g.arboreum_cottongen_reftransV1_0001550, g.arboreum_cottongen_reftransV1_0001550 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0001550
Unique Nameg.arboreum_cottongen_reftransV1_0001550
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2126
Homology
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: A0A0B0NE02_GOSAR (Methylenetetrahydrofolate reductase OS=Gossypium arboreum GN=F383_04451 PE=3 SV=1)

HSP 1 Score: 1201.81 bits (3108), Expect = 0.000e+0
Identity = 573/595 (96.30%), Postives = 589/595 (98.99%), Query Frame = -1
Query:  189 MKVIEKIQSLQE--GKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVI+KIQSL +  GKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQN+ICVETMMHLTCTNMPVEKIDHAL+TIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIR+KYGD+FGITVAGYPEAHPDAIG++GVAT EAYQ+DLAYLK+KVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGF+RMTGFCKTKIP E+TAALE IKDN+EAVK+YG+HLGTEMCRKILAHG+KTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL
Sbjct:    1 MKVIDKIQSLSQDQGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNMICVETMMHLTCTNMPVEKIDHALETIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRAKYGDFFGITVAGYPEAHPDAIGSNGVATPEAYQSDLAYLKKKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFVRMTGFCKTKIPDEVTAALEPIKDNDEAVKSYGIHLGTEMCRKILAHGIKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 595          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: A0A0D2QEY3_GOSRA (Methylenetetrahydrofolate reductase OS=Gossypium raimondii GN=B456_006G223600 PE=3 SV=1)

HSP 1 Score: 1198.34 bits (3099), Expect = 0.000e+0
Identity = 570/595 (95.80%), Postives = 587/595 (98.66%), Query Frame = -1
Query:  189 MKVIEKIQSLQE--GKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVI+KIQS  +  GKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQN+ICVETMMHLTCTNMPVEKIDHAL+TIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIR+KYGD+FGITVAGYPEAHPDAIG++GVAT EAYQ+DLAYLK+KVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGF+RMTGFCKTKIP E+TAALE IKDN+EAVK+YG+HLGTEMCRKILAHG+KTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLD LVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASF+VWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL
Sbjct:    1 MKVIDKIQSFSQDQGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNMICVETMMHLTCTNMPVEKIDHALETIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRAKYGDFFGITVAGYPEAHPDAIGSNGVATPEAYQSDLAYLKKKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFVRMTGFCKTKIPDEVTAALEPIKDNDEAVKSYGIHLGTEMCRKILAHGIKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDALVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFMVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 595          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: A0A0B0P0L2_GOSAR (Methylenetetrahydrofolate reductase OS=Gossypium arboreum GN=F383_21448 PE=3 SV=1)

HSP 1 Score: 1176.39 bits (3042), Expect = 0.000e+0
Identity = 556/593 (93.76%), Postives = 578/593 (97.47%), Query Frame = -1
Query:  189 MKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVN+CRQIGI CPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFW+NRPKSY++RTIGWDQYP GRWGDSRNPSYGAL+D+QFMRPRARDKKLQEEWATPLKSIDDIQEKFK++CLGKLRSSPWSELD LQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCS +KLD LV KC   SS+TY+AVNKKGNL+SNIG TDVNAVTWGVFPAKEI+QPTVVDPASF+VWKDEAFEIWSR+W+ALYP+GDPSK LLEE+QSSYYLVSLVDN+Y+  ++F VF DL
Sbjct:    1 MKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNECRQIGINCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWSNRPKSYITRTIGWDQYPYGRWGDSRNPSYGALTDHQFMRPRARDKKLQEEWATPLKSIDDIQEKFKSYCLGKLRSSPWSELDSLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSKEKLDALVNKCKPLSSITYIAVNKKGNLISNIGTTDVNAVTWGVFPAKEIVQPTVVDPASFMVWKDEAFEIWSRAWAALYPEGDPSKKLLEEVQSSYYLVSLVDNDYIGSDVFAVFGDL 593          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: A0A0D2UUH8_GOSRA (Methylenetetrahydrofolate reductase OS=Gossypium raimondii GN=B456_011G153400 PE=3 SV=1)

HSP 1 Score: 1157.9 bits (2994), Expect = 0.000e+0
Identity = 549/593 (92.58%), Postives = 572/593 (96.46%), Query Frame = -1
Query:  189 MKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLF+RMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVAT EAYQNDLAYLKRKVDAGADLIVTQLFYDTDIF+KFVNDCRQIGI CPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHG+KTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFW+NRPKSY++RTIGWDQ+P GRWGDSRNPSYGAL+D+QFMR RARDKKLQEEWATPLKSIDDIQEKFK+ CLGKLRSSPWSELD LQPETKIIHEQLGKINLKGFLTINSQPAVNGE SDS SVGWGGPGGYVYQKAYLEFFCS +KLD LV KC   SS+TY+AVNKKGNL+SNIG TDVNAVTWGVFPAKEIIQPTVVDPASF+VWKDEAFEIWSR+W+ALYP+GD SK LLEE+QSSYYLVSLVDN+Y+  ++F VF DL
Sbjct:    1 MKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFDRMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATPEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFIKFVNDCRQIGINCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGIKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWSNRPKSYITRTIGWDQFPHGRWGDSRNPSYGALTDHQFMRRRARDKKLQEEWATPLKSIDDIQEKFKSFCLGKLRSSPWSELDSLQPETKIIHEQLGKINLKGFLTINSQPAVNGELSDSLSVGWGGPGGYVYQKAYLEFFCSKEKLDALVNKCKPLSSITYIAVNKKGNLISNIGATDVNAVTWGVFPAKEIIQPTVVDPASFMVWKDEAFEIWSRAWAALYPEGDLSKKLLEEVQSSYYLVSLVDNDYIGSDVFAVFGDL 593          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: A0A061ELE3_THECC (Methylenetetrahydrofolate reductase OS=Theobroma cacao GN=TCM_020235 PE=3 SV=1)

