWAVLCSIPLRGIQETLVAFWKEPLALGLTETVLAVPVAIFKAFVGTLVDIKEVLLRVFLKKAKTSGPRRNRRSGFSKLVRWLVSFGVFVIAYERIGGMGSLVILGLGFMCSSKTADSTFSAVSSFRTNSFRRSAIGAFFTRGISRRLKTMVAIGLIVAMIVGFLAGLIFFSYKIGVEGKDAVISLKSHVEESNYAERIGIKKWMEENDVPGMVDKYTTTVYETVSDQIDSLAMQYNMTELVTGIKHFVISTPANSSQQSSALMSPSPYTEKLLSLRTKVSNRQWGEIYSELDAIFRELIITREDLVEKAKGFALRGMDVSQRVFASSASVLGGGAKLMFSVGNSIISGAAEVFNFVSQSMVFFWVLYYLITSESGGVTEQVMQMLPIPKSASTRCVEVLDNAISGVLLATAEIAFFQGCLTWLLFRLYKIHFLYVSTVLAFISPLFPIFPSWFATLPATLQLAIESRYIMAITLSIIHVVLMDYGASEIKEDIPGYSEYLTALSILGGMTLFPSAVEGAIMGPLITTVVIALKDLYAEFVLEENKKND 651          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: A0A067F6Y3_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g006268mg PE=4 SV=1)

HSP 1 Score: 911.753 bits (2355), Expect = 0.000e+0
Identity = 492/653 (75.34%), Postives = 552/653 (84.53%), Query Frame = 3
Query:   69 MELVXXXXXXXXXXXXXXXXWQDMFRSASVRKPSPAPGNSDXXXXXXXXXXXXXXSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 2027
            MELVP+S +P  K SS+T PWQDMFRSAS+RKPS    +    P     PP   NST P  K + SGDPQVRLALYIA+AHAGLAFT+FILY I KLLQ+Y RPIQWAIL SIPLRGIQ+ LV FWSEPL+LGLTETVLAVPVA+FK F+GTLVDIK+V  +VFLK+ K+N  R  RSGF  LVRWLV+FAVFVIAYE IG VGSL I+ LGF+ ST N+D ++SAVSSFRS SF R+  S+YFT RILKRL+TIVAIGLI+GM V F AG  FFSYKIGVEGKDAV+S+KSHVEESNYAER+GVK+WMEENDVPGMVD+YTT FYETVSEQ+D+LAMQYNMTEFVTGIKHFVI     SS +S AL + SPYT+K +SLR RV+ REW QIYTEVDAIFREL+ITREDLVQKAK FA +G +VSQRV A SASVLG  AK+M + G  I+ GAAEVFNFVSQLM+F WVLYYLITSESGGVTEQVM M+PISKPARIRCVEV+D AISGVLLAT EIAFFQGCLTWL+FR F+IHF+YMST LAFIS L PIFP WFATIPAA++L+LESRYIVA+  S+ H+VL+DYG  EIQE IPGYS YLTGLSIIGGMTLFPSA+EGAIMGPLITTVVIALKDLYVEFVLEEPKK+D
Sbjct:    1 MELVPFSDDPDKKSSSTTPPWQDMFRSASIRKPSATSNSQAPLPESHAPPPSQANSTAPGQKTTCSGDPQVRLALYIALAHAGLAFTLFILYFIFKLLQDYIRPIQWAILLSIPLRGIQQALVAFWSEPLQLGLTETVLAVPVAIFKVFVGTLVDIKEVFFKVFLKKLKNNGPRHSRSGFSKLVRWLVSFAVFVIAYETIGAVGSLVILALGFLFSTTNVDSTMSAVSSFRSKSFGRTPFSSYFTRRILKRLETIVAIGLIVGMMVVFLAGIIFFSYKIGVEGKDAVISIKSHVEESNYAERLGVKKWMEENDVPGMVDRYTTTFYETVSEQVDSLAMQYNMTEFVTGIKHFVIAPPAGSSEQSKALTSLSPYTQKLMSLRNRVTKREWKQIYTEVDAIFRELVITREDLVQKAKEFAYQGINVSQRVFAGSASVLGSSAKLMLSTGYLIISGAAEVFNFVSQLMIFLWVLYYLITSESGGVTEQVMGMLPISKPARIRCVEVIDNAISGVLLATVEIAFFQGCLTWLLFRFFKIHFLYMSTTLAFISALFPIFPFWFATIPAAVQLLLESRYIVAISLSVIHLVLLDYGTCEIQEDIPGYSPYLTGLSIIGGMTLFPSALEGAIMGPLITTVVIALKDLYVEFVLEEPKKED 653          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: V4WGU0_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10007697mg PE=4 SV=1)

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 491/653 (75.19%), Postives = 552/653 (84.53%), Query Frame = 3
