g.arboreum_cottongen_reftransV1_0007008, g.arboreum_cottongen_reftransV1_0007008 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0007008
Unique Nameg.arboreum_cottongen_reftransV1_0007008
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1857
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr5chromosomeg.arboreum_cottongen_reftransV1_0007008:1..1857 .
Chr5:7684622..7691509 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: A0A0B0NI48_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_06303 PE=3 SV=1)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 436/437 (99.77%), Postives = 436/437 (99.77%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST 1416
            AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSAL AMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGISKSSQTPSTPSTPVTPQPKPTATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST
Sbjct:   20 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALSAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGISKSSQTPSTPSTPVTPQPKPTATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST 456          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: A0A0D2RSQ8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G243100 PE=3 SV=1)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 428/437 (97.94%), Postives = 431/437 (98.63%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST 1416
            AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQF KDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSAL AMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYK DLSM YDVGISKSSQTP TP TPVTPQPKPTATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNT+ASHAAYAMNLYYQ+SAKNPWNCDFSQTATLTSQNP+YNNCIYPGGST
Sbjct:   20 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFHKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALSAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKSDLSMTYDVGISKSSQTPPTPKTPVTPQPKPTATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLYYQNSAKNPWNCDFSQTATLTSQNPTYNNCIYPGGST 456          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: A0A0D2RL22_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G243100 PE=3 SV=1)

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 429/480 (89.38%), Postives = 438/480 (91.25%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST*KSQTKCELKLEK-GKGWLNKSCGYLIFVALTVKLFSFDMDLL 1542
            AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQF KDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSAL AMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYK DLSM YDVGISKSSQTP TP TPVTPQPKPTATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNT+ASHAAYAMNLYYQ+SAKNPWNCDFSQTATLTSQNPS               T  +L L      W N+S   + F+   + L +F+M  L
Sbjct:   20 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFHKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALSAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKSDLSMTYDVGISKSSQTPPTPKTPVTPQPKPTATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLYYQNSAKNPWNCDFSQTATLTSQNPS-------------KYTSLKLYLSSITDNWFNRSVQSVFFL---IYLINFNMRKL 483          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: A0A061E125_THECC (O-Glycosyl hydrolases family 17 protein isoform 2 OS=Theobroma cacao GN=TCM_006900 PE=3 SV=1)

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 394/436 (90.37%), Postives = 413/436 (94.72%), Query Frame = 1
Query:  118 IGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXX---XXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST 1416
            IGVNYGQVADNLPPPSATAKLL+STSIEKVRLYGADPAIIKALANT IGIVIGA NGD+P+LASDPNSAAQW+NSNVLPFYPASKIILITVGNEVL TNDPNLINQLLPAMQN+QNA+N ASLGGK+KVSTVHSMAVL QSDPPSSGLFSPSYQPALKGLLQFQK+NGSPFAINPYPFFAYQSDSRPETLAF LFQPNAGRVDSGNGIKY NMFDAQVD+VHSAL AMGFKDVEIMVAETGWPY+GDSNEVGPSIENAKAYNGNLIAHL+SMVGTPLMPGKSVDTYLFALYDEDLK GP SERAFGL++PDLSM YD G+SKSSQTPSTP  PVTP     KPTA+GWCVPKAGISDAQLQ+SLDYAC QGIDC PIQPGGACFEPNT+ASHAAYAMNLYYQ+S KN WNCDFSQTAT+TSQNPSYNNCIYPGGST
