g.arboreum_cottongen_reftransV1_0014722, g.arboreum_cottongen_reftransV1_0014722 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0014722
Unique Nameg.arboreum_cottongen_reftransV1_0014722
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length568
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeg.arboreum_cottongen_reftransV1_0014722:1..568 .
Chr1:135034309..135035168 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: A0A0B0MGD5_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_22992 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 6.884e-71
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 325
            RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR
Sbjct:  151 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 258          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: A0A0B0MLG1_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_22992 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 8.046e-71
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 325
            RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR
Sbjct:  159 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 266          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: A0A0D2REM0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G007500 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 6.302e-69
Identity = 106/108 (98.15%), Postives = 106/108 (98.15%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 325
            RSRQEVLSTMTPRPTDHWPF SKGEGKGIMLKSPHTPKAPR GPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR
Sbjct:  159 RSRQEVLSTMTPRPTDHWPFMSKGEGKGIMLKSPHTPKAPRQGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 266          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: A0A061DGH5_THECC (F-box family protein OS=Theobroma cacao GN=TCM_000159 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 6.200e-64
Identity = 96/108 (88.89%), Postives = 104/108 (96.30%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 325
            RSRQE+LSTMTPRPT+HWPF SKG+GK I+++SPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDS FPSRCM+PS +PKPLCKSLASNRVLFYEDELCQAVAQNKLR
Sbjct:  160 RSRQEMLSTMTPRPTEHWPFMSKGDGKSILMRSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSGFPSRCMIPSVIPKPLCKSLASNRVLFYEDELCQAVAQNKLR 267          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: A0A067FV90_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g024421mg PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 4.710e-61
Identity = 92/108 (85.19%), Postives = 102/108 (94.44%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 325
            RSRQE+L  MTPRPT+ WPF SKGEG+G+++ SPHTPKAP+HGPRPPSR+K+TE+RQIAAVLFQDSAFPSRCMVPS LPKPLCKSLASNRVLFYEDELCQAVAQNKLR
Sbjct:  161 RSRQEMLQIMTPRPTERWPFVSKGEGRGVLMPSPHTPKAPKHGPRPPSRMKITEMRQIAAVLFQDSAFPSRCMVPSVLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 268          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: D7TGH3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_00s2668g00010 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 6.726e-61
Identity = 93/107 (86.92%), Postives = 100/107 (93.46%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKL 322
            RSRQE+L TMTP PT+HWPF SKG+GKG+ L SPHTPKAPRHGPRPPSR+KVTE+RQIAAVLFQ+SA PSRCMVPS LPKPLCKSLASNRVLFYEDELCQAVAQNKL
Sbjct:   67 RSRQEMLRTMTPLPTEHWPFVSKGDGKGVFLASPHTPKAPRHGPRPPSRLKVTEMRQIAAVLFQESALPSRCMVPSILPKPLCKSLASNRVLFYEDELCQAVAQNKL 173          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: V4SDN2_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10026280mg PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.341e-60
Identity = 91/108 (84.26%), Postives = 102/108 (94.44%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 325
            RSRQE+L +MTPRPT+ WPF SKGEG+G+++ SPHTPKAP+HGPRPPSR+K+TE+RQIAAVLFQDS FPSRCMVPS LPKPLCKSLASNRVLFYEDELCQAVAQNKLR
Sbjct:  161 RSRQEMLQSMTPRPTERWPFVSKGEGRGVLMPSPHTPKAPKHGPRPPSRMKITEMRQIAAVLFQDSTFPSRCMVPSVLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 268          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: A0A0D2PBW8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G192100 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 2.093e-60