Query:   69 MELVXXXXXXXXXXXXXXXXWQDMFRSASVRKPSPAPGNSDXXXXXXXXXXXXXXSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 2027
            MELVP+S +P  K SS+T PWQDMFRSAS+RKPS    +    P     PP   NST P  K + SGDPQVRLALYIA+AHAGLAFT+FILY I KLLQ+Y RPIQWAIL SIPLRGIQ+ LV FWSEPL+LGLTETVLAVPVA+FK F+GTL+DIK+V  +VFLK+ K+N  R  RSGF  LVRWLV+FAVFVIAYE IG VGSL I+ LGF+ ST N+D ++SAVSSFRS SF R+  S+YFT RILKRL+TIVAIGLI+GM V F AG  FFSYKIGVEGKDAV+S+KSHVEESNYAER+GVK+WMEENDVPGMVD+YTT FYETVSEQ+D+LAMQYNMTEFVTGIKHFVI     SS +S AL + SPYT+K +SLR RV+ REW QIYTEVDAIFREL+ITREDLVQKAK FA +G +VSQRV A SASVLG  AK+M + G  I+ GAAEVFNFVSQLM+F WVLYYLITSESGGVTEQVM M+PISKPARIRCVEV+D AISGVLLAT EIAFFQGCLTWL+FR F+IHF+YMST LAFIS L PIFP WFATIPAA++L+LESRYIVA+  S+ H+VL+DYG  EIQE IPGYS YLTGLSIIGGMTLFPSA+EGAIMGPLITTVVIALKDLYVEFVLEEPKK+D
Sbjct:    1 MELVPFSDDPDKKSSSTTPPWQDMFRSASIRKPSATSNSQAPLPESHAPPPSQANSTAPGQKTTCSGDPQVRLALYIALAHAGLAFTLFILYFIFKLLQDYIRPIQWAILLSIPLRGIQQALVAFWSEPLQLGLTETVLAVPVAIFKVFVGTLLDIKEVFFKVFLKKLKNNGPRHSRSGFSKLVRWLVSFAVFVIAYETIGAVGSLVILALGFLFSTTNVDSTMSAVSSFRSKSFGRTPFSSYFTRRILKRLETIVAIGLIVGMMVVFLAGIIFFSYKIGVEGKDAVISIKSHVEESNYAERLGVKKWMEENDVPGMVDRYTTTFYETVSEQVDSLAMQYNMTEFVTGIKHFVIAPPAGSSEQSKALTSLSPYTQKLMSLRNRVTKREWKQIYTEVDAIFRELVITREDLVQKAKEFAYQGINVSQRVFAGSASVLGSSAKLMLSTGYLIISGAAEVFNFVSQLMIFLWVLYYLITSESGGVTEQVMGMLPISKPARIRCVEVIDNAISGVLLATVEIAFFQGCLTWLLFRFFKIHFLYMSTTLAFISALFPIFPFWFATIPAAVQLLLESRYIVAISLSVIHLVLLDYGTCEIQEDIPGYSPYLTGLSIIGGMTLFPSALEGAIMGPLITTVVIALKDLYVEFVLEEPKKED 653          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: M5WNL2_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa002632mg PE=4 SV=1)

HSP 1 Score: 909.442 bits (2349), Expect = 0.000e+0
Identity = 466/633 (73.62%), Postives = 541/633 (85.47%), Query Frame = 3
Query:  129 WQDMFRSASVRKPS-PAPGNSDXXXXXXXXXXXXXXSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKK 2024
            WQDMFRSAS+RK S P P   +                DPDHK +LSGDPQVRLALYI MAHAGLAFTIFILYA+ KLL+EY RPIQWA+LCSIPLRGIQ+TLVGFWSEPLRLGLTET+LAVPVA+F+ F+GTLV+I++VC R+FL++PKS   RR +S F  L+RWLV+F + ++AYERIGGVGSL I+ LGF+ S K +D ++S VSS R +SFRRS +SA+FT RIL RL TIVAIGLI  M VGF  G TFFSYKIGVE KDAV+S+K HVEESNY E++G+K+WMEENDVPGMVD+YT++ YETVS+QID+LAMQYNMTEF TGIKHF++  + +SS  STAL +PSPYTEK LSLR R+S REWG IYTEVDAI REL+ITREDLV+KAKGFA++G DVSQR+LASS SVLGG AK MF+IG+SI+ GAAE+FNFVSQLMVFFWVLYYLITSESGGVT QVMSM+PISK AR+RCVEVLD AISGVLLATAEIA FQGCLTWL+ RL++IHF+YMSTVLA +S LLPIFP WFATIPAA++LVLE RYI+A++ S+ H+VLMDYGA+EIQE IPG+S YLTGLSI+GGMTLFPSA+EGAIMGPLITTVVIALKDLYVEFVL EPK K