HSP 1 Score: 1129.01 bits (2919), Expect = 0.000e+0
Identity = 536/599 (89.48%), Postives = 567/599 (94.66%), Query Frame = -1
Query:  189 MKVIEKIQSLQE--GKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDP----SKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVIEKI++LQE  GKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGF+CALDLVKHIRSKYGDYFGITVAGYPEAHPDAIG+DGVAT EAYQNDL YLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPA+IT ALE IKDN+EAVK+YG+HLGTEMCRKILAHG+KTLHLYTLNMEKSALAILMNLGLIEESKISR LPWRRPANVFRVKEDVRPIFWANRPKSY+SRTIGWDQYP GRWGDS+NPSYGAL+DYQFMRPRAR KKL EEWATPLKSIDDIQEKFK++CLGKL+SSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDS SVGWGGPGGYVYQKAYLEFFCS +KLD L+ KC + S +TY+AVNK G+L+SNIG+ DVNAVTWG FPAKE IQPTVVDPASF+VWKDEAFEIWSR+W++ Y D DP    SK LLEE+QS YYLVSLVDN+Y+ GNIF VFED+
Sbjct:    1 MKVIEKIRTLQEEQGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFACALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGSDGVATPEAYQNDLEYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPADITNALEPIKDNDEAVKSYGIHLGTEMCRKILAHGIKTLHLYTLNMEKSALAILMNLGLIEESKISRFLPWRRPANVFRVKEDVRPIFWANRPKSYISRTIGWDQYPHGRWGDSQNPSYGALTDYQFMRPRARGKKLHEEWATPLKSIDDIQEKFKSYCLGKLKSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSTSVGWGGPGGYVYQKAYLEFFCSKEKLDALIAKCKALSFITYLAVNKNGDLISNIGVADVNAVTWGAFPAKETIQPTVVDPASFMVWKDEAFEIWSRTWASWYSDTDPEGVQSKKLLEEVQSKYYLVSLVDNDYISGNIFAVFEDI 599          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: A0A0D2VMP2_GOSRA (Methylenetetrahydrofolate reductase OS=Gossypium raimondii GN=B456_011G153400 PE=3 SV=1)

HSP 1 Score: 1119.38 bits (2894), Expect = 0.000e+0
Identity = 531/567 (93.65%), Postives = 550/567 (97.00%), Query Frame = -1
Query:  267 MKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEI 1967
            MKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLF+RMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVAT EAYQNDLAYLKRKVDAGADLIVTQLFYDTDIF+KFVNDCRQIGI CPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHG+KTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFW+NRPKSY++RTIGWDQ+P GRWGDSRNPSYGAL+D+QFMR RARDKKLQEEWATPLKSIDDIQEKFK+ CLGKLRSSPWSELD LQPETKIIHEQLGKINLKGFLTINSQPAVNGE SDS SVGWGGPGGYVYQKAYLEFFCS +KLD LV KC   SS+TY+AVNKKGNL+SNIG TDVNAVTWGVFPAKEIIQPTVVDPASF+VWKDEAFEIWSR+W+ALYP+GD SK LLEE+
Sbjct:    1 MKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFDRMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATPEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFIKFVNDCRQIGINCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGIKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWSNRPKSYITRTIGWDQFPHGRWGDSRNPSYGALTDHQFMRRRARDKKLQEEWATPLKSIDDIQEKFKSFCLGKLRSSPWSELDSLQPETKIIHEQLGKINLKGFLTINSQPAVNGELSDSLSVGWGGPGGYVYQKAYLEFFCSKEKLDALVNKCKPLSSITYIAVNKKGNLISNIGATDVNAVTWGVFPAKEIIQPTVVDPASFMVWKDEAFEIWSRAWAALYPEGDLSKKLLEEV 567          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: M5W952_PRUPE (Methylenetetrahydrofolate reductase OS=Prunus persica GN=PRUPE_ppa003184mg PE=3 SV=1)

HSP 1 Score: 1089.33 bits (2816), Expect = 0.000e+0
Identity = 505/595 (84.87%), Postives = 556/595 (93.45%), Query Frame = -1
Query:  189 MKVIEKIQS--LQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVIEKIQ   L+E KV+FSFEFFPPKTEDGV+NL ERM+RMVAHNP+FCDITWGAGGSTADLTLDIANKMQNIICVE+MMHLTCTNMPV+KIDHALQTIKSNG+QNVLALRGDPPHGQDKFVQ++GGF+CALDLV HIR+KYGDYFG+TVAGYPEAHPDAIG DG+A+ EAYQ+DLAYLKRKVDAGADLI+TQLFYDTD+FLKFV+DCRQIGITCPIVPGIMPINNYKGF+RMTGFCKTKIPAE+TAALE IKDNEEAVK+YG+HLGTEMC+KILAHG++TLHLYTLNMEKSALAILMNLGLIEE+KISR LPWRRPANVFRVKEDVRPIFWANRPKSY+SRTIGWD YP GRWGDSRNPSYGAL+DYQFMRPRARDKKL EEW  PL+S++DI EKFK  CLGKLRSSPWSELDGLQPETKII+E LGKIN KGFLTINSQPAVNGERSDS SVGWGGPGGYVYQKAYLEFFCS +KL+ LV+KC +  SLTY+AVNK G  +SNIG TDVNAVTWGVFPA+EIIQPTVVDPASF+VWKDEAFEIWSR W+ LYP+GD S+ LLEE+Q+SY+L SLVDN+Y+ G++F VF D 
Sbjct:    1 MKVIEKIQEALLEEKKVLFSFEFFPPKTEDGVENLLERMERMVAHNPAFCDITWGAGGSTADLTLDIANKMQNIICVESMMHLTCTNMPVDKIDHALQTIKSNGLQNVLALRGDPPHGQDKFVQIQGGFACALDLVTHIRAKYGDYFGVTVAGYPEAHPDAIGTDGLASPEAYQSDLAYLKRKVDAGADLIITQLFYDTDVFLKFVHDCRQIGITCPIVPGIMPINNYKGFIRMTGFCKTKIPAEVTAALEPIKDNEEAVKSYGIHLGTEMCKKILAHGIRTLHLYTLNMEKSALAILMNLGLIEETKISRPLPWRRPANVFRVKEDVRPIFWANRPKSYISRTIGWDLYPHGRWGDSRNPSYGALTDYQFMRPRARDKKLVEEWVVPLRSVEDIHEKFKKFCLGKLRSSPWSELDGLQPETKIINELLGKINTKGFLTINSQPAVNGERSDSTSVGWGGPGGYVYQKAYLEFFCSKEKLNALVEKCKALPSLTYMAVNKDGRWISNIGQTDVNAVTWGVFPAREIIQPTVVDPASFMVWKDEAFEIWSRGWACLYPEGDSSRKLLEEVQNSYFLASLVDNDYIQGDVFAVFADF 595          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: B9HG95_POPTR (Methylenetetrahydrofolate reductase OS=Populus trichocarpa GN=POPTR_0007s00200g PE=3 SV=1)