Sbjct:   24 IGVNYGQVADNLPPPSATAKLLQSTSIEKVRLYGADPAIIKALANTGIGIVIGATNGDVPALASDPNSAAQWVNSNVLPFYPASKIILITVGNEVLMTNDPNLINQLLPAMQNVQNALNAASLGGKVKVSTVHSMAVLSQSDPPSSGLFSPSYQPALKGLLQFQKENGSPFAINPYPFFAYQSDSRPETLAFSLFQPNAGRVDSGNGIKYTNMFDAQVDAVHSALSAMGFKDVEIMVAETGWPYAGDSNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKSGPASERAFGLFRPDLSMTYDAGLSKSSQTPSTPQNPVTPVTPQPKPTASGWCVPKAGISDAQLQASLDYACSQGIDCGPIQPGGACFEPNTVASHAAYAMNLYYQTSGKNLWNCDFSQTATVTSQNPSYNNCIYPGGST 459          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: A0A0D2RZI6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G090600 PE=3 SV=1)

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 383/437 (87.64%), Postives = 398/437 (91.08%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST 1416
            AEPFIGVNYGQ ADNLPPP AT +LLKSTSIEKVRLYGADP IIKALANTEIGIVIGAANGDIP LASDPNSA QW+NSNVLPFYP SKIIL+TVGNEVLTTNDPNLI+QLLPAMQNMQNAI GA LGGKIKVSTVHSMAVLGQSDPPSSG FSPSY+PAL+GLL+F  DNGSPFA+NPYPFFAYQSD RPETLAFCLFQPN GRVD  +GIKYMNMFDAQVD+VHSAL  MGFKDVEIMVAETGWPY GD+NEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLK GPGS+RAFGLYKPDLSM YDVGI        +   P     KPTAT WCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPN +ASHAAYAMNLYYQ+SAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST
Sbjct:   20 AEPFIGVNYGQEADNLPPPLATVELLKSTSIEKVRLYGADPVIIKALANTEIGIVIGAANGDIPCLASDPNSAVQWVNSNVLPFYPDSKIILVTVGNEVLTTNDPNLIDQLLPAMQNMQNAITGALLGGKIKVSTVHSMAVLGQSDPPSSGCFSPSYEPALRGLLRFHSDNGSPFAVNPYPFFAYQSDPRPETLAFCLFQPNEGRVDRVSGIKYMNMFDAQVDAVHSALSDMGFKDVEIMVAETGWPYRGDNNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKVGPGSKRAFGLYKPDLSMTYDVGI--------SNCYPTPSTLKPTATIWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNIVASHAAYAMNLYYQNSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST 448          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: A0A067LCR3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_10086 PE=3 SV=1)

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 364/437 (83.30%), Postives = 404/437 (92.45%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST 1416
            +E FIG+NYG +ADNLPPP+ATAKLL+STSI+KVRLYGADPA +KALANT IGIVIGAANGDIP+LASDPNSA QW+N+NVLP+YPAS IILIT+GNEVL + D NLI+QLLPAMQNM NA+N  SLGGKIKVSTVHSMA L QSDPPSSG+F+PSYQ  +KGLLQFQ+DNGSP AINPYPFFAYQSD RPETLAFCLFQPNAGRVDSGNGI YMNMFDAQVD+V SAL A+GFKD+EI+VAETGWPYSGDSNEVGPSIENA+AYNGNLI HL+++VGTPLMPGKSVDTYLFALYDEDLKPGP SERAFGL+K DLSM YDVG++KSSQ PSTP+TP TP  KPTATGWC+PK+G+SDAQLQ+SLDYACGQGIDC PIQPGGACFEPN + SHAAYAMNLYYQ+S+KNPWNCDFSQTATLTS+NPSYN C+YPGGST
Sbjct:   23 SESFIGINYGLLADNLPPPTATAKLLQSTSIQKVRLYGADPAFLKALANTGIGIVIGAANGDIPALASDPNSATQWVNANVLPYYPASNIILITIGNEVLLSGDQNLISQLLPAMQNMHNALNSISLGGKIKVSTVHSMASLSQSDPPSSGMFNPSYQDTMKGLLQFQRDNGSPLAINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGNGIMYMNMFDAQVDAVRSALNAIGFKDIEILVAETGWPYSGDSNEVGPSIENARAYNGNLINHLRTLVGTPLMPGKSVDTYLFALYDEDLKPGPSSERAFGLFKTDLSMTYDVGLTKSSQVPSTPTTPATPSAKPTATGWCMPKSGVSDAQLQASLDYACGQGIDCGPIQPGGACFEPNNLVSHAAYAMNLYYQASSKNPWNCDFSQTATLTSKNPSYNGCVYPGGST 459          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: B9RBE5_RICCO (Glucan endo-1,3-beta-glucosidase, putative OS=Ricinus communis GN=RCOM_1674960 PE=3 SV=1)

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 358/437 (81.92%), Postives = 404/437 (92.45%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST 1416
            ++ FIG+NYG VADNLPPP+A+AKLL+ST+I+KVRLYGADPA++KALANT IG+VIGAANGDIP+LASDPNSA QWIN+NVLP+YPA+ IILITVGNEV+ + D NLI+QLLPAMQN+ NA+N ASLGGKIKVSTVHSMAVL QSDPPSSGLF+PSYQ  +KGLLQFQ+DNGSP  INPYPFFAYQSD RPETLAFCLFQPN+GR+DSGNGIKYMNMFDAQVD+V SAL  +GFKD+EI+VAETGWPY GDSNEVGPS+ENA+AYNGNLIAHL+S+VGTPLMPGKSVDTYLFALYDEDLKPGP SERAFGL+K DLSM YD G+SK+S TPS+P TP TP  KPT  GWC+PK+G+ DAQLQ+SLDYACGQGIDCSPIQPGGACFEPNT+ASHAAYAMNLYYQ+S+KNPWNCDFSQTATLTS+NPSYN C+YPGGST