Sbjct:   20 WQDMFRSASIRKSSTPEPQVPEPQAPPKDPSK----RIDPDHKTTLSGDPQVRLALYITMAHAGLAFTIFILYAVGKLLEEYLRPIQWAVLCSIPLRGIQQTLVGFWSEPLRLGLTETLLAVPVAMFRVFVGTLVEIREVCFRIFLRKPKSEYRRRHQSEFSKLLRWLVSFWILILAYERIGGVGSLAILGLGFLFSAKGVDSTMSTVSSLRCSSFRRSPISAFFTRRILIRLKTIVAIGLIFAMIVGFLVGVTFFSYKIGVESKDAVISLKLHVEESNYTEKIGIKQWMEENDVPGMVDRYTSKLYETVSDQIDSLAMQYNMTEFATGIKHFIVRQSANSSEPSTALASPSPYTEKLLSLRNRISKREWGHIYTEVDAIVRELVITREDLVEKAKGFAIRGMDVSQRILASSTSVLGGSAKFMFSIGSSIVSGAAEIFNFVSQLMVFFWVLYYLITSESGGVTAQVMSMLPISKSARVRCVEVLDNAISGVLLATAEIAIFQGCLTWLLLRLYKIHFLYMSTVLAILSSLLPIFPSWFATIPAALQLVLEGRYIIAIILSVIHLVLMDYGASEIQEDIPGHSEYLTGLSILGGMTLFPSALEGAIMGPLITTVVIALKDLYVEFVLGEPKDK 648          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: B9GG00_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s37940g PE=4 SV=2)

HSP 1 Score: 908.672 bits (2347), Expect = 0.000e+0
Identity = 474/639 (74.18%), Postives = 544/639 (85.13%), Query Frame = 3
Query:  129 WQDMFRSASVRKPSPAPGNSDXXXXXXXXXXXXXXSTDPDHKN--------SLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRRKRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKK 2021
            WQDMFRSAS RKPS     +  PP+ P          D  H N        S SGDPQVRLALYIAMAHAGLAF IFILY +CKLLQ Y RPIQWAILCSIPLRGIQ+TLV FW+EPL+LGLTETVLAVPV++F  F+GTLVDIK+VCLRVFLK+ K + SRR RSGF  L+RWL++F VFVI+YERIGG+GSL I+  GF+ STK ++ + S VSS R+ SFRRS ++ +FT  +LKRL TIVAIGLI+GM VG  AG  FFSYKI VEGKDAV+S+KSHVEESNYAE++G+K+WM+ENDVPGMVDKYTT FYETVS+QID+LAMQYNMTEFVTGI+HFVI+   ++S +S ALM+PSPYTEK LSLRK+V N+EWG+IYTE+DAIFRELI TREDLV+KAKG+AV+G +VSQRV ASSASVLGGGAK+M +IGNSI+ GAAEVFNFVSQ ++FFWVLYYLITSESGGVT QVM M+PI KPARIRCVEVLD+AISGVLLATAEIAFFQGCLTWL+FRL++IHF+Y+ST+LA  SPL PIFPP FATIPAA++LV+E RYI+AV  SI HIVLMDYGA EIQE IPGY+ YLTGLSIIGGMTLFPSA+EGAIMGPLITTVVI LKDLYVEFVLEEPKK
Sbjct:   18 WQDMFRSASYRKPS----TTPPPPSPPQPNAPPHAPNDHHHHNNKTSASTFSASGDPQVRLALYIAMAHAGLAFAIFILYFVCKLLQAYLRPIQWAILCSIPLRGIQQTLVAFWTEPLQLGLTETVLAVPVSIFTVFVGTLVDIKEVCLRVFLKKSKGDSSRRHRSGFSKLLRWLLSFGVFVISYERIGGLGSLLILASGFLCSTKTVNSTFSTVSSLRNYSFRRSSITPFFTRGVLKRLKTIVAIGLIVGMIVGSLAGLIFFSYKIAVEGKDAVISLKSHVEESNYAEKLGIKQWMDENDVPGMVDKYTTTFYETVSDQIDSLAMQYNMTEFVTGIRHFVISPPANTSQQSVALMSPSPYTEKMLSLRKKVLNQEWGEIYTELDAIFRELIFTREDLVEKAKGYAVQGMEVSQRVFASSASVLGGGAKLMLSIGNSIISGAAEVFNFVSQSVIFFWVLYYLITSESGGVTNQVMGMLPIPKPARIRCVEVLDKAISGVLLATAEIAFFQGCLTWLLFRLYDIHFLYVSTILAIFSPLFPIFPPMFATIPAAVQLVMEGRYILAVSLSIIHIVLMDYGATEIQEDIPGYNEYLTGLSIIGGMTLFPSAIEGAIMGPLITTVVIGLKDLYVEFVLEEPKK 652          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Match: A0A067L497_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_01077 PE=4 SV=1)