HSP 1 Score: 1087.79 bits (2812), Expect = 0.000e+0
Identity = 512/608 (84.21%), Postives = 558/608 (91.78%), Query Frame = -1
Query:  189 MKVIEKIQSL---------------QEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVI+KI+                    KVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHAL+TIKSNGIQNVLALRGDPPHGQDKFVQ++GGF+CALDLVKHIRSKYGDYFGITVAGYPEAHPDAIG+DG AT E YQ DLAYLK+KVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAE+TAALE IKDNEEAV+AYG+HLGTEMC+KILAHG+KTLHLYTLNMEKSALAILMNLGLIEESKI+R+LPWR P NVFR KEDVRPIFWANRPKSYLSRTIGWDQYP GRWGDS NPSYGALSDYQFMRPRAR KKL EEWA+PLKS++DI EKFK +CLGKL+SSPWSEL+GLQPETKII+EQLG+INLKGFLTINSQPAVN E+SDSPSVGWGGPGGYVYQKAYLEFFCS +KL+ LV++C +F  +TY+AVN+ G+ +SN+ LTDVNAVTWGVFPAKEIIQPTVVDP SF VWKDEAFEIWSR W++LYP+GDPS+ LLEE+Q+SY+LVSLVDN+Y+ G+IF VF +L
Sbjct:    1 MKVIDKIREAAGGGGDANGNGGDNSSSNKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALETIKSNGIQNVLALRGDPPHGQDKFVQIQGGFACALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGSDGFATPEDYQKDLAYLKQKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEVTAALEPIKDNEEAVRAYGIHLGTEMCKKILAHGIKTLHLYTLNMEKSALAILMNLGLIEESKITRALPWRPPTNVFRAKEDVRPIFWANRPKSYLSRTIGWDQYPHGRWGDSHNPSYGALSDYQFMRPRARGKKLFEEWASPLKSVEDIYEKFKVYCLGKLKSSPWSELEGLQPETKIINEQLGRINLKGFLTINSQPAVNAEKSDSPSVGWGGPGGYVYQKAYLEFFCSKEKLNALVERCKAFPLVTYMAVNRGGSWISNVALTDVNAVTWGVFPAKEIIQPTVVDPTSFSVWKDEAFEIWSRGWASLYPEGDPSRTLLEEVQNSYFLVSLVDNDYIHGDIFAVFAEL 608          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: V4VQH3_9ROSI (Methylenetetrahydrofolate reductase OS=Citrus clementina GN=CICLE_v10019406mg PE=3 SV=1)

HSP 1 Score: 1087.79 bits (2812), Expect = 0.000e+0
Identity = 510/594 (85.86%), Postives = 556/594 (93.60%), Query Frame = -1
Query:  189 MKVIEKIQS-LQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVI+KIQ  +   KVVFSFEFFPPKTEDGV+NLFERMDRMVAHNP+FCDITWGAGGSTADLTLDIAN+MQN ICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQ++GGF+CALDLVKHIRS YGDYFGITVAGYPE HPD IG DGVA++E+YQ+DL YLK+KVDAGADLI+TQLFYDTD+FLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALE IKDNEEAVKAYG+HLG EMC+KILAHG+KT+HLYTLNMEKSALAIL+NLGLIEESKISRSLPWR P NVFRVKEDVRPIFWANRPKSYLSRT+GWDQYP+GRWGDSRNPSYGALSD+QFMRPR+RDKKL EEWA PLKS++DI EKFKN+CLGKLRSSPWSELDGLQPETKII+EQLGKIN+KGFLTINSQPAVNGERSDS SVGWGGPGGYVYQKAYLEFFCS +KL  LV K      +T++AVNK+GN  +N+  TDVNAVTWGVFPAKEIIQPTVVDPASF VWKDEAFEIWSRSW++LYP+GD S+ LLEE+QSSYYLVSLVDN+Y++G++F VF DL
Sbjct:    1 MKVIDKIQEKVASDKVVFSFEFFPPKTEDGVENLFERMDRMVAHNPAFCDITWGAGGSTADLTLDIANRMQNTICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQIQGGFACALDLVKHIRSAYGDYFGITVAGYPEGHPDTIGPDGVASNESYQSDLLYLKKKVDAGADLIITQLFYDTDMFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEPIKDNEEAVKAYGIHLGAEMCKKILAHGIKTVHLYTLNMEKSALAILLNLGLIEESKISRSLPWRPPTNVFRVKEDVRPIFWANRPKSYLSRTVGWDQYPRGRWGDSRNPSYGALSDHQFMRPRSRDKKLHEEWAVPLKSVEDIYEKFKNYCLGKLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKVLPFITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDYINGDLFTVFADL 594          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Match: U5FIP4_POPTR (Methylenetetrahydrofolate reductase OS=Populus trichocarpa GN=POPTR_0017s00520g PE=3 SV=1)