Sbjct:   24 SQSFIGINYGLVADNLPPPTASAKLLQSTAIQKVRLYGADPAVLKALANTGIGVVIGAANGDIPALASDPNSATQWINANVLPYYPATNIILITVGNEVVLSGDQNLISQLLPAMQNIANALNAASLGGKIKVSTVHSMAVLSQSDPPSSGLFNPSYQDTMKGLLQFQRDNGSPLTINPYPFFAYQSDPRPETLAFCLFQPNSGRIDSGNGIKYMNMFDAQVDAVRSALNGIGFKDIEILVAETGWPYRGDSNEVGPSVENARAYNGNLIAHLRSLVGTPLMPGKSVDTYLFALYDEDLKPGPSSERAFGLFKTDLSMAYDAGLSKASVTPSSPKTPATPSTKPTGAGWCMPKSGVPDAQLQASLDYACGQGIDCSPIQPGGACFEPNTLASHAAYAMNLYYQTSSKNPWNCDFSQTATLTSKNPSYNGCVYPGGST 460          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: A9PG28_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0004s16120g PE=2 SV=1)

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 363/436 (83.26%), Postives = 401/436 (91.97%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGS 1413
            +E FIGVNYGQVADNLP PSATAKLL+ST+++KVRLYGADPAII+ALANT I IVIGAANG+IP+LASDPNSA QWINSNVLP+YPASKIILITVGNEVL +ND NLI+QLLPAMQNMQ A++ ASLGGK+KVSTVHSMA+L +SDPPSSGLF+P+YQ  ++ LLQFQKDNGSP A+NPYPFFAYQSD RPETLAFCLFQPN+GRVDSGNGIKYMNMFDAQVD+V SAL AMGF DVEI+VAETGWPY GDSNEVGP IENA+AYNGNL+AHL+SMVGTPLMPGKSVDTY+FALYDEDLK GP SER+FGL+KPDLSM YD+G+SKSS  PSTP TPVTP PKPT   WCVPKAG+SDAQLQ+SLDYACGQGIDC PIQPGGACFEPNT+ASHA+YAMNLYYQ SAKNPWNCDFS+TATLT +NPSYN C YPGGS
Sbjct:   20 SESFIGVNYGQVADNLPSPSATAKLLQSTAVQKVRLYGADPAIIRALANTGIEIVIGAANGEIPALASDPNSATQWINSNVLPYYPASKIILITVGNEVLLSNDQNLISQLLPAMQNMQKALSSASLGGKVKVSTVHSMAILSRSDPPSSGLFNPAYQDTMRRLLQFQKDNGSPLAVNPYPFFAYQSDPRPETLAFCLFQPNSGRVDSGNGIKYMNMFDAQVDAVRSALNAMGFIDVEIVVAETGWPYKGDSNEVGPGIENARAYNGNLVAHLRSMVGTPLMPGKSVDTYIFALYDEDLKSGPASERSFGLFKPDLSMTYDIGLSKSSLPPSTPKTPVTPSPKPTKADWCVPKAGVSDAQLQASLDYACGQGIDCGPIQPGGACFEPNTVASHASYAMNLYYQKSAKNPWNCDFSETATLTFKNPSYNGCTYPGGS 455          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: V4SHI5_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10028372mg PE=3 SV=1)

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 367/443 (82.84%), Postives = 401/443 (90.52%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXX------XXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST 1416
            ++ FIGVNYGQVADNLPPP+ATAKLL+STSI+K+RLYGADPAIIKALANT +GIVIGA++GDIP+LASDPN+A QWINSNVLPFYPASKIILITVGNEV+ +ND NLI+QLLPAM NMQNA+N ASLGGKIKVSTVH+M+VL QSDPPSSG F    Q  ++G+LQF KD+GSPF INPYPFFAYQSD RPETLAFCLFQPNAGRVDSG GIKYMNMFDAQVD+VHSAL AMGFKDVEI+VAETGWPY GD NEVGPS+ENAKAYNGNLIAHL+SM GTPLMPGKSVDTY+FALYDEDLKPGP SER+FGL+KPDLS  YDVGISKSSQTPS       P TP TP PKPTA GWCVPKAGISDAQLQ+SLDYAC QGIDCSPIQPGGACFEPNT+ SHAA+AMNLYYQ+SAKNPWNCDFS+TATLTSQNPSYN C+YP G T
Sbjct:   27 SQSFIGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMANMQNALNAASLGGKIKVSTVHAMSVLAQSDPPSSGSFI--RQDTMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGISKSSQTPSAPVTPSTPKTPTTPSPKPTAAGWCVPKAGISDAQLQASLDYACSQGIDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLTSQNPSYNGCVYPSGGT 467          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Match: A0A061DZ94_THECC (O-Glycosyl hydrolases family 17 protein isoform 1 OS=Theobroma cacao GN=TCM_006900 PE=3 SV=1)

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 378/463 (81.64%), Postives = 397/463 (85.75%), Query Frame = 1
Query:  118 IGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQ-------------------------------------------VDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXX---XXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLT 1368
            IGVNYGQVADNLPPPSATAKLL+STSIEKVRLYGADPAIIKALANT IGIVIGA NGD+P+LASDPNSAAQW+NSNVLPFYPASKIILITVGNEVL TNDPNLINQLLPAMQN+QNA+N ASLGGK+KVSTVHSMAVL QSDPPSSGLFSPSYQPALKGLLQFQK+NGSPFAINPYPFFAYQSDSRPETLAF LFQPNAGRVDSGNGIKY NMFDAQ                                           VD+VHSAL AMGFKDVEIMVAETGWPY+GDSNEVGPSIENAKAYNGNLIAHL+SMVGTPLMPGKSVDTYLFALYDEDLK GP SERAFGL++PDLSM YD G+SKSSQTPSTP  PVTP     KPTA+GWCVPKAGISDAQLQ+SLDYAC QGIDC PIQPGGACFEPNT+ASHAAYAMNLYYQ+S KN WNCDFSQTAT+T