HSP 1 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 467/634 (73.66%), Postives = 549/634 (86.59%), Query Frame = 3
Query:  129 WQDMFRSASVRKPSPAPGNSDXXXXXXXXXXXXXXSTDPDHKNSLSGDPQVRLALYIAMAHAGLAFTIFILYAICKLLQEYFRPIQWAILCSIPLRGIQETLVGFWSEPLRLGLTETVLAVPVAVFKAFIGTLVDIKDVCLRVFLKRPKSNLSRR-KRSGFPMLVRWLVAFAVFVIAYERXXXXXXXXXXXXXXXXSTKNIDDXXXXXXXXXXXXXXXXXXXAYFTTRILKRLDTIVAIGLIIGMFVGFFAGATFFSYKIGVEGKDAVVSVKSHVEESNYAERMGVKRWMEENDVPGMVDKYTTQFYETVSEQIDNLAMQYNMTEFVTGIKHFVIXXXXXXXXXXXALMTPSPYTEKFLSLRKRVSNREWGQIYTEVDAIFRELIITREDLVQKAKGFAVKGADVSQRVLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITSESGGVTEQVMSMIPISKPARIRCVEVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVLESRYIVAVVFSISHIVLMDYGAAEIQESIPGYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD 2027
            WQDMFRS S RKP+     ++ P    +   + P S+D D K + SGDPQVRLALYIAMAHAGLAFTIFI+Y + KLLQEY+RP+QWAILCSIPLRGIQETLV FWSEPL+LGLTETVLAVPVA+FKAF+GTLVD K+V LRVFLKRPK    RR +RSGF  LVRWLV+F VFV+AYERIGG+GSL II LGF+ ST   D + S VSSF++NSF+RS +SA+FT RILK+L TIVA+GLI+GM VG   G  FFSYKIGVEGK+AV+S+KSHVEE+NYAER+G+K+WM++NDVPGMVDKYTT  Y TVS+QID+LA QYNMTE VTGIKHFVI+S  +SSV S++LM PSP+T+K ++LR +VSNR+W +IYTE+DAIFRELIIT+EDLV+KAK FAV+G DVSQR+ ASSASVLGGG K+MF++GNS++ GAAEVFNFVSQ MVFFWVLYYLITSESGGVTEQVM M+PI + AR+RCVEVL++AISGVLLATAEIA FQGCLTWL+FRL++IHFVY+STVLAF+SPLLPIFPPWFATIPA ++LV+ESRY++AV FSI H++LMDYGA+EIQE IPGYS YLTGLSI+GGMTLFPSAVE AIMGPLITTV+I LKDLY EFVL E K K+
Sbjct:   20 WQDMFRSGSFRKPT----TTNPPKPPSNTSTEPPQSSDSDKKTTFSGDPQVRLALYIAMAHAGLAFTIFIIYFVGKLLQEYWRPLQWAILCSIPLRGIQETLVEFWSEPLQLGLTETVLAVPVAIFKAFVGTLVDFKEVLLRVFLKRPKREDPRRTRRSGFSKLVRWLVSFGVFVLAYERIGGIGSLLIIGLGFMCSTTTADSTFSVVSSFKNNSFKRSAISAFFTRRILKKLKTIVAVGLIVGMIVGSLVGLIFFSYKIGVEGKNAVISLKSHVEENNYAERIGIKQWMDDNDVPGMVDKYTTALYVTVSDQIDSLAEQYNMTELVTGIKHFVISSPANSSVESSSLMIPSPFTQKLVNLRTKVSNRQWSEIYTELDAIFRELIITQEDLVEKAKAFAVRGMDVSQRIFASSASVLGGGFKVMFSVGNSVISGAAEVFNFVSQSMVFFWVLYYLITSESGGVTEQVMYMLPIPESARVRCVEVLEDAISGVLLATAEIALFQGCLTWLLFRLYKIHFVYVSTVLAFLSPLLPIFPPWFATIPATLQLVMESRYVLAVSFSIIHVLLMDYGASEIQEDIPGYSEYLTGLSILGGMTLFPSAVEVAIMGPLITTVLIGLKDLYAEFVLGEQKPKN 649          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy Swiss-Prot
Match: TM245_HUMAN (Transmembrane protein 245 OS=Homo sapiens GN=TMEM245 PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.445e-16
Identity = 64/217 (29.49%), Postives = 114/217 (52.53%), Query Frame = 3
Query: 1422 YGAAEVFNFVSQLMVFFWVLYYLITS--ESGGVTEQVMSMIPISKPARIRCV--EVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVL-ESRYIVAVVFSISHIVLMDYGAAEIQESIPGYS-AYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD*KN-TPYPS 2051
            Y    + NFV  L++F   L+YL++S  E     + V+S+ P+S+P     +  + ++EAI GV  A+ ++A F G  TWL   +F I+ V++ + LA I   +P    ++A +PA ++L L +     A++  I H++   +    I   I G    YLTGL++ GG       +EGAI+GP++  +++   ++Y   ++         N TP+P+
Sbjct:  647 YSGTALLNFVLSLIIFLTTLFYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIGQSVEEAIRGVFDASLKMAGFYGLYTWLTHTMFGINIVFIPSALAAILGAVPFLGTYWAAVPAVLDLWLTQGLGCKAILLLIFHLLPTYFVDTAIYSDISGGGHPYLTGLAVAGGAYYL--GLEGAIIGPILLCILVVASNIYSAMLVSPTNSVPTPNQTPWPA 861          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy Swiss-Prot
Match: TM245_MOUSE (Transmembrane protein 245 OS=Mus musculus GN=Tmem245 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.374e-16
Identity = 63/217 (29.03%), Postives = 114/217 (52.53%), Query Frame = 3
Query: 1422 YGAAEVFNFVSQLMVFFWVLYYLITS--ESGGVTEQVMSMIPISKPARIRCV--EVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVL-ESRYIVAVVFSISHIVLMDYGAAEIQESIP-GYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD*KN-TPYPS 2051
            Y    + NFV  L++F   L+YL++S  E     + V+S+ P+S+P     +  + ++EAI GV  A+ ++A F G  TWL   +F I+ V++ + LA I   +P    ++A +PA ++L L +     A++  + H++   +    I   I  G   YLTGL++ GG       +EGAI+GP++  +++   ++Y   ++         N TP+P+
Sbjct:  644 YSGTALLNFVLSLIIFLTTLFYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIGQSVEEAIRGVFDASLKMAGFYGLYTWLTHTIFGINIVFIPSALAAILGAVPFLGTYWAAVPAVLDLWLTQGLGCKAILLLVFHLLPTYFVDTAIYSDISGGGHPYLTGLAVAGGAYYL--GLEGAIIGPILLCILVVASNIYSAMLVSPTNSMPTPNQTPWPA 858          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy Swiss-Prot
Match: TM245_RAT (Transmembrane protein 245 OS=Rattus norvegicus GN=Tmem245 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 8.387e-16
Identity = 63/217 (29.03%), Postives = 113/217 (52.07%), Query Frame = 3
Query: 1422 YGAAEVFNFVSQLMVFFWVLYYLITS--ESGGVTEQVMSMIPISKPARIRCV--EVLDEAISGVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVL-ESRYIVAVVFSISHIVLMDYGAAEIQESIP-GYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKK-KD*KNTPYPS 2051
            Y    + NFV  L++F   L+YL++S  E     + V+S+ P+S+P     +  + ++EAI GV  A+ ++A F G  TWL   +F I+ V++ + LA I   +P    ++A +PA ++L L +     AV+  + H++   +    I   I  G   YLTGL++ GG       +EGAI+GP++  +++   ++Y   ++           TP+P+
Sbjct:  644 YSGTALLNFVLSLIIFLTTLFYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIGQSVEEAIRGVFDASLKMAGFYGLYTWLTHTVFGINIVFIPSALAAILGAVPFLGTYWAAVPAVLDLWLTQGLGCKAVLLLVFHLLPTYFVDTAIYSDISGGGHPYLTGLAVAGGAYYL--GLEGAIIGPILLCILVVASNIYSAMLVSPTNSMPTPSQTPWPA 858          
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy Swiss-Prot
Match: TM245_BOVIN (Transmembrane protein 245 OS=Bos taurus GN=TMEM245 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.365e-15
Identity = 68/244 (27.87%), Postives = 125/244 (51.23%), Query Frame = 3
Query: 1350 VLASSASVLGGGAKIMFTIGNSILYGAAEVFNFVSQLMVFFWVLYYLITS--ESGGVTEQVMSMIPISKPARIRCV--EVLDEAIS---GVLLATAEIAFFQGCLTWLMFRLFEIHFVYMSTVLAFISPLLPIFPPWFATIPAAIELVL-ESRYIVAVVFSISHIVLMDYGAAEIQESIP-GYSAYLTGLSIIGGMTLFPSAVEGAIMGPLITTVVIALKDLYVEFVLEEPKKKD*KN-TPYPS 2051
            V++ + S+L      + TI   + Y    + NFV  L++F   L+YL++S  E     + V+S+ P+S+P     +  + ++EAI    GV  A+ ++A F G  TWL   +F I+ V++ + LA I   +P    ++A +PA ++L L +     A++  + H++   +    I   I  G   YLTGL++ GG       +EGAI+GP++  +++   ++Y   ++         N TP+P+
Sbjct:  626 VMSRNVSLLFSTITTLLTI---LFYSGTALLNFVLSLIIFLTTLFYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIGQSVEEAIRHSRGVFDASLKMAGFYGLYTWLTHTIFGINIVFIPSALAAILGAVPFLGTYWAAVPAVLDLWLTQGLGCKAILLLVFHLLPTYFVDTAIYSDISGGGHPYLTGLAVAGGAYYL--GLEGAIIGPILLCILVVASNIYSAMLVSPTNSVPTPNQTPWPA 864          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NUD9_GOSAR0.000e+099.85Transmembrane C9orf5 OS=Gossypium arboreum GN=F383... [more]
A0A0D2NKR8_GOSRA0.000e+099.23Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2Q3K3_GOSRA0.000e+098.93Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061F3M8_THECC0.000e+087.75Uncharacterized protein isoform 1 OS=Theobroma cac... [more]
B9S9X9_RICCO0.000e+076.50Putative uncharacterized protein OS=Ricinus commun... [more]
A0A067F6Y3_CITSI0.000e+075.34Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
V4WGU0_9ROSI0.000e+075.19Uncharacterized protein OS=Citrus clementina GN=CI... [more]
M5WNL2_PRUPE0.000e+073.62Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
B9GG00_POPTR0.000e+074.18Uncharacterized protein OS=Populus trichocarpa GN=... [more]
A0A067L497_JATCU0.000e+073.66Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0011016 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
TM245_HUMAN1.445e-1629.49Transmembrane protein 245 OS=Homo sapiens GN=TMEM2... [more]
TM245_MOUSE2.374e-1629.03Transmembrane protein 245 OS=Mus musculus GN=Tmem2... [more]
TM245_RAT8.387e-1629.03Transmembrane protein 245 OS=Rattus norvegicus GN=... [more]
TM245_BOVIN5.365e-1527.87Transmembrane protein 245 OS=Bos taurus GN=TMEM245... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002549Transmembrane protein TqsA-likePFAMPF01594UPF0118coord: 447..639
e-value: 2.0E-9
score: 36.9
IPR002549Transmembrane protein TqsA-likePANTHERPTHR21716TRANSMEMBRANE PROTEINcoord: 34..654
NoneNo IPR availablePANTHERPTHR21716:SF4TRANSMEMBRANE PROTEIN 245coord: 34..654
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 452..477
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 509..532
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 627..648
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 592..602
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 539..561
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 533..538
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..74
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 573..591
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 257..277
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 622..626
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 75..97
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 188..217
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 168..187
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 562..572
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 603..621
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 98..108
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 130..140
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 218..256
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 141..167
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 278..451
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 649..655
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 478..508
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 109..129
NoneNo IPR availableTMHMMTMhelixcoord: 626..648
NoneNo IPR availableTMHMMTMhelixcoord: 539..561
NoneNo IPR availableTMHMMTMhelixcoord: 185..217
NoneNo IPR availableTMHMMTMhelixcoord: 257..279
NoneNo IPR availableTMHMMTMhelixcoord: 510..532
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 452..474
NoneNo IPR availableTMHMMTMhelixcoord: 571..588
NoneNo IPR availableTMHMMTMhelixcoord: 600..622

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0011016 ID=g.arboreum_cottongen_reftransV1_0011016|Name=g.arboreum_cottongen_reftransV1_0011016|organism=Gossypium arboreum|type=contig|length=2436bp
CAAAGGAACTTTGTCTCTCTTCTTCTGCAAAGACTTGATCTTTCTGTGTT
CGAAAAACTGTCCTGGACATGGAGTTGGTTCCATATTCAAGTGAACCAAA
ACCCAAACCAAGCTCCTCAACTCTTCCATGGCAAGACATGTTCCGATCTG
CATCGGTAAGGAAGCCTTCTCCAGCACCAGGCAACAGCGACGCGCCTCCC
AACCAACCTCACGCGCCACCCCAGGTTCCGAACTCAACCGACCCAGATCA
CAAAAACAGCCTCTCGGGTGATCCCCAGGTACGGTTGGCTCTTTACATAG
CCATGGCTCATGCTGGCCTTGCCTTCACCATATTCATTTTATATGCGATT
TGCAAGCTTTTGCAAGAGTATTTTAGGCCAATTCAGTGGGCTATCTTGTG
TTCGATTCCTTTAAGAGGTATACAAGAAACCCTTGTGGGATTTTGGAGCG
AACCTTTGAGACTAGGCCTCACTGAAACTGTTCTTGCTGTTCCTGTTGCT
GTCTTCAAGGCTTTTATAGGTACCCTTGTTGATATTAAGGATGTCTGTTT
GAGGGTGTTCCTTAAAAGACCAAAATCTAATCTTTCAAGGCGCAAGAGAA
GTGGGTTTCCAATGCTAGTTAGGTGGTTAGTAGCTTTCGCTGTGTTTGTG
ATTGCCTATGAGAGAATTGGTGGTGTTGGGTCATTGGGCATAATTGTGTT
GGGGTTTGTGATTAGTACTAAAAACATAGATGATTCATTGTCTGCTGTTT
CATCATTTAGGAGTAACAGTTTCAGGAGAAGTAGAATGAGTGCGTATTTC
ACTACTAGGATACTTAAAAGGTTGGATACTATTGTGGCTATTGGGCTGAT
AATTGGTATGTTTGTGGGGTTCTTTGCTGGAGCTACATTTTTCTCGTATA
AGATCGGTGTTGAGGGAAAAGATGCCGTGGTTTCGGTGAAATCTCATGTG
GAAGAGAGTAACTATGCTGAGAGGATGGGTGTTAAAAGATGGATGGAAGA
GAATGATGTCCCTGGAATGGTGGATAAGTACACTACTCAGTTCTATGAAA
CAGTTTCCGAGCAGATTGATAACTTGGCAATGCAGTATAATATGACGGAG
TTTGTGACCGGAATTAAGCATTTCGTCATAACTTCAACCACCAGTTCATC
AGTGCGATCGACAGCTTTGATGACCCCCTCTCCTTATACGGAAAAGTTTT
TGAGTTTGAGGAAGAGGGTTAGCAATCGCGAGTGGGGGCAAATTTACACC
GAAGTCGATGCGATTTTCAGAGAGTTGATAATCACTCGGGAGGATTTGGT
GCAAAAGGCTAAAGGGTTTGCTGTTAAAGGGGCAGATGTTTCGCAACGGG
TGCTAGCAAGCAGTGCTTCTGTTTTAGGTGGAGGCGCGAAGATCATGTTC
ACCATCGGCAATTCCATCCTCTACGGAGCTGCTGAGGTGTTCAATTTTGT
ATCTCAGTTGATGGTGTTCTTTTGGGTTCTATATTACCTTATCACATCAG
AATCTGGTGGAGTAACAGAACAAGTAATGTCTATGATTCCAATATCAAAA
CCGGCTAGGATTAGATGCGTGGAAGTTCTTGATGAAGCTATTTCTGGCGT
GCTTTTGGCAACAGCTGAGATTGCATTCTTTCAAGGATGTCTTACATGGC
TTATGTTTAGACTGTTTGAAATACACTTTGTGTATATGTCAACAGTGCTT
GCTTTCATCAGCCCCTTATTGCCCATATTTCCACCTTGGTTTGCGACAAT
TCCTGCAGCTATAGAACTAGTGCTTGAAAGTAGATACATAGTAGCTGTGG
TCTTCTCCATTAGTCACATTGTGCTTATGGATTATGGTGCTGCTGAAATC
CAGGAGAGCATACCTGGTTACAGTGCCTACCTTACAGGGCTTAGCATCAT
TGGTGGAATGACATTGTTCCCTTCTGCAGTTGAGGGAGCAATTATGGGAC
CATTGATTACGACGGTTGTGATCGCTTTGAAAGATCTCTATGTGGAATTC
GTTCTGGAAGAACCTAAGAAAAAAGACTAGAAGAACACACCATACCCTTC
AACGGGTTTGCTTCCATGGTGGAGAGAGCTCATGTATATTAGTACCACTG
GTTTCCAACAACTTCAAACCACAATTCTTTGCTACTTGAACAGTGCTTCA
ATCTACATGCTATGTTTATTACATTTTTTTATATCCCTTTGAAATCAGTG
GCAATGGTTATGTATCCTCGTGTTTGCTTAGAAAGAAAGCAATATCGTAT
ATTCTTTGATTCAGTATTTAAACATGTAATAACTGGTGAAGCCAATGTTT
GAGTTCTGTATTTAAACAAGTAAGAACTGGTGAAAGGCAATATTTGAGTT
GAGAGAGAATGTGTGAAGTTGGTGGACTTGTTTCTTTATTTTTATCTGTT
ACAGGCAGCACCAAATAATACATCCCAAGAAGCAAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002549AI-2E-like