HSP 1 Score: 1087.4 bits (2811), Expect = 0.000e+0
Identity = 514/605 (84.96%), Postives = 553/605 (91.40%), Query Frame = -1
Query:  189 MKVIEKIQ------------SLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVI+KI+            S    KVVFSFEFFPPKT+DGVDNLFERMDRMV+HNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHAL+TIKSNGIQNVLALRGDPPHGQDKFVQ++GG +CALDLVKHIRSKYGDYFGITVAGYPEAHPD IG+DG AT E Y  DLAYLK+KVDAGADLIVTQLFYDTDIFLKFVNDCRQIGI CPIVPGIMPINNYKGF+RM GFCKTKIPAE+TAALE IKDNEEAV+AYG+HLGTEMC+KILAHG+KTLHLYTLNMEKSALAILMNLGLIEESKI+R LPWR P NVFRVKEDVRPIFWANRPKSYL+RTIGWDQYP GRWGDSRNPSYGALSDYQFMRPRAR KKL EEWA PLKS++DI EKFK +CLGKL+SSPWSELDGLQPETKII+EQLGKINLKGFLTINSQPAVNGE+SDSPSVGWGGPGGYVYQKAYLEFFCS DKL+ LV KC SF  +TY+AVNK G+ +SN+ LTDVNAVTWGVFP KEIIQPTVVDP SF VWKDEAFEIWSR W++LYP+GDPS+ LLEE+QSSY+LVSLVDN+Y+ G+IF VF DL
Sbjct:    1 MKVIDKIRAAAAAGDSNGGDSSSNNKVVFSFEFFPPKTDDGVDNLFERMDRMVSHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALETIKSNGIQNVLALRGDPPHGQDKFVQIQGGLACALDLVKHIRSKYGDYFGITVAGYPEAHPDVIGSDGFATLEDYHKDLAYLKQKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGINCPIVPGIMPINNYKGFIRMAGFCKTKIPAEVTAALEPIKDNEEAVRAYGIHLGTEMCKKILAHGIKTLHLYTLNMEKSALAILMNLGLIEESKITRPLPWRPPTNVFRVKEDVRPIFWANRPKSYLTRTIGWDQYPHGRWGDSRNPSYGALSDYQFMRPRARGKKLLEEWAAPLKSVEDIYEKFKVYCLGKLKSSPWSELDGLQPETKIINEQLGKINLKGFLTINSQPAVNGEKSDSPSVGWGGPGGYVYQKAYLEFFCSKDKLNALVDKCKSFPFVTYIAVNKGGSWISNVALTDVNAVTWGVFPGKEIIQPTVVDPTSFSVWKDEAFEIWSRGWASLYPEGDPSRTLLEEVQSSYFLVSLVDNDYIHGDIFAVFADL 605          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR2_ARATH (Methylenetetrahydrofolate reductase 2 OS=Arabidopsis thaliana GN=MTHFR2 PE=1 SV=2)