Sbjct:   24 IGVNYGQVADNLPPPSATAKLLQSTSIEKVRLYGADPAIIKALANTGIGIVIGATNGDVPALASDPNSAAQWVNSNVLPFYPASKIILITVGNEVLMTNDPNLINQLLPAMQNVQNALNAASLGGKVKVSTVHSMAVLSQSDPPSSGLFSPSYQPALKGLLQFQKENGSPFAINPYPFFAYQSDSRPETLAFSLFQPNAGRVDSGNGIKYTNMFDAQAPVLSVMVLMTFFFHVVPKYIRAGHCNNSRFALPGFHLWLDVDVDAVHSALSAMGFKDVEIMVAETGWPYAGDSNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKSGPASERAFGLFRPDLSMTYDAGLSKSSQTPSTPQNPVTPVTPQPKPTASGWCVPKAGISDAQLQASLDYACSQGIDCGPIQPGGACFEPNTVASHAAYAMNLYYQTSGKNLWNCDFSQTATVT 486          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 331/433 (76.44%), Postives = 374/433 (86.37%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYP 1404
            AEPFIGVNYGQVADNLPPPS T KLL+STSI+KVRLYGADPAIIKALA T +GIVIGAANGD+PSLASDPN+A QWINSNVLPFYPASKI+LITVGNE+L +NDPNL+NQLLPAMQN+Q A+   SLGGKIKVSTV+SM VLG SDPPSSG F+  YQ  LKG+LQF  D GSPFAINPYPFFAYQSD RPETLAFCLF+PNAGRVDS  GIKY NMFDAQVD+VHSAL +MGF+ VEI+VAETGW   GD+NEVG S++NAKAYNGNLIAHL+SMVGTPLMPGK VDTY+FALYDE+LKPGP SERAFGL+K DLSMVYDVG+        + S+  TP  K T++GWCVPK G ++ +LQ+SLD+ACG GIDC  IQPGGACFEPN + SHAAYAMN+Y+Q S K P +CDFS+TAT+TSQNPSYNNC+YP
Sbjct:   22 AEPFIGVNYGQVADNLPPPSETVKLLQSTSIQKVRLYGADPAIIKALAGTGVGIVIGAANGDVPSLASDPNAATQWINSNVLPFYPASKIMLITVGNEILMSNDPNLVNQLLPAMQNVQKALEAVSLGGKIKVSTVNSMTVLGSSDPPSSGSFAAGYQTGLKGILQFLSDTGSPFAINPYPFFAYQSDPRPETLAFCLFEPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETGWASRGDANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSSERAFGLFKTDLSMVYDVGL------AKSSSSSQTPSGKVTSSGWCVPKKGATNEELQASLDWACGHGIDCGAIQPGGACFEPNNVVSHAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPSYNNCVYP 448          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: ALL9_OLEEU (Glucan endo-1,3-beta-D-glucosidase OS=Olea europaea GN=OLE9 PE=1 SV=1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 301/436 (69.04%), Postives = 360/436 (82.57%), Query Frame = 1
Query:  106 AEPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGS 1413
            ++ F+GVNYGQ++DNLP   AT  LLKST+I+KVRL+GA+PA+IKA ANT + IVIG  NGDIP+LAS+PN A+Q++ SNV+ FYPAS II ITVGNEVLT+ D  LI+QLLPAMQN+QNA+N ASLGGK+KVSTVH+MAVL QS PPSSG+F+P     +K LLQFQ  N +PF I+PYP+FAY++   P+TLAFCLFQPNAG+VDSGNG KY NMFDAQVD+VHSAL AMGFKD+EI+VAETGWP+ GDSNEVGPS++NAKAY GNLI HLKS VGTPLMPGKS+DTYLF+LYDED K G  SE+ FGL+KPD S  YDVG+ K++Q P+TP+TP        +  WCVPK G+SD QL  +++YACGQGIDC PIQPGGACFEPNT+ +HAAY MNLYYQS+ +N WNCDFSQTATLT+ NPSY  C +P GS
Sbjct:   26 SQSFLGVNYGQLSDNLPSLQATVNLLKSTTIQKVRLFGAEPAVIKAFANTGVEIVIGFDNGDIPTLASNPNVASQFVKSNVMSFYPASNIIAITVGNEVLTSGDQKLISQLLPAMQNVQNALNAASLGGKVKVSTVHAMAVLSQSYPPSSGVFNPGLGDTMKALLQFQSANDAPFMISPYPYFAYKNQPTPDTLAFCLFQPNAGQVDSGNGHKYTNMFDAQVDAVHSALNAMGFKDIEIVVAETGWPHGGDSNEVGPSLDNAKAYVGNLINHLKSKVGTPLMPGKSIDTYLFSLYDEDKKTGASSEKYFGLFKPDGSTTYDVGLLKNTQNPTTPATPTPTPKAAGS--WCVPKPGVSDDQLTGNINYACGQGIDCGPIQPGGACFEPNTVKAHAAYVMNLYYQSAGRNSWNCDFSQTATLTNTNPSYGACNFPSGS 459          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: E13B_WHEAT (Glucan endo-1,3-beta-glucosidase OS=Triticum aestivum GN=GLC1 PE=2 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 4.346e-114
Identity = 181/440 (41.14%), Postives = 269/440 (61.14%), Query Frame = 1
Query:  118 IGVNYGQVADNLPPPSATAKLLKS-TSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDP---NSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDP-PSSGLFSPSYQPAL-KGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATG------WCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIY 1401
            IGVNYG  ADNLP P++ A  L + T+I++V+L+ A+P  I A A T I + +   N  +P+LA      ++A  WI +N+ P+ PA+ + L+  GNE+L + D NLI  LLPAM+ +  A+    L G ++V+T H + +L  SD  PS+  F   Y   L   +LQF +D GSPF +NPYP+F+Y    RPETL + LF+PN+G  D    + Y +M DAQ+D++++A+  +G+ DV+I V E GWP   +  ++G  ++ A+ +N  +I    S  GTPLMP ++ +TYLF+L+DE+ KPGP +ER FGL+ PD + VYD+G+ +   + +   +P                 WCV K G +   LQ++++YACG  +DC PIQ GGACF PN++ +HA+Y MN YYQ++      CDF  T  +TS +PSY  C Y
Sbjct:   26 IGVNYGANADNLPSPTSVATFLATKTTIDRVKLFDANPTFISAFAGTPISLAVSLPNSALPALADKATGLDAARSWIRANLSPYVPATNVTLLLAGNEILLSTDTNLILSLLPAMRRLAQALKAEGLTG-VRVTTPHYLGILAPSDGIPSNASFRAGYNTKLFPAMLQFHRDTGSPFMVNPYPYFSY----RPETLNYALFRPNSGIYDPATKLNYTSMLDAQMDAIYTAMKKLGYGDVDIAVGEAGWPTQAEPGQIGVGVQEARDFNEGMIRVCSSGKGTPLMPNRTFETYLFSLFDENQKPGPIAERHFGLFNPDFTPVYDLGLLRDGASVAPTPSPNPSPNPSPKPAPSGGGKWCVAKDGANGTDLQNNINYACGF-VDCKPIQSGGACFSPNSLQAHASYVMNAYYQANGHTDLACDFKGTGIVTSSDPSYGGCKY 459          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: E1313_ARATH (Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis thaliana GN=At5g56590 PE=1 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 9.425e-104
Identity = 173/474 (36.50%), Postives = 282/474 (59.49%), Query Frame = 1
Query:  118 IGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDP--NLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNE-VGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQG-IDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIY--PGGST*KSQTKCELKLEKGKGWLNKSCGYLIFVALTVKLF 1521
            +GV YG+ AD+LP PS   +L++  +I+ VR+Y  +  ++KA  NT I ++IG  N D+ + +   ++   W+ ++VLP+YP +KI  ITVG E  +T+DP  N  + ++PAMQN+  A+    L  +IKVST  S+ +L +S PPS+G F+ SY   L+ +L+F  +N SPF I+ YP++AY+      +L + LF+ ++  +D   G+ Y NMFDAQVD+++ AL A+ F+ ++IMV ETGWP  G   E    S +NA+ YN N+I H+ +  GTP  PG++++ Y+F+L++E+ K G  SER +GL+ PD + VY +    + ++    S         ++  WC+  +  S+  L+ +LD+ACG G +DC+ IQP   CF+P+T+ SHA++  N Y+Q +      C F       +++PSY+ CIY   GG+  K+     L         N+   +++ + L + LF
Sbjct:   26 VGVCYGRSADDLPTPSKVVQLIQQHNIKYVRIYDYNSQVLKAFGNTSIELMIGVPNSDLNAFSQSQSNVDTWLKNSVLPYYPTTKITYITVGAE--STDDPHINASSFVVPAMQNVLTALRKVGLSRRIKVSTTLSLGILSRSFPPSAGAFNSSYAYFLRPMLEFLAENKSPFMIDLYPYYAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVTETGWPTKGSPKEKAAASSDNAETYNSNIIRHVVTNQGTPAKPGEAMNVYIFSLFNENRKAGLDSERNWGLFYPDQTSVYQLDF--TGKSNGFHSNSSGTNSSGSSNSWCIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNRATDVACSFGGAGVKVNKDPSYDKCIYITAGGNKTKATNATALTSSASTPRGNELLQWILKLCLMISLF 495          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.031e-101
Identity = 177/450 (39.33%), Postives = 272/450 (60.44%), Query Frame = 1
Query:  118 IGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXX---------------------XXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQG-IDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIY 1401
            IG+ YG+ ADNLP P+  ++L++  +I+ VR+Y A+  ++KA ANT I ++IG  N D+ + A   ++   W+++N+LP+YP++KI  I+VG EV    D N    +LPAM+N+  A+  + L  KIK+S+ HS+A+L +S PPSS  FS  +   LK +L+F  +N SPF I+ YP++AY+  +    L + LF+ ++  VD   G+ Y NMFDAQ+D+++ AL AM FK V++MV E+GWP  G   E   + ENA AYN NLI H+    GTP  PG+ +D YLF+L++E+ KPG  SER +G++  + + VY +  +  + TP +                      +  +          WC+  +  S  +LQ++LD+ACG G +DCS +QP   CFEP+T+ SHA+YA N YYQ S  +  +C F+  +    ++PSY NC+Y
Sbjct:   27 IGICYGRNADNLPSPNRVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNADLLAFAQFQSNVDTWLSNNILPYYPSTKITSISVGLEVTEAPD-NATGLVLPAMRNIHTALKKSGLDKKIKISSSHSLAILSRSFPPSSASFSKKHSAFLKPMLEFLVENESPFMIDLYPYYAYRDSTEKVPLEYALFESSSQVVDPATGLLYSNMFDAQLDAIYFALTAMSFKTVKVMVTESGWPSKGSPKETAATPENALAYNTNLIRHVIGDPGTPAKPGEEIDVYLFSLFNENRKPGIESERNWGMFYANGTNVYALDFTGENTTPVSPTNSTTGTSPSPSSSPIINGNSTVTIGGGGGGGTKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLY 475          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: E1311_ARATH (Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis thaliana GN=At1g32860 PE=1 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 4.626e-98
Identity = 158/321 (49.22%), Postives = 207/321 (64.49%), Query Frame = 1
Query:  118 IGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKS--MVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVG 1074
            IGVNYGQ+ DNLP P+    L+KS    KV+LY A+P I+KA +NT I  +IG  N +  S   DP+ A  WI  NV PF PA+ I  IT+GNE+L  ND +L   LLPAMQ + +A+  A L  +I V+T HS+++L  S PPS+G F P    +L  +L+F +   SPF IN YPFFAY+ + +   L F LFQPN G VD   G  Y NM  AQ+D+V+SAL A GFK + + ++ETGWP  GD +EVG + ENAK YNGNLI  + S     TPL P   +  Y+FAL++E+LKPGP SER +GL+KPD +  Y +G
Sbjct:   29 IGVNYGQIGDNLPSPTDVIPLIKSIGATKVKLYDANPQILKAFSNTGIEFIIGLGN-EYLSKMKDPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTTNLLPAMQGVHSALITAGLSDQISVTTAHSLSILKSSFPPSAGEFQPDLLDSLTPILEFHRKTDSPFLINAYPFFAYKGNPKEVPLDFVLFQPNQGIVDPATGFHYDNMLFAQIDAVYSALAAAGFKSLRVEISETGWPSKGDDDEVGATPENAKRYNGNLIKMMMSGKKTKTPLKPNNDLSIYVFALFNENLKPGPTSERNYGLFKPDGTQAYSLG 348          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: E133_ARATH (Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis thaliana GN=At2g01630 PE=1 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 4.686e-97
Identity = 164/439 (37.36%), Postives = 258/439 (58.77%), Query Frame = 1
Query:  109 EPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQP---NAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQG-IDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGS 1413
            +  IGVN G    N+P P+    LLKS +I +VRLY AD +++ A A+T + ++I   N  +  ++    +AA W+  NV  +YPA+ I  I VG+EVLT+   N  + L+ A++ +Q A+  A+L  +IKVST HS  ++  S PPS   F+ ++ P +  LL+F +  GSP  +N YP+F Y   +    L + LFQP   N   VD+   + Y N+FDA VD+ + A+  + F ++ I+V E+GWP  G  +E   ++ENA  YN NLI H+ +  GTP  PG +V TY++ LY+ED +PGP SE+ +GL+  + + VY + ++ +    +  +T  T         +C+ K  +    LQ++LD+ACG G +DCS +  G +C+EP+ + +H+ YA N YYQ   K   +CDF   AT+T+ +PS   C++PG +
Sbjct:   20 DSLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQLLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTS-LTNAASVLVSALKYIQAALVTANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYFDYVQSNGVIPLDYALFQPLQANKEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYTNGTPVYTLRLAGAGAILANDTTNQT---------FCIAKEKVDRKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSA 448          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: E131_ARATH (Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis thaliana GN=At1g11820 PE=1 SV=3)

HSP 1 Score: 309.686 bits (792), Expect = 1.343e-95
Identity = 163/446 (36.55%), Postives = 261/446 (58.52%), Query Frame = 1
Query:  109 EPFIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQP---NAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQGI-DCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPGGST*KSQTK 1434
            +PF+G N G    NL  P+   K L++  +  VRLY ADP ++KALA T++ ++I   N  + ++ S  ++AA WI  NV+ +YP + I  I+VG+EVLTT  P+    LLPA++++ NA+  ++L  +IKVST H+ +++  + PPS   F+ ++   +  LLQF    GSP  +N YP++ Y  +     L  CLF+P   +   VD    + Y N+ DA VD+ + ++  +   DV ++V E+GWP  GDS E   +I+NA  YN NLI H+    GTPL P  +   Y++ L++EDL+  P SE ++GL+  + + VY + +S S    +  +T  T         +C+   G+    LQ++LD+ACG G  +CS IQPG +C++PN +  HA++A N YYQ   +   +CDF   A +T+ +PS+ +CI+PG     ++T+
Sbjct:   41 DPFVGFNIGTDVSNLLSPTELVKFLQAQKVNHVRLYDADPELLKALAKTKVRVIISVPNNQLLAIGSSNSTAASWIGRNVVAYYPETLITAISVGDEVLTT-VPSSAPLLLPAIESLYNALVASNLHTQIKVSTPHAASIMLDTFPPSQAYFNQTWHSIMVPLLQFLSKTGSPLMMNLYPYYVYMQNKGVVPLDNCLFEPLTPSKEMVDPNTLLHYTNVLDAMVDAAYVSMKNLNVSDVAVLVTESGWPSKGDSKEPYATIDNADTYNSNLIKHVFDRTGTPLHPEMTSSVYIYELFNEDLRAPPVSEASWGLFYGNSTPVYLLHVSGSGTFLANDTTNQT---------YCIAMDGVDAKTLQAALDWACGPGRSNCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTDPSHGSCIFPGSKKVGNRTQ 476          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: E134_ARATH (Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis thaliana GN=At3g13560 PE=1 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.632e-92
Identity = 169/435 (38.85%), Postives = 252/435 (57.93%), Query Frame = 1
Query:  115 FIGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQ---PNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGIXXXXXXXXXXXXXXXXXXXXXATGWCVPKAGISDAQLQSSLDYACGQG-IDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKNPWNCDFSQTATLTSQNPSYNNCIYPG 1407
            FIGVN G    N+PPPS    LLKS  I  VRLY A+  ++KA ANT I +++G  N +I  +   P++AA W+N NV  + P++ I  I VG+EVLTT  P++   L  A+ N+  A+  ++L  K+KVS+  SM ++ +  PPS+  FSPS+   +  LLQF K+ GS F +N YP++ Y + +    L + LF+   P    VD    + Y +MFDA VD+ + ++ A+ F  + ++V ETGWP SG S+E   ++ NA+ +N NLI  + +  G P  P   ++TY++ LY+ED + GP SER +G+  P+ + VY          P + S   +      ++ +CV KA   D +L   L++ACGQG  +C+ IQPG  C+ PN + SHA++A N YYQ        CDF  TA  T+++PSY  C Y G
Sbjct:   25 FIGVNIGTDLTNMPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNEEILKIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTT-IPHVAPILASALNNIHKALVASNLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYYGYTTANGIFPLDYALFKQLSPVKQIVDPNTLLHYNSMFDAMVDAAYYSMEALNFSKIPVVVTETGWPSSGGSDEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGILFPNGTSVY----------PLSLSGGSSSAALNGSSMFCVAKADADDDKLVDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRDPSYRTCAYTG 448          
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Match: E1314_ARATH (Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis thaliana GN=At2g27500 PE=1 SV=2)

HSP 1 Score: 292.352 bits (747), Expect = 1.403e-90
Identity = 139/320 (43.44%), Postives = 204/320 (63.75%), Query Frame = 1
Query:  118 IGVNYGQVADNLPPPSATAKLLKSTSIEKVRLYGADPAIIKALANTEIGIVIGAANGDIPSLASDPNSAAQWINSNVLPFYPASKIILITVGNEVLTTNDPNLINQLLPAMQNMQNAINGASLGGKIKVSTVHSMAVLGQSDPPSSGLFSPSYQPALKGLLQFQKDNGSPFAINPYPFFAYQSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALGAMGFKDVEIMVAETGWPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGSERAFGLYKPDLSMVYDVGI 1077
            +G+NYGQ+A+NLP P+  A LL+S +I +V+LY ADP ++ + +N+++  +IG  N  + ++++DP  A  W+   + P    ++I  I VGNE+  TND  LI  LLPAM+++  A+    L  ++ V++ HS+ +L  S PPSSG F   +   L+ LL F     SPF IN YPFFAY+   +   L + LFQPN G VD    + Y NM  AQVD+++SA+  +G  D+E+ ++ETGWP  GD NE+G S ENA  YNGNL+  ++   GTP      +D Y+FAL++E+LKPGP SER +GL+ PD   VY+VG+
Sbjct:   29 VGINYGQIANNLPSPARVAVLLRSLNITRVKLYDADPNVLFSFSNSQVDFMIGLGNEYLQNMSTDPTKAQDWLQQRLEPHISKTRITSIVVGNEIFKTNDHVLIQSLLPAMKSVYAALTNLGLEKQVTVTSAHSLDILSTSYPPSSGSFKEEFIQYLQPLLDFHSQIESPFLINAYPFFAYKDSPKEVPLEYVLFQPNQGMVDPNTNLHYDNMLFAQVDALYSAIKTLGHTDIEVRISETGWPSKGDENEIGASPENAALYNGNLLKLIQQRKGTPAKQSVPIDVYVFALFNENLKPGPVSERNYGLFYPDGKPVYNVGM 348          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NI48_GOSAR0.000e+099.77Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2RSQ8_GOSRA0.000e+097.94Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RL22_GOSRA0.000e+089.38Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061E125_THECC0.000e+090.37O-Glycosyl hydrolases family 17 protein isoform 2 ... [more]
A0A0D2RZI6_GOSRA0.000e+087.64Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A067LCR3_JATCU0.000e+083.30Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
B9RBE5_RICCO0.000e+081.92Glucan endo-1,3-beta-glucosidase, putative OS=Rici... [more]
A9PG28_POPTR0.000e+083.26Uncharacterized protein OS=Populus trichocarpa GN=... [more]
V4SHI5_9ROSI0.000e+082.84Uncharacterized protein OS=Citrus clementina GN=CI... [more]
A0A061DZ94_THECC0.000e+081.64O-Glycosyl hydrolases family 17 protein isoform 1 ... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0007008 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
E137_ARATH0.000e+076.44Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis ... [more]
ALL9_OLEEU0.000e+069.04Glucan endo-1,3-beta-D-glucosidase OS=Olea europae... [more]
E13B_WHEAT4.346e-11441.14Glucan endo-1,3-beta-glucosidase OS=Triticum aesti... [more]
E1313_ARATH9.425e-10436.50Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis... [more]
E1312_ARATH1.031e-10139.33Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis... [more]
E1311_ARATH4.626e-9849.22Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis... [more]
E133_ARATH4.686e-9737.36Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis ... [more]
E131_ARATH1.343e-9536.55Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis ... [more]
E134_ARATH1.632e-9238.85Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis ... [more]
E1314_ARATH1.403e-9043.44Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012946X8 domainSMARTSM00768X8_clscoord: 367..451
e-value: 1.0E-45
score: 167.9
IPR012946X8 domainPFAMPF07983X8coord: 368..438
e-value: 1.8E-21
score: 76.5
IPR013781Glycoside hydrolase, catalytic domainGENE3D3.20.20.80coord: 24..342
e-value: 2.3E-118
score: 394.3
IPR000490Glycoside hydrolase family 17PFAMPF00332Glyco_hydro_17coord: 24..341
e-value: 1.6E-85
score: 287.1
NoneNo IPR availablePANTHERPTHR32227:SF16GLUCAN ENDO-1,3-BETA-GLUCOSIDASE 7-RELATEDcoord: 18..439
NoneNo IPR availablePANTHERPTHR32227FAMILY NOT NAMEDcoord: 18..439
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 21..456
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 4..15
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..20
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..3
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 16..20
NoneNo IPR availableSIGNALP_GRAM_NEGATIVESignalP-noTMSignalP-noTMcoord: 1..20
score: 0.698
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.947
IPR017853Glycoside hydrolase superfamilySUPERFAMILY51445(Trans)glycosidasescoord: 24..342

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0007008 ID=g.arboreum_cottongen_reftransV1_0007008|Name=g.arboreum_cottongen_reftransV1_0007008|organism=Gossypium arboreum|type=contig|length=1857bp
AGCAAACACACACTCTCATTCTCTCTCTGTATTTCCTTTGTCTCTTTAAT
GGCTACTTTCTTCTTCTTCCTCCTCTCCTTCCTTATCTGCTTTCACTTGT
CAAGTGCTGAGCCGTTTATTGGAGTGAACTACGGCCAAGTGGCGGACAAC
TTACCGCCGCCGTCAGCCACCGCGAAGCTTCTAAAATCGACGTCGATTGA
GAAAGTTAGATTGTACGGAGCGGATCCGGCGATTATCAAAGCTTTGGCTA
ATACCGAAATTGGGATCGTAATCGGAGCAGCTAATGGAGATATTCCTTCT
TTGGCTTCCGATCCAAACTCAGCAGCTCAGTGGATTAACTCCAACGTGTT
GCCTTTTTACCCTGCTAGCAAAATCATCCTCATCACTGTTGGCAACGAGG
TATTGACTACAAATGACCCGAATTTAATAAACCAACTGCTACCCGCAATG
CAAAATATGCAAAACGCCATTAACGGTGCTTCACTGGGTGGAAAGATCAA
GGTCTCAACGGTTCATTCAATGGCGGTGTTGGGCCAATCCGACCCGCCAT
CTTCCGGGTTGTTTAGCCCGAGTTATCAACCCGCATTGAAAGGTTTGCTT
CAGTTCCAGAAGGACAACGGGTCCCCTTTTGCCATTAATCCGTACCCGTT
TTTCGCTTATCAAAGTGACTCCAGACCCGAAACGCTTGCCTTCTGCTTGT
TTCAACCCAACGCGGGACGAGTTGACTCGGGGAACGGAATCAAGTACATG
AACATGTTTGATGCCCAGGTTGATTCAGTGCATTCTGCTTTGGGTGCTAT
GGGGTTCAAGGATGTCGAGATTATGGTTGCCGAAACGGGATGGCCATATA
GCGGCGACAGTAATGAGGTCGGACCTAGCATTGAGAATGCAAAAGCCTAT
AACGGGAACTTGATTGCTCATTTGAAATCGATGGTCGGGACACCGTTGAT
GCCCGGGAAATCTGTGGATACTTACCTCTTTGCACTCTATGATGAGGACT
TGAAACCCGGTCCCGGTTCTGAACGGGCATTTGGACTTTACAAGCCGGAC
CTTTCCATGGTATATGATGTTGGCATTTCAAAGAGTAGTCAGACTCCATC
GACTCCATCGACTCCGGTAACTCCTCAACCGAAACCGACTGCAACTGGTT
GGTGTGTACCGAAGGCCGGTATTTCCGATGCTCAATTGCAATCGAGTCTA
GACTATGCATGTGGCCAAGGCATCGATTGCAGTCCGATCCAACCGGGAGG
TGCCTGTTTCGAACCGAACACCATAGCGTCTCACGCTGCTTATGCCATGA
ACCTTTACTACCAGAGTTCCGCCAAGAATCCGTGGAACTGTGATTTCTCG
CAGACGGCAACACTAACATCCCAAAATCCTAGTTATAATAATTGCATCTA
CCCTGGTGGGAGCACTTAGAAAAGCCAGACAAAATGTGAATTGAAATTGG
AAAAAGGAAAAGGATGGTTAAATAAAAGCTGTGGGTACCTTATATTTGTA
GCTTTAACTGTAAAGTTATTCTCCTTTGATATGGATTTGCTGTGGTCTGT
GTTCTTTTTTGGGGGTAAATTATTTGATCTAATAAAGTTAGGGTTGGAAC
AGTGATGAACTTTTAGTGGTTAAAAAAAATGGGGTCATGCTTATAATCTC
TTAGACATAATATCAAAACCAGTATGATGTAGGTATAAAAGTTTAGATTC
GATCCGAAACATTTAATTTTTCTTCTCCAATTATTAAAAAAAAAAAAATC
ATATTTTGCTTCTTGCATGTTCTATGTACCATGTCTTCTCTAAATGTATT
GTTTTATATATAGTCAATGAATTTTGGCCTTTTCTTATGCCTAAGATGTT
GGTTTCA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR012946X8
IPR013781Glyco_hydro_catalytic_dom
IPR000490Glyco_hydro_17
IPR017853Glycoside_hydrolase_SF
Vocabulary: Biological Process
TermDefinition
GO:0005975carbohydrate metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds