g.arboreum_cottongen_reftransV1_0007404, g.arboreum_cottongen_reftransV1_0007404 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0007404
Unique Nameg.arboreum_cottongen_reftransV1_0007404
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length322
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeg.arboreum_cottongen_reftransV1_0007404:1..321 .
Chr1:2333631..2334384 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A0B0NN42_GOSAR (Polyphosphoinositide phosphatase OS=Gossypium arboreum GN=F383_08537 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.311e-62
Identity = 97/105 (92.38%), Postives = 100/105 (95.24%), Query Frame = 2
Query:    8 LRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            LRFLHWDLHKH RS++TNVLLLLGKVA YALTLTGFFYCRVTS LRP+EC  WPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG
Sbjct:  347 LRFLHWDLHKHFRSQATNVLLLLGKVAAYALTLTGFFYCRVTSTLRPDECTAWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 451          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A0D2SID1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G222100 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.900e-58
Identity = 92/105 (87.62%), Postives = 97/105 (92.38%), Query Frame = 2
Query:    8 LRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            LRFLHWDLHKH RS++TNVLLLLGKVA YALTLTG FYCRVTS +RP+EC  WPSS+NIDDGDMSPPKYCDNVNEGA RLEGNH GDNNTANGNHSVKPPTFQRG
Sbjct:  388 LRFLHWDLHKHFRSQATNVLLLLGKVAAYALTLTGSFYCRVTSTMRPDECTAWPSSKNIDDGDMSPPKYCDNVNEGAYRLEGNHSGDNNTANGNHSVKPPTFQRG 492          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A0D2VH81_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G222100 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.441e-58
Identity = 92/105 (87.62%), Postives = 97/105 (92.38%), Query Frame = 2
Query:    8 LRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            LRFLHWDLHKH RS++TNVLLLLGKVA YALTLTG FYCRVTS +RP+EC  WPSS+NIDDGDMSPPKYCDNVNEGA RLEGNH GDNNTANGNHSVKPPTFQRG
Sbjct:  388 LRFLHWDLHKHFRSQATNVLLLLGKVAAYALTLTGSFYCRVTSTMRPDECTAWPSSKNIDDGDMSPPKYCDNVNEGAYRLEGNHSGDNNTANGNHSVKPPTFQRG 492          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A061GSU6_THECC (Phosphoinositide phosphatase family protein isoform 4 OS=Theobroma cacao GN=TCM_037461 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 4.339e-55
Identity = 88/107 (82.24%), Postives = 94/107 (87.85%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            N+LRFLHWDLHKHSR K+TNVLL LGK+A Y LTLTGFFYCRVTSALRPEECM WP SENI DGDMSP KYC+NVNE A+RLEGN+ GDNN ANGNHSVKPPT Q G
Sbjct:  386 NQLRFLHWDLHKHSRGKATNVLLFLGKMAAYVLTLTGFFYCRVTSALRPEECMAWPYSENIGDGDMSPTKYCNNVNEDANRLEGNYSGDNNVANGNHSVKPPTIQSG 492          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A061GK02_THECC (Phosphoinositide phosphatase family protein isoform 5 (Fragment) OS=Theobroma cacao GN=TCM_037461 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 4.362e-55
Identity = 88/107 (82.24%), Postives = 94/107 (87.85%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            N+LRFLHWDLHKHSR K+TNVLL LGK+A Y LTLTGFFYCRVTSALRPEECM WP SENI DGDMSP KYC+NVNE A+RLEGN+ GDNN ANGNHSVKPPT Q G
Sbjct:  386 NQLRFLHWDLHKHSRGKATNVLLFLGKMAAYVLTLTGFFYCRVTSALRPEECMAWPYSENIGDGDMSPTKYCNNVNEDANRLEGNYSGDNNVANGNHSVKPPTIQSG 492          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A061GKX8_THECC (Phosphoinositide phosphatase family protein isoform 1 OS=Theobroma cacao GN=TCM_037461 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 5.369e-55
Identity = 88/107 (82.24%), Postives = 94/107 (87.85%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            N+LRFLHWDLHKHSR K+TNVLL LGK+A Y LTLTGFFYCRVTSALRPEECM WP SENI DGDMSP KYC+NVNE A+RLEGN+ GDNN ANGNHSVKPPT Q G
Sbjct:  386 NQLRFLHWDLHKHSRGKATNVLLFLGKMAAYVLTLTGFFYCRVTSALRPEECMAWPYSENIGDGDMSPTKYCNNVNEDANRLEGNYSGDNNVANGNHSVKPPTIQSG 492          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A061GM31_THECC (Phosphoinositide phosphatase family protein isoform 2 OS=Theobroma cacao GN=TCM_037461 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 6.073e-55
Identity = 88/107 (82.24%), Postives = 94/107 (87.85%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            N+LRFLHWDLHKHSR K+TNVLL LGK+A Y LTLTGFFYCRVTSALRPEECM WP SENI DGDMSP KYC+NVNE A+RLEGN+ GDNN ANGNHSVKPPT Q G
Sbjct:  386 NQLRFLHWDLHKHSRGKATNVLLFLGKMAAYVLTLTGFFYCRVTSALRPEECMAWPYSENIGDGDMSPTKYCNNVNEDANRLEGNYSGDNNVANGNHSVKPPTIQSG 492          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A061GLB4_THECC (Phosphoinositide phosphatase family protein isoform 3 OS=Theobroma cacao GN=TCM_037461 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 7.785e-55
Identity = 88/107 (82.24%), Postives = 94/107 (87.85%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            N+LRFLHWDLHKHSR K+TNVLL LGK+A Y LTLTGFFYCRVTSALRPEECM WP SENI DGDMSP KYC+NVNE A+RLEGN+ GDNN ANGNHSVKPPT Q G
Sbjct:  386 NQLRFLHWDLHKHSRGKATNVLLFLGKMAAYVLTLTGFFYCRVTSALRPEECMAWPYSENIGDGDMSPTKYCNNVNEDANRLEGNYSGDNNVANGNHSVKPPTIQSG 492          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A0D2QJB9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G017800 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.045e-53
Identity = 91/107 (85.05%), Postives = 95/107 (88.79%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDM P KY ++  E   R E N+ G+NN ANGNHSVKPPTFQRG
Sbjct:  387 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMLPLKYSNDT-EDIYRSERNYSGENNVANGNHSVKPPTFQRG 492          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Match: A0A0B0MB15_GOSAR (Polyphosphoinositide phosphatase OS=Gossypium arboreum GN=F383_02863 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 3.526e-52
Identity = 90/107 (84.11%), Postives = 92/107 (85.98%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDM P K C N  E   R   N+ G+ N ANGNHSVKPPTFQRG
Sbjct:  366 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMLPLK-CSNDTEDIYRSGRNYSGETNVANGNHSVKPPTFQRG 471          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy Swiss-Prot
Match: SAC3_ARATH (Phosphoinositide phosphatase SAC3 OS=Arabidopsis thaliana GN=SAC3 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.506e-22
Identity = 56/107 (52.34%), Postives = 64/107 (59.81%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            NRLRFLHWDLHKH RSK+ NVL LL KVA  AL LT  FY +VT A+  E+ M+  SS + D GD+SP    D+ N   D LE       N A G   VKPP  Q G
Sbjct:  373 NRLRFLHWDLHKHFRSKTKNVLALLCKVATCALMLTDLFYYQVTPAMTIEDSMSLSSSSDADTGDISPHTSSDDDNGDHDSLEKKSSRSKNIAYGKCDVKPPRLQSG 479          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy Swiss-Prot
Match: SAC4_ARATH (Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana GN=SAC4 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.715e-22
Identity = 56/107 (52.34%), Postives = 66/107 (61.68%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTWPSSENIDDGDMSPPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            NRLRFLHWDLHKH  SK+ NVL LLGKVA  AL LTGFFY ++T A++ E  M+  SS    D D SP    D+ +   D LE N     N ANG++ VKP   Q G
Sbjct:  382 NRLRFLHWDLHKHFHSKTENVLALLGKVAACALMLTGFFYYQLTPAMKLEGYMSLSSS----DADTSPHNSSDDDSRDYDSLEKNCRPSKNVANGDYDVKPSRLQSG 484          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy Swiss-Prot
Match: SAC2_ARATH (Phosphoinositide phosphatase SAC2 OS=Arabidopsis thaliana GN=SAC2 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.227e-16
Identity = 48/111 (43.24%), Postives = 63/111 (56.76%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFYCRVTSALRPEECMTW-PSSENIDDGDMS---PPKYCDNVNEGADRLEGNHFGDNNTANGNHSVKPPTFQRG 322
            +RLR LHWDLHKHSR K TNVL +LG++A YAL LT  FYC++T  LR E      PS+   DDG+ S   PP    + +E A  L   +  D+  A  +   +    Q+G
Sbjct:  378 DRLRPLHWDLHKHSRKKGTNVLAILGRLATYALNLTSIFYCQLTPDLRGEGFQNQNPSTLENDDGECSTYDPP----SKDETAPNLVVENGNDSKDAKEDQQKEVTMLQKG 484          
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy Swiss-Prot
Match: SAC1_ARATH (Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana GN=SAC1 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.126e-8
Identity = 23/40 (57.50%), Postives = 31/40 (77.50%), Query Frame = 2
Query:    2 NRLRFLHWDLHKHSRSKSTNVLLLLGKVANYALTLTGFFY 121
            N L+F+HWD HK ++SKS NVL +LG VA+ AL LTG ++
Sbjct:  393 NHLKFIHWDFHKFAKSKSANVLAVLGAVASEALDLTGLYF 432          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NN42_GOSAR1.311e-6292.38Polyphosphoinositide phosphatase OS=Gossypium arbo... [more]
A0A0D2SID1_GOSRA3.900e-5887.62Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2VH81_GOSRA4.441e-5887.62Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GSU6_THECC4.339e-5582.24Phosphoinositide phosphatase family protein isofor... [more]
A0A061GK02_THECC4.362e-5582.24Phosphoinositide phosphatase family protein isofor... [more]
A0A061GKX8_THECC5.369e-5582.24Phosphoinositide phosphatase family protein isofor... [more]
A0A061GM31_THECC6.073e-5582.24Phosphoinositide phosphatase family protein isofor... [more]
A0A061GLB4_THECC7.785e-5582.24Phosphoinositide phosphatase family protein isofor... [more]
A0A0D2QJB9_GOSRA1.045e-5385.05Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MB15_GOSAR3.526e-5284.11Polyphosphoinositide phosphatase OS=Gossypium arbo... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0007404 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SAC3_ARATH4.506e-2252.34Phosphoinositide phosphatase SAC3 OS=Arabidopsis t... [more]
SAC4_ARATH4.715e-2252.34Phosphoinositide phosphatase SAC4 OS=Arabidopsis t... [more]
SAC2_ARATH4.227e-1643.24Phosphoinositide phosphatase SAC2 OS=Arabidopsis t... [more]
SAC1_ARATH2.126e-857.50Phosphoinositide phosphatase SAC1 OS=Arabidopsis t... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 20..38
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 39..105
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..19

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0007404 ID=g.arboreum_cottongen_reftransV1_0007404|Name=g.arboreum_cottongen_reftransV1_0007404|organism=Gossypium arboreum|type=contig|length=322bp
GAACCGTTTGAGATTCCTTCACTGGGATCTACACAAACATTCTCGGAGCA
AATCGACAAATGTTTTGCTACTTTTGGGTAAAGTGGCCAATTATGCATTA
ACGCTAACAGGTTTCTTTTATTGTCGGGTGACATCAGCCTTGAGACCTGA
GGAGTGTATGACATGGCCTTCCTCTGAGAATATTGATGATGGTGACATGT
CACCCCCAAAATACTGTGACAATGTTAACGAGGGTGCTGACAGATTGGAG
GGGAATCATTTTGGTGATAATAATACTGCTAATGGAAATCATTCTGTCAA
GCCTCCCACTTTCCAAAGAGGT
back to top