HSP 1 Score: 1057.74 bits (2734), Expect = 0.000e+0
Identity = 489/594 (82.32%), Postives = 548/594 (92.26%), Query Frame = -1
Query:  189 MKVIEKIQSL-QEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVI+KIQSL  EGK  FSFEFFPPKTEDGVDNLFERMDRMVA+ P+FCDITWGAGGSTADLTLDIA++MQN++CVE+MMHLTCTNMPVEKIDHAL+TI+SNGIQNVLALRGDPPHGQDKFVQVEGGF CALDLV HIRSKYGDYFGITVAGYPEAHPD IG +G+A++EAYQ+DL YLK+K+DAGADLIVTQLFYDTDIFLKFVNDCRQIGI+CPIVPGIMPINNY+GFLRMTGFCKTKIP E+ AALE IKDNEEAVKAYG+HLGTEMC+K+LAHGVK+LHLYTLNMEKSALAILMNLG+I+ESKISRSLPWRRPANVFR KEDVRPIFWANRPKSY+SRT GW+ +PQGRWGDSR+ SYGALSD+QF RPRARDKKLQ+EW  PLKS++DIQEKFK  CLG L+SSPWSELDGLQPET+II+EQL K+N KGFLTINSQP+VN ERSDSP+VGWGGP GYVYQKAYLEFFCS +KLD +V+KC +  S+TY+AVNK    +SN    DVNAVTWGVFPAKEIIQPT+VDPASF VWKDEAFE WSRSW+ LYP+ DPS+NLLEE+++SYYLVSLV+N+Y++G+IF VF DL
Sbjct:    1 MKVIDKIQSLADEGKTAFSFEFFPPKTEDGVDNLFERMDRMVAYGPTFCDITWGAGGSTADLTLDIASRMQNVVCVESMMHLTCTNMPVEKIDHALETIRSNGIQNVLALRGDPPHGQDKFVQVEGGFDCALDLVNHIRSKYGDYFGITVAGYPEAHPDVIGENGLASNEAYQSDLEYLKKKIDAGADLIVTQLFYDTDIFLKFVNDCRQIGISCPIVPGIMPINNYRGFLRMTGFCKTKIPVEVMAALEPIKDNEEAVKAYGIHLGTEMCKKMLAHGVKSLHLYTLNMEKSALAILMNLGMIDESKISRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWEDFPQGRWGDSRSASYGALSDHQFSRPRARDKKLQQEWVVPLKSVEDIQEKFKELCLGNLKSSPWSELDGLQPETRIINEQLIKVNSKGFLTINSQPSVNAERSDSPTVGWGGPVGYVYQKAYLEFFCSKEKLDAVVEKCKALPSITYMAVNKGEQWVSNTAQADVNAVTWGVFPAKEIIQPTIVDPASFNVWKDEAFETWSRSWANLYPEADPSRNLLEEVKNSYYLVSLVENDYINGDIFAVFADL 594          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR_ORYSJ (Probable methylenetetrahydrofolate reductase OS=Oryza sativa subsp. japonica GN=Os03g0815200 PE=2 SV=1)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 486/594 (81.82%), Postives = 539/594 (90.74%), Query Frame = -1
Query:  189 MKVIEKIQ-SLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFEDL 1967
            MKVIEKIQ +  +G+ VFSFE+FPPKTE+G+DNLFERMDRMVAH P+FCDITWGAGGSTADLTL+IAN+MQN++CVETMMHLTCTNMPVEKID AL TIKSNGIQNVLALRGDPPHGQDKFVQV GGF+CALDLV+HIR+KYGDYFGITVAGYPEAHPDAI +   AT EAY NDLAYLK+KVDAGADLI+TQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALE IKDNEEAVKAYG+HLGTEMC+KILA G+KTLHLYTLNMEKSAL ILMNLGLIEESKISRSLPWR P NVFRVKEDVRPIFWANRPKSY+SRT+GWDQYP GRWGDSRNPSYGAL+DYQF RPR R KKLQEEWA P+KS++DI E+F N C GKL SSPWSELDGLQPETKII +QL KIN KGFLTINSQPAVNGERSDS SVGWGGPGGYVYQKAYLEFFCS +KLD L++K  +F SLTY+AVNK G   SNI    VNAVTWGVFP KEI+QPTVVD ASF+VWKDEAFEIWS+ W+ L+P+GD S+ +L+++Q SY+LVSLVDN+Y++G++F  F+++
Sbjct:    1 MKVIEKIQEAAADGRTVFSFEYFPPKTEEGLDNLFERMDRMVAHGPNFCDITWGAGGSTADLTLEIANRMQNMVCVETMMHLTCTNMPVEKIDDALTTIKSNGIQNVLALRGDPPHGQDKFVQVAGGFACALDLVQHIRAKYGDYFGITVAGYPEAHPDAIQSTEGATPEAYSNDLAYLKQKVDAGADLIITQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEPIKDNEEAVKAYGIHLGTEMCKKILATGIKTLHLYTLNMEKSALGILMNLGLIEESKISRSLPWRPPTNVFRVKEDVRPIFWANRPKSYISRTLGWDQYPHGRWGDSRNPSYGALTDYQFTRPRGRGKKLQEEWAVPVKSVEDINERFMNFCQGKLTSSPWSELDGLQPETKIIDDQLVKINQKGFLTINSQPAVNGERSDSTSVGWGGPGGYVYQKAYLEFFCSKEKLDQLIEKSKAFPSLTYIAVNKDGESFSNIPTNAVNAVTWGVFPGKEIVQPTVVDSASFMVWKDEAFEIWSKGWACLFPEGDSSREILDKVQKSYFLVSLVDNDYINGDLFAAFKEI 594          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR1_ARATH (Methylenetetrahydrofolate reductase 1 OS=Arabidopsis thaliana GN=MTHFR1 PE=1 SV=1)

HSP 1 Score: 1033.48 bits (2671), Expect = 0.000e+0
Identity = 474/591 (80.20%), Postives = 540/591 (91.37%), Query Frame = -1
Query:  198 MKVIEKIQSLQE-GKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVF 1967
            MKV++KI+S+ E G+  FSFEFFPPKTEDGV+NLFERMDR+V++ P+FCDITWGAGGSTADLTL+IA++MQN+ICVETMMHLTCTNMP+EKIDHAL+TI+SNGIQNVLALRGDPPHGQDKFVQVEGGF+CALDLV HIRSKYGDYFGITVAGYPEAHPD I  DG+AT E+YQ+DLAYLK+KVDAGADLIVTQLFYDTDIFLKFVNDCRQIGI CPIVPGIMPI+NYKGFLRM GFCKTKIPAE+TAALE IKDN+EAVKAYG+H  TEMC+KILAHG+ +LHLYTLN++KSA+ ILMNLGLI+ESKISRSLPWRRPANVFR KEDVRPIFWANRPKSY+SRT GW+ +P GRWGDS + +Y  LSDYQF RP+ RDKKLQ+EW  PLKSI+D+QEKFK  C+G L+SSPWSELDGLQPETKII+EQLGKIN  GFLTINSQP+VN  +SDSP++GWGGPGGYVYQKAYLEFFCS DKLD LV+K  +F S+TY+AVNK  N +SN G +DVNAVTWGVFPAKE+IQPT+VDPASF VWKDEAFEIWSRSW+ LYP+ DPS+ LLEE+++SYYLVSLVDNNY++G+IF VF
Sbjct:    1 MKVVDKIKSVTEQGQTAFSFEFFPPKTEDGVENLFERMDRLVSYGPTFCDITWGAGGSTADLTLEIASRMQNVICVETMMHLTCTNMPIEKIDHALETIRSNGIQNVLALRGDPPHGQDKFVQVEGGFACALDLVNHIRSKYGDYFGITVAGYPEAHPDVIEADGLATPESYQSDLAYLKKKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGINCPIVPGIMPISNYKGFLRMAGFCKTKIPAELTAALEPIKDNDEAVKAYGIHFATEMCKKILAHGITSLHLYTLNVDKSAIGILMNLGLIDESKISRSLPWRRPANVFRTKEDVRPIFWANRPKSYISRTKGWNDFPHGRWGDSHSAAYSTLSDYQFARPKGRDKKLQQEWVVPLKSIEDVQEKFKELCIGNLKSSPWSELDGLQPETKIINEQLGKINSNGFLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSKDKLDTLVEKSKAFPSITYMAVNKSENWVSNTGESDVNAVTWGVFPAKEVIQPTIVDPASFKVWKDEAFEIWSRSWANLYPEDDPSRKLLEEVKNSYYLVSLVDNNYINGDIFSVF 591          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR1_MAIZE (Methylenetetrahydrofolate reductase 1 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 1031.94 bits (2667), Expect = 0.000e+0
Identity = 480/592 (81.08%), Postives = 534/592 (90.20%), Query Frame = -1
Query:  195 MKVIEKI-QSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDGNIFGVFE 1967
            MKVIEKI ++  +G+  FSFE+FPPKTE+GV+NLFERMDRMVAH PSFCDITWGAGGSTADLTL+IAN+MQN++CVETMMHLTCTNMPVEKIDHAL+TIKSNGIQNVLALRGDPPHGQDKFVQVEGGF+CALDLV+HIR+KYGDYFGITVAGYPEAHPDAI  +G AT EAY NDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIP+EITAAL+ IKDNEEAV+ YG+HLGTEMC+KILA G+KTLHLYTLNM+KSA+ ILMNLGLIEESK+SR LPWR   NVFRVKEDVRPIFWANRPKSYL RT+GWDQYP GRWGDSRNPSYGAL+D+QF RPR R KKLQEEWA PLKS++DI E+F N C GKL SSPWSELDGLQPETKII +QL  IN KGFLTINSQPAVNGE+SDSP+VGWGGPGGYVYQKAYLEFFC+ +KLD L++K  +F SLTY+AVNK G   SNI    VNAVTWGVFP KEIIQPTVVD ASF+VWKDEAFEIW+R W  ++P+GD S+ LLE++Q +YYLVSLVDN+Y+ G++F  F+
Sbjct:    1 MKVIEKILEAAGDGRTAFSFEYFPPKTEEGVENLFERMDRMVAHGPSFCDITWGAGGSTADLTLEIANRMQNMVCVETMMHLTCTNMPVEKIDHALETIKSNGIQNVLALRGDPPHGQDKFVQVEGGFACALDLVQHIRAKYGDYFGITVAGYPEAHPDAIQGEGGATLEAYSNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPSEITAALDPIKDNEEAVRQYGIHLGTEMCKKILATGIKTLHLYTLNMDKSAIGILMNLGLIEESKVSRPLPWRPATNVFRVKEDVRPIFWANRPKSYLKRTLGWDQYPHGRWGDSRNPSYGALTDHQFTRPRGRGKKLQEEWAVPLKSVEDISERFTNFCQGKLTSSPWSELDGLQPETKIIDDQLVNINQKGFLTINSQPAVNGEKSDSPTVGWGGPGGYVYQKAYLEFFCAKEKLDQLIEKIKAFPSLTYIAVNKDGETFSNISPNAVNAVTWGVFPGKEIIQPTVVDHASFMVWKDEAFEIWTRGWGCMFPEGDSSRELLEKVQKTYYLVSLVDNDYVQGDLFAAFK 592          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR_HUMAN (Methylenetetrahydrofolate reductase OS=Homo sapiens GN=MTHFR PE=1 SV=3)

