g.arboreum_cottongen_reftransV1_0004832, g.arboreum_cottongen_reftransV1_0004832 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0004832
Unique Nameg.arboreum_cottongen_reftransV1_0004832
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length797
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr12chromosomeg.arboreum_cottongen_reftransV1_0004832:1..797 .
Chr12:48527132..48529056 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: A0A0B0P3I3_GOSAR (Lecithine-cholesterol acyltransferase-like 4 OS=Gossypium arboreum GN=F383_02751 PE=4 SV=1)

HSP 1 Score: 422.935 bits (1086), Expect = 1.713e-142
Identity = 204/205 (99.51%), Postives = 204/205 (99.51%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQK VKNW
Sbjct:    1 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKNVKNW 205          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: A0A0D2UJS1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G237300 PE=4 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 4.804e-135
Identity = 193/205 (94.15%), Postives = 198/205 (96.59%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            MAMLLEDI+QSVE+WLKLIKKPQPY DPNLDPVLLVPGIAGSIL AVDDQNGKEERVWVRILGA+YKFRTKLWSRFDPSTGKTESLDPN TI+VP  RYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLA KLE VYEASGGKKINVISHSMGGLLVKCFMGLHSD+FQKYVKNW
Sbjct:    1 MAMLLEDIVQSVEMWLKLIKKPQPYGDPNLDPVLLVPGIAGSILNAVDDQNGKEERVWVRILGADYKFRTKLWSRFDPSTGKTESLDPNATIRVPEERYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAAKLESVYEASGGKKINVISHSMGGLLVKCFMGLHSDVFQKYVKNW 205          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: A0A061GCD7_THECC (Alpha/beta-Hydrolases superfamily protein isoform 2 OS=Theobroma cacao GN=TCM_029386 PE=4 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.467e-124
Identity = 176/205 (85.85%), Postives = 193/205 (94.15%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            MAMLLEDI+QSVE+WLKL++KPQPYVDP+LDPVLLVPGIAGSIL AVD QNGKEERVWVRILGA+YK RTKLWSRFDPSTG+T SLDP+T+I VP  RYGL AIDVLDPDMI+GR+CV YFHDMIVEM+KWGFQEGKTLFGFGYDFRQSNRLQET+DRLA KLE VY+ASGGKKIN+ISHSMGGLL+KCFM LHSDIF+KYVKNW
Sbjct:    1 MAMLLEDIVQSVEMWLKLMRKPQPYVDPDLDPVLLVPGIAGSILNAVDGQNGKEERVWVRILGADYKLRTKLWSRFDPSTGRTVSLDPSTSITVPEERYGLYAIDVLDPDMIIGRECVYYFHDMIVEMIKWGFQEGKTLFGFGYDFRQSNRLQETLDRLAAKLESVYKASGGKKINIISHSMGGLLIKCFMALHSDIFEKYVKNW 205          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: A0A061GKE0_THECC (Alpha/beta-Hydrolases superfamily protein isoform 1 OS=Theobroma cacao GN=TCM_029386 PE=4 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 3.400e-123
Identity = 176/205 (85.85%), Postives = 193/205 (94.15%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            MAMLLEDI+QSVE+WLKL++KPQPYVDP+LDPVLLVPGIAGSIL AVD QNGKEERVWVRILGA+YK RTKLWSRFDPSTG+T SLDP+T+I VP  RYGL AIDVLDPDMI+GR+CV YFHDMIVEM+KWGFQEGKTLFGFGYDFRQSNRLQET+DRLA KLE VY+ASGGKKIN+ISHSMGGLL+KCFM LHSDIF+KYVKNW