Identity = 94/108 (87.04%), Postives = 100/108 (92.59%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 325
            RSRQE+LSTMTPR T+HWPF SKG+GK  ++ SPHTPKAPR GPRPPSR+KVTELRQIAAVLFQDS FPSRCMVPS LPKPLCKSLASNRVLFYEDELCQAVAQNKLR
Sbjct:  160 RSRQEMLSTMTPRVTEHWPFLSKGDGKSNLMGSPHTPKAPRQGPRPPSRIKVTELRQIAAVLFQDSGFPSRCMVPSVLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 267          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: M5WA31_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa010075mg PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 2.452e-60
Identity = 90/107 (84.11%), Postives = 102/107 (95.33%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKL 322
            RSRQE+L+TMTP PT+HWPF SKG+GKGI ++SPHTPKAPRHGPRPPSR+KV+E+RQ+AAVLFQ+S FP+RCMVPS LPKPLCKSLASNRVLFYEDELCQAVAQNKL
Sbjct:  158 RSRQEMLNTMTPHPTEHWPFLSKGDGKGIFIRSPHTPKAPRHGPRPPSRLKVSEMRQVAAVLFQESNFPTRCMVPSVLPKPLCKSLASNRVLFYEDELCQAVAQNKL 264          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Match: A0A067JJ36_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_25374 PE=4 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 4.219e-60
Identity = 94/108 (87.04%), Postives = 99/108 (91.67%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSAFPSRCMVPSTLPKPLCKSLASNRVLFYEDELCQAVAQNKLR 325
            RSRQE+L TMTPRPT+HWPF SKGEGK   L SPHTPKAPRHGPRPPSR+KVTE++QIAAVLFQDSAFP RCMVPS L KPLCKSLASNRVLFYEDELCQAVAQNKLR
Sbjct:  160 RSRQEMLRTMTPRPTEHWPFVSKGEGKAAFLPSPHTPKAPRHGPRPPSRIKVTEMKQIAAVLFQDSAFPPRCMVPSALSKPLCKSLASNRVLFYEDELCQAVAQNKLR 267          
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy Swiss-Prot
Match: FB248_ARATH (F-box protein At4g35930 OS=Arabidopsis thaliana GN=At4g35930 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.905e-37
Identity = 71/111 (63.96%), Postives = 83/111 (74.77%), Query Frame = 2
Query:    2 RSRQEVLSTMTPRPTDHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLFQDSA-FPSRCMVPSTLPKP-LCKSLASN--RVLFYEDELCQAVAQNKL 322
            RSRQE+L  MTP P + WPF  +G+G   M+ SPHTPKAP+H PRPPSR K+ E++QI AVLFQD   FPSRC+VPS L +P L K +A    RVLFYEDELCQAVAQN L
Sbjct:  211 RSRQEMLRVMTPVPINRWPF-RRGDGNPTMVSSPHTPKAPKHAPRPPSRTKLAEMKQITAVLFQDQTPFPSRCIVPSVLQRPTLFKPMAPKHPRVLFYEDELCQAVAQNNL 320          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0MGD5_GOSAR6.884e-71100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0B0MLG1_GOSAR8.046e-71100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2REM0_GOSRA6.302e-6998.15Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061DGH5_THECC6.200e-6488.89F-box family protein OS=Theobroma cacao GN=TCM_000... [more]
A0A067FV90_CITSI4.710e-6185.19Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
D7TGH3_VITVI6.726e-6186.92Putative uncharacterized protein OS=Vitis vinifera... [more]
V4SDN2_9ROSI1.341e-6084.26Uncharacterized protein OS=Citrus clementina GN=CI... [more]
A0A0D2PBW8_GOSRA2.093e-6087.04Uncharacterized protein OS=Gossypium raimondii GN=... [more]
M5WA31_PRUPE2.452e-6084.11Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
A0A067JJ36_JATCU4.219e-6087.04Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0014722 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
FB248_ARATH2.905e-3763.96F-box protein At4g35930 OS=Arabidopsis thaliana GN... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR34049:SF2SUBFAMILY NOT NAMEDcoord: 1..99
NoneNo IPR availablePANTHERPTHR34049FAMILY NOT NAMEDcoord: 1..99

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0014722 ID=g.arboreum_cottongen_reftransV1_0014722|Name=g.arboreum_cottongen_reftransV1_0014722|organism=Gossypium arboreum|type=contig|length=568bp
TCGTTCAAGGCAAGAGGTGCTTAGCACAATGACACCAAGGCCTACCGATC
ACTGGCCCTTTACGAGCAAGGGAGAAGGCAAAGGTATTATGTTAAAAAGC
CCACACACTCCAAAAGCTCCACGACACGGTCCACGGCCACCTTCTCGTGT
TAAAGTGACCGAGTTGAGGCAAATCGCTGCAGTGCTCTTTCAAGATTCTG
CATTCCCTTCGAGATGCATGGTACCCTCTACTCTCCCTAAACCATTATGC
AAATCTTTGGCTTCGAATCGAGTTTTATTTTACGAAGATGAGTTATGCCA
AGCTGTTGCTCAAAATAAGCTTCGTTGATATATTCCCCAGTGTTAGAAAA
TATCATAAAGCTGGATTCCACTTGTATATAGTTATATTTTTTTGCCCATT
TCTATACAGGAGATTATAGTTAATAGAGTCAGAAGTATCAGATATGAGGT
TTTGTAGGCTTTGCTTGGGGAGTATTAGGTTATATATATGAAACTTTATA
TGAATCTTATATGCATTAAGGGTTTGAAGATTTTAGAGGATAAATGTGGT
TTTTTTTCACAATAATAG
back to top