HSP 1 Score: 516.924 bits (1330), Expect = 1.257e-172
Identity = 266/617 (43.11%), Postives = 382/617 (61.91%), Query Frame = -1
Query:  192 HREFKIQLKMKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTAD----LTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHG-VKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQ--FMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLG-------KLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFS-SLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNY-MDGNIFGVFED 1994
             R  +++ KM+     + L+ G   FS EFFPP+T +G  NL  R DRM A  P + D+TW   G         ++ IA+   N   +ET++H+TC    +E+I   L   K  G++N++ALRGDP    D++ + EGGF+ A+DLVKHIRS++GDYF I VAGYP+ HP+A          +++ DL +LK KV AGAD I+TQLF++ D F +FV  C  +GITCPIVPGI PI  Y    ++    K ++P EI   +E IKDN+ A++ YG+ L   +C+++LA G V  LH YTLN E +   +L  LG+  E    R LPW   A+  R +EDVRPIFWA+RPKSY+ RT  WD++P GRWG+S +P++G L DY   +++ ++  ++L + W   L S + + E F  +  G       K+   PW++ + L  ET ++ E+L ++N +G LTINSQP +NG+ S  P VGWG  GGYV+QKAYLEFF S +  + L++    +   + Y  VN KG  ++N      NAVTWG+FP +EIIQPTVVDP SF+ WKDEAF +W   W  LY +  PS+ +++ I  +Y+LV+LVDN++ +D  ++ V ED
Sbjct:   40 ERHERLREKMR-----RRLESGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLYIDVTWHPAGDPGSDKETSSMMIASTAVNYCGLETILHMTCCRQRLEEITGHLHKAKQLGLKNIMALRGDPI--GDQWEEEEGGFNYAVDLVKHIRSEFGDYFDICVAGYPKGHPEA---------GSFEADLKHLKEKVSAGADFIITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQGYHSLRQLVKLSKLEVPQEIKDVIEPIKDNDAAIRNYGIELAVSLCQELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDP-RRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKMWGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWND-EPLAAETSLLKEELLRVNRQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIERWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDFPLDNCLWQVVED 638          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR_MACFA (Methylenetetrahydrofolate reductase OS=Macaca fascicularis GN=MTHFR PE=2 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 2.747e-170
Identity = 265/616 (43.02%), Postives = 380/616 (61.69%), Query Frame = -1
Query:  192 REFKIQLKMKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTAD----LTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHG-VKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQ--FMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLG-------KLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFS-SLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNY-MDGNIFGVFED 1991
            R  +++ KM+     + ++ G   FS EFFPP+T +G  NL  R DRM A  P F D+TW   G         ++ IA+   N   +ET++H+TC    +E+I   L   K  G++N++ALRGDP    D++ + EGGF+ A+DLVKHIRS++GDYF + VAGYP+ HP+A          +++ DL +LK KV AGAD I+TQLF++ D F +FV  C  +GITCPIVPGI PI  Y    ++    K ++P EI   +E IKDN+ A++ YG+ L   +C ++LA G V  LH YTLN E +   +L  LG+  E    R LPW   A+  R +EDVRPIFWA+RPKSY+ RT  WD++P GRWG+S +P++G L DY   +++ ++  + L + W   L S + + E F  +  G       K+   PW++ + L  ET ++ E+L ++N +G LTINSQP +NG+ S  P VGWG  GGYV+QKAYLEFF S +  + L++    +   + Y  VN KG  ++N      NAVTWG+FP +EIIQPTVVDP SF+ WKDEAF +W   W  LY +  PS+ +++ I  +Y+LV+LVDN++ +D  ++ V ED
Sbjct:   41 RHERLRDKMR-----RRMESGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLFIDVTWHPAGDPGSDKETSSMMIASTAVNYCGLETILHMTCCCQRLEEITGHLHKAKQLGLKNIMALRGDPI--GDQWEEEEGGFNYAVDLVKHIRSEFGDYFDLCVAGYPKGHPEA---------GSFEADLKHLKEKVSAGADFIITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQGYHSLRQLVKQSKLEVPQEIKDVIEPIKDNDAAIRNYGIELAVSLCHELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDP-RRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPRELLLKMWGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWND-EPLAAETSLLKEELLRVNRQGILTINSQPNINGKPSSDPVVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFALWIEQWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDFPLDNCLWQVVED 638          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR_BOVIN (Methylenetetrahydrofolate reductase OS=Bos taurus GN=MTHFR PE=2 SV=1)

HSP 1 Score: 509.99 bits (1312), Expect = 6.036e-170
Identity = 263/612 (42.97%), Postives = 382/612 (62.42%), Query Frame = -1
Query:  192 QLKMKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTAD----LTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHG-VKTLHLYTLNMEKSALAILMNLGL-IEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQ--FMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLG-------KLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFS-SLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNY-MDGNIFGVFED 1976
            +L+ K+  K+ S   G   FS EFFPP+T  G  NL  R DRM A  P F D+TW   G         ++ IA+   N   +ET++H+TC +   E+I   L   K  G++N+LALRGDP    D++ + EGGF+ A DLVKHIR+++GDYF + VAGYP+ HP+          E+++ DL +LK KV AGAD I+TQLF++ + F +FV  C +IGITCP++PGI PI  Y    ++    K ++P +I   +E IKDN+ A++ YG+     +C+++LA G V  LH YTLN E + + +L  LGL IE+ +  R LPW   A+  R  EDVRPIFWA+RPKSY+ RT  WD++P GRWG+S +P++G L DY   +++ ++  ++L + W   L S + + + F +H  G       K+   PW++ + L  ET ++ E+L ++N +G LTINSQP +NG+ S  P VGWG  GGYV+QKAYLEFF S + ++ L++    +   + Y  V+ KG  ++N      NAVTWG+FP +EIIQPTVVDP SF+ WKDEAF +W   W  LY +  PS+ +++ I  +Y+LV+LVDN + +D  ++ V ED
Sbjct:   43 RLREKMKRKMDS---GDKWFSLEFFPPRTAQGAVNLISRFDRMGAGGPLFVDVTWHPAGDPGSDKETSSMVIASTAVNYCGLETILHMTCCHQSREEITGHLNKAKQLGLKNILALRGDPI--GDQWEEEEGGFNYATDLVKHIRNEFGDYFDVCVAGYPKGHPEG---------ESFEADLKHLKEKVAAGADFIITQLFFEAETFFRFVKACSEIGITCPVLPGIFPIQGYHSLRQLVKLSKLEVPQQIKDVIEPIKDNDAAIRNYGIEQAVSLCQELLASGLVPGLHFYTLNREVATIEVLKRLGLWIEDPR--RPLPWALSAHPKRRVEDVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKMWGEELTSEESVFQVFAHHLSGEPNQNGYKVTCLPWND-EPLAAETSLMKEELLRVNRRGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKKYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEFPLDNCLWQVVED 637          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR_MOUSE (Methylenetetrahydrofolate reductase OS=Mus musculus GN=Mthfr PE=2 SV=2)

HSP 1 Score: 508.834 bits (1309), Expect = 1.645e-169
Identity = 261/616 (42.37%), Postives = 377/616 (61.20%), Query Frame = -1
Query:  192 REFKIQLKMKVIEKIQSLQEGKVVFSFEFFPPKTEDGVDNLFERMDRMVAHNPSFCDITWGAGGSTAD----LTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHG-VKTLHLYTLNMEKSALAILMNLGLIEESKISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQ--FMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLG-------KLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFS-SLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNY-MDGNIFGVFED 1991
            R  +++ KM+     + +  G   FS EFFPP+T +G  NL  R DRM A  P F D+TW   G         ++ IA+   N   +ET++H+TC     E+I   L   K  G++N++ALRGDP    D +   EGGFS A DLVKHIR+++ DYF I VAGYP  HPDA         E++++DL +LK KV AGAD I+TQLF++   F  FV  C +IGI+CPI+PGI PI  Y    ++    K ++P +I   +E IKDN+ A++ YG+ L   +CR++L  G V  LH YTLN E + + +L  LG+  E    R LPW   A+  R +EDVRPIFWA+RPKSY+ RT  WD++P GRWG+S +P++G L DY   +++ ++  ++L + W   L S + + E F+++  G       ++   PW++ + L  ET ++ E+L ++N  G LTINSQP +N + S  P VGWG  GGYV+QKAYLEFF S + ++ L++   ++   + Y  V+ KG  ++N      NAVTWG+FP +EIIQPTVVDP SF+ WKDEAF +W   W  LY +  PS+ +++ I  +Y+LV+LVDN + +D  ++ V ED
Sbjct:   40 RHERLREKMR-----RRMDSGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLFVDVTWHPAGDPGSDKETSSMMIASTAVNYCGLETILHMTCCQQRPEEITGHLHRAKQLGLKNIMALRGDP--VGDHWEAEEGGFSYATDLVKHIRTEFADYFDICVAGYPRGHPDA---------ESFEDDLKHLKEKVSAGADFIITQLFFEASTFFSFVKACTEIGISCPILPGIFPIQGYTSLRQLVKLSKLEVPQKIKDVIEPIKDNDAAIRNYGIELAVSLCRELLDSGLVPGLHFYTLNREVATMEVLKQLGMWTEDP-RRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQDWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPREELLKMWGEELTSEESVFEVFEHYLSGEPNRHGYRVTCLPWND-EPLAAETSLMKEELLRVNRLGILTINSQPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKTYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFALWIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEFPLDSCLWQVVED 637          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR1_SCHPO (Methylenetetrahydrofolate reductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met9 PE=1 SV=1)