Sbjct:    1 MAMLLEDIVQSVEMWLKLMRKPQPYVDPDLDPVLLVPGIAGSILNAVDGQNGKEERVWVRILGADYKLRTKLWSRFDPSTGRTVSLDPSTSITVPEERYGLYAIDVLDPDMIIGRECVYYFHDMIVEMIKWGFQEGKTLFGFGYDFRQSNRLQETLDRLAAKLESVYKASGGKKINIISHSMGGLLIKCFMALHSDIFEKYVKNW 205          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: M5WN28_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa004058mg PE=4 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.420e-121
Identity = 172/205 (83.90%), Postives = 188/205 (91.71%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            M MLLE+I+QSVE+WLKLIKKPQPYVDPNLDPVLLVPGIAGSIL AVDD+NG EERVWVRILGA+YKFRTKLWSRFDPSTGKT SLDP   I VP GRYGL AID LDPDM++G++CV YFHDMIVE  KWGFQEGKTLFGFGYDFRQSNRLQET+DRLAEKLE VY A+GGKKIN+I+HSMGGLLVKCFM LH+D+F+KYVKNW
Sbjct:    1 MTMLLEEIVQSVELWLKLIKKPQPYVDPNLDPVLLVPGIAGSILNAVDDENGTEERVWVRILGADYKFRTKLWSRFDPSTGKTVSLDPKARIVVPEGRYGLEAIDALDPDMVIGQECVYYFHDMIVEFTKWGFQEGKTLFGFGYDFRQSNRLQETLDRLAEKLEAVYNAAGGKKINIITHSMGGLLVKCFMCLHTDVFEKYVKNW 205          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: D7T9J5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0011g01830 PE=4 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 1.418e-118
Identity = 172/205 (83.90%), Postives = 187/205 (91.22%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            MA+LLE+I QSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSIL AVDD NG+ ERVWVRI+GA+YKFRTKLWSRFDPSTG+T SLDP T I VP  RYGL AIDVLDP+MI+GRDCV YFHDMIVEM+KWGFQEGKTLFGFGYDFRQSNR QET++R A KLE VY ASGGKKIN+ISHSMGGLLVKCFM LH+DIF+KYV+NW
Sbjct:    1 MAVLLEEIAQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILKAVDD-NGRGERVWVRIIGADYKFRTKLWSRFDPSTGQTVSLDPKTHIVVPEERYGLHAIDVLDPEMIIGRDCVYYFHDMIVEMMKWGFQEGKTLFGFGYDFRQSNRFQETLERFAAKLEAVYTASGGKKINIISHSMGGLLVKCFMSLHTDIFEKYVQNW 204          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: U5FRA7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0015s15420g PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 6.299e-117
Identity = 169/206 (82.04%), Postives = 187/206 (90.78%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNG-KEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            MAMLLEDI++SVE+WL+LIKKPQPYVDPNLDPVLLVPGIAGSIL AVD +NG KEERVW+RIL A+Y  RTKLWSRFDP TG++ +LDP   I VP  RYGL AIDVLDPDMI+GRDCV YFHDMIVEM+KWGFQEGKTLFGFGYDFRQSNRL ET++RLA+KLE VY+ASGGKKIN+ISHSMGGLLVKCFM LHSDIF+KYVKNW
Sbjct:    1 MAMLLEDIVRSVELWLRLIKKPQPYVDPNLDPVLLVPGIAGSILKAVDKENGDKEERVWIRILAADYTCRTKLWSRFDPQTGRSVTLDPKRNIVVPEDRYGLHAIDVLDPDMIIGRDCVYYFHDMIVEMIKWGFQEGKTLFGFGYDFRQSNRLPETLERLAKKLESVYQASGGKKINIISHSMGGLLVKCFMSLHSDIFEKYVKNW 206          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: A0A059C4X7_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_E01878 PE=4 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 1.653e-116
Identity = 170/205 (82.93%), Postives = 182/205 (88.78%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            MA+LLEDILQSVE WLKLI+KPQPYVDPNLDPVLLVPG+AGSIL AVD  NGK ERVWVRI GA+YK RTKLWSRFDP+ GKT SLDP T I VP  RYGL AIDVLDPDM++GRDCV YFHDMIVEM+KWGFQEGKTLFGFGYDFRQSNR QETM+RLA KLE VY A+GGKK+ +ISHSMGGLLVKCFM LHSDIF KYVKNW
Sbjct:    1 MAVLLEDILQSVEQWLKLIRKPQPYVDPNLDPVLLVPGVAGSILHAVDGSNGKGERVWVRIFGADYKCRTKLWSRFDPAVGKTVSLDPKTNIVVPEDRYGLYAIDVLDPDMVLGRDCVYYFHDMIVEMIKWGFQEGKTLFGFGYDFRQSNRFQETMERLAAKLESVYNAAGGKKMTIISHSMGGLLVKCFMCLHSDIFAKYVKNW 205          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: B9SDQ9_RICCO (Phosphatidylcholine-sterol O-acyltransferase, putative OS=Ricinus communis GN=RCOM_1289750 PE=4 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 6.905e-116
Identity = 170/206 (82.52%), Postives = 187/206 (90.78%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVDDQNGKE-ERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            MA+LLEDI+QSVE+WLKLIKK QPYVDPNLDPVLLVPGIAGSIL AVDD + K  ERVWVRIL A+YKFRTKLWSRFDPSTGKT SLDP T I VP  RYGL AID+LDPD+I+GR+CV YFHDMIVEM+KWGF+EGKTLFGFGYDFRQSNRL ET++  A+KLELVY+ASGGKKIN+ISHSMGGLLVKCFM LHSDIF+KYVKNW
Sbjct:    1 MAVLLEDIVQSVELWLKLIKKAQPYVDPNLDPVLLVPGIAGSILHAVDDNSDKSVERVWVRILRADYKFRTKLWSRFDPSTGKTVSLDPKTNIVVPQDRYGLHAIDILDPDLIIGRECVFYFHDMIVEMIKWGFEEGKTLFGFGYDFRQSNRLPETLESFAKKLELVYKASGGKKINIISHSMGGLLVKCFMSLHSDIFEKYVKNW 206          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Match: U5FUA6_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0012s12220g PE=4 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 5.829e-115
Identity = 169/206 (82.04%), Postives = 185/206 (89.81%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQPYVDPNLDPVLLVPGIAGSILTAVD-DQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            MAMLLEDI++SVE+WL LIKKPQPYVDP+LDPVLLVPGIAGSIL AVD D  GKEERVWVRIL A+Y  RTKLWSRFDP TG++ +LDP T I VP  RYGL AIDVLDPDMI+GRDCV YFHDMIVEM+KWGFQEGKTLFGFGYDFRQSNRL ET++ LA+KLE VY+ASGGKKIN+ISHSMGGLLVKCFM LHSDIF+KYVKNW
Sbjct:    1 MAMLLEDIVRSVELWLNLIKKPQPYVDPSLDPVLLVPGIAGSILKAVDKDNGGKEERVWVRILAADYTCRTKLWSRFDPQTGRSVTLDPKTNIVVPDDRYGLHAIDVLDPDMIIGRDCVYYFHDMIVEMIKWGFQEGKTLFGFGYDFRQSNRLPETLECLAKKLESVYKASGGKKINIISHSMGGLLVKCFMSLHSDIFEKYVKNW 206          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy Swiss-Prot
Match: LCAT4_ARATH (Lecithin-cholesterol acyltransferase-like 4 OS=Arabidopsis thaliana GN=LCAT4 PE=1 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 5.358e-109
Identity = 160/206 (77.67%), Postives = 183/206 (88.83%), Query Frame = -2
Query:    2 MAMLLEDILQSVEIWLKLIKKPQ-PYVDPNLDPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 616
            M++LLE+I++SVE  LKL  + Q PYVDPNL+PVLLVPGIAGSIL AVD +NG EERVWVRI GA+++FRTK+WSRFDPSTGKT SLDP T+I VP  R GL AIDVLDPDMIVGR+ V YFH+MIVEM+ WGF+EGKTLFGFGYDFRQSNRLQET+D+ A+KLE VY+ASG KKINVISHSMGGLLVKCFMGLHSDIF+KYV+NW
Sbjct:    1 MSLLLEEIIRSVEALLKLRNRNQEPYVDPNLNPVLLVPGIAGSILNAVDHENGNEERVWVRIFGADHEFRTKMWSRFDPSTGKTISLDPKTSIVVPQDRAGLHAIDVLDPDMIVGRESVYYFHEMIVEMIGWGFEEGKTLFGFGYDFRQSNRLQETLDQFAKKLETVYKASGEKKINVISHSMGGLLVKCFMGLHSDIFEKYVQNW 206          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy Swiss-Prot
Match: LCAT3_ARATH (Phospholipase A(1) LCAT3 OS=Arabidopsis thaliana GN=LCAT3 PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 9.070e-51
Identity = 94/179 (52.51%), Postives = 119/179 (66.48%), Query Frame = -2
Query:    2 DPVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYKFRTKLWSRFDPSTGKTESLDPNTTIKVPGGRYGLGAIDVLDPDMIVGRDC----VCYFHDMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMDRLAEKLELVYEASGGKKINVISHSMGGLLVKCFMGLHSDIFQKYVKNW 526
            DPVLLV GI GSIL +    +  E RVWVRI  AN  F+  LWS ++P TG TE LD N  + VP   +GL AID+LDP   V + C    V +FHDMI  ++  G+++G TLFG+GYDFRQSNR+   +  L +KLE  Y+ SGG+K+ +ISHSMGGL+V CFM LH + F KYV  W
Sbjct:   24 DPVLLVSGIGGSILHSKKKNSKSEIRVWVRIFLANLAFKQSLWSLYNPKTGYTEPLDDNIEVLVPDDDHGLYAIDILDPSWFV-KLCHLTEVYHFHDMIEMLVGCGYKKGTTLFGYGYDFRQSNRIDLLILGLKKKLETAYKRSGGRKVTIISHSMGGLMVSCFMYLHPEAFSKYVNKW 201          
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy Swiss-Prot
Match: PDAT2_ARATH (Putative phospholipid:diacylglycerol acyltransferase 2 OS=Arabidopsis thaliana GN=PDAT2 PE=3 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 5.116e-7
Identity = 56/170 (32.94%), Postives = 74/170 (43.53%), Query Frame = -2
Query:   44 PVLLVPGIAGSILTAVDDQNGKEERVWVRILGANYK--FRTKLWSRFDPSTGKTESLDPN--TTIKVPGGRYGLGAIDVLDPDMIVGRDCVCYFH--DMIVEMLKWGFQEGKTLFGFGYDFRQSNRLQETMD----RLAEKLELVYEASGGKKINVISHSMGGLLVKCFM 523
            PV+LVPGI    L   + +   E     R+ GA++    R  L      S      LDP+      VPG    L A D   P         CYF    +I  + K G+ EGK L    YD+R S    E  D    RL  K+EL+Y  +G KK+ V+ HSMG +    F+
Sbjct:   92 PVILVPGIVTGGLELWEGRPCAEGLFRKRLWGASFSEILRRPLCWLEHLSLDSETGLDPSGIRVRAVPG----LVAADYFAP---------CYFAWAVLIENLAKIGY-EGKNLHMASYDWRLSFHNTEVRDQSLSRLKSKIELMYATNGFKKVVVVPHSMGAIYFLHFL 247          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0P3I3_GOSAR1.713e-14299.51Lecithine-cholesterol acyltransferase-like 4 OS=Go... [more]
A0A0D2UJS1_GOSRA4.804e-13594.15Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GCD7_THECC1.467e-12485.85Alpha/beta-Hydrolases superfamily protein isoform ... [more]
A0A061GKE0_THECC3.400e-12385.85Alpha/beta-Hydrolases superfamily protein isoform ... [more]
M5WN28_PRUPE1.420e-12183.90Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
D7T9J5_VITVI1.418e-11883.90Putative uncharacterized protein OS=Vitis vinifera... [more]
U5FRA7_POPTR6.299e-11782.04Uncharacterized protein OS=Populus trichocarpa GN=... [more]
A0A059C4X7_EUCGR1.653e-11682.93Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]
B9SDQ9_RICCO6.905e-11682.52Phosphatidylcholine-sterol O-acyltransferase, puta... [more]
U5FUA6_POPTR5.829e-11582.04Uncharacterized protein OS=Populus trichocarpa GN=... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0004832 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
LCAT4_ARATH5.358e-10977.67Lecithin-cholesterol acyltransferase-like 4 OS=Ara... [more]
LCAT3_ARATH9.070e-5152.51Phospholipase A(1) LCAT3 OS=Arabidopsis thaliana G... [more]
PDAT2_ARATH5.116e-732.94Putative phospholipid:diacylglycerol acyltransfera... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 149..169
NoneNo IPR availablePANTHERPTHR11440LECITHIN-CHOLESTEROL ACYLTRANSFERASE-RELATEDcoord: 1..205
NoneNo IPR availablePANTHERPTHR11440:SF3LECITHIN-CHOLESTEROL ACYLTRANSFERASE-LIKE 4coord: 1..205
IPR029058Alpha/Beta hydrolase foldGENE3D3.40.50.1820coord: 31..48
e-value: 2.0E-14
score: 53.5
coord: 118..200
e-value: 2.0E-14
score: 53.5
IPR029058Alpha/Beta hydrolase foldSUPERFAMILY53474alpha/beta-Hydrolasescoord: 120..200
coord: 27..44
IPR003386Lecithin:cholesterol/phospholipid:diacylglycerol acyltransferasePFAMPF02450LCATcoord: 76..193
e-value: 5.1E-17
score: 62.0

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0004832 ID=g.arboreum_cottongen_reftransV1_0004832|Name=g.arboreum_cottongen_reftransV1_0004832|organism=Gossypium arboreum|type=contig|length=797bp
TCCAATTCTTCACGTATTTCTGAAAAATATCGCTGTGAAGGCCCATGAAA
CATTTTACCAAAAGGCCGCCCATCGAGTGACTTATAACATTTATCTTCTT
CCCTCCTGAAGCTTCATATACCAACTCTAATTTCTCTGCCAGCCGATCCA
TTGTTTCTTGCAACCTATTACTTTGGCGAAAATCATAACCAAACCCAAAG
AGTGTTTTCCCTTCTTGGAAACCCCATTTGAGCATTTCAACAATCATATC
GTGAAAATAACAAACACAGTCACGTCCCACGATCATATCAGGGTCCAATA
CATCAATGGCGCCCAGGCCATATCTTCCTCCAGGGACTTTAATAGTTGTA
TTTGGATCCAAAGATTCAGTTTTACCAGTAGAAGGATCAAAACGAGACCA
GAGCTTGGTCCGGAACTTGTAATTGGCACCGAGAATCCGAACCCATACCC
GTTCTTCTTTACCATTCTGATCATCCACGGCAGTCAAAATCGAGCCGGCG
ATACCCGGAACTAATAAAACCGGGTCCAAATTCGGGTCGACGTAAGGTTG
GGGTTTCTTTATCAGCTTCAACCATATCTCCACCGATTGTAAAATATCTT
CCAACAACATCGCCATCCCAAATCAAAAACTAATTACAATTTCCCAAAAA
AAAATAAAATAAAAAAAGGAAAGAATATGTGATTAAATATTTAAGAAATG
TGAAATTACTATGGGGAAATTGAGATTTTTTTTTATTTTAGGGTTTGAGA
TTTCGGAGGGGAAAGAGTTTATCACGTAGAGTTAAAGAGGAGGAAAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR003386LACT/PDAT_acylTrfase
Vocabulary: Molecular Function
TermDefinition
GO:0008374O-acyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0006629lipid metabolic process