HSP 1 Score: 486.493 bits (1251), Expect = 1.507e-161
Identity = 257/592 (43.41%), Postives = 355/592 (59.97%), Query Frame = -1
Query:  189 KVVFSFEFFPPKTEDGVDNLFERMDRMVA-HNPSFCDITWGAGGSTADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHGVKTLHLYTLNMEKSALAILMNLGLIEES----------KISRSLPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGWDQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSNIGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEIWSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYMDG-NIFGVFEDL 1928
            KV +S+EFFPPKT  GV NL+ R+DRM     P F D+TWGAGG++++LT  I N +Q    V+T MHLTCTNM  E ID AL+     G +N+LALRGDP    D + + E GF  A DLV++IR+ Y D F I VAGYPE         G +  +     + +LK KVD GAD IVTQ+FYD D F+ +V+  R  GI  PI PGIMPI  +  F+R   +   KIP      L  +KD++E V+  GV L  EMCRK++A G+  LH YT+N+EK+   I+  LGL++E+          +++ +    R     R+ E VRPIFW  R +SY+SRT  WD+ P GRWGDSR+P++G     ++   R   K++   W +P KS  +I + F  +C  K+ S PWS+L  +  E  +I +QL  +N   FLTINSQPA+NGE+S  P  GWG P GYV+QK Y+EFF     L+ L +     +S++Y   NK G+L +N      NAVTWGVFP +EIIQPT+V+  SF+ WKDEA+ +    W+  Y     S+ LL  +   ++L  +VDN++ +G ++F VF  +
Sbjct:   15 KVTYSYEFFPPKTSTGVQNLYNRIDRMKTWGRPMFVDVTWGAGGTSSELTPGIVNVIQTDFEVDTCMHLTCTNMSTEMIDAALKRAHETGCRNILALRGDPVKDTD-WTEGESGFRYASDLVRYIRTHYNDEFCIGVAGYPE---------GYSPDDDIDESIKHLKLKVDEGADFIVTQMFYDVDNFIAWVDKVRAAGINIPIFPGIMPIQAWDSFIRRAKWSGVKIPQHFMDTLVPVKDDDEGVRERGVELIVEMCRKLIASGITRLHFYTMNLEKAVKMIIERLGLLDENLAPIVDTNNVELTNASSQDR-----RINEGVRPIFWRTRNESYVSRTDQWDELPHGRWGDSRSPAFGEFDAIRYGL-RMSPKEITTSWGSP-KSYSEIGDLFARYCEKKISSLPWSDL-PISDEADLIRDQLLSMNRNAFLTINSQPALNGEKSSHPVFGWGPPNGYVFQKPYVEFFVHPSLLNELKETVKKLNSVSYFVTNKNGDLDTNSQYEIPNAVTWGVFPNREIIQPTIVESTSFLAWKDEAYSL-GMEWANAYSPDSISRKLLVSMMKEWFLCVIVDNDFQNGQSLFDVFNKM 587          
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Match: MTHR2_YEAST (Methylenetetrahydrofolate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET13 PE=1 SV=2)

HSP 1 Score: 482.641 bits (1241), Expect = 4.938e-160
Identity = 264/598 (44.15%), Postives = 366/598 (61.20%), Query Frame = -1
Query:  222 MKVIEKIQSLQE--GKVVFSFEFFPPKTEDGVDNLFERMDRMV-AHNPSFCDITWGAGGST-ADLTLDIANKMQNIICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRGDPPHGQDKFVQVEGGFSCALDLVKHIRSKYGDYFGITVAGYPEAHPDAIGNDGVATSEAYQNDLAYLKRKVDAGADLIVTQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTKIPAEITAALEAIKDNEEAVKAYGVHLGTEMCRKILAHG-VKTLHLYTLNMEKSALAILMNLGLI-EESKISRS----LPWRRPANVFRVKEDVRPIFWANRPKSYLSRTIGW--DQYPQGRWGDSRNPSYGALSDYQFMRPRARDKKLQEEWATPLKSIDDIQEKFKNHCLGKLRSSPWSELDGLQPETKIIHEQLGKINLKGFLTINSQPAVNGERSDSPSVGWGGPGGYVYQKAYLEFFCSLDKLDVLVKKCNSFSSLTYVAVNKKGNLLSN-IGLTDVNAVTWGVFPAKEIIQPTVVDPASFVVWKDEAFEI---WSRSWSALYPDGDPSKNLLEEIQSSYYLVSLVDNNYM 1967
            MK+ EK++  ++  GK  +SFE+F PKT  GV NL++RMDRM  A  P F DITW AGG   + L+ D+    Q+++ +ET MHLTCTNMP+  ID AL+    +G QN+LALRGDPP   + +  VEGGF  A DL+K+I+SKYGD+F I VAGYPE HP+    D        + DL YLK+K+DAG D I+TQ+FYD D F+ + +  R  G+  PI+PGIMPI  Y  FLR   + +  IP   ++ L+ IKD++E V+  G +L  EMC+K+L  G V  LH+YT+N+EK+ L IL  L ++  ES+ +      LPWR+  N  R  E+VRPIFW  RP SY++RT  W  D++P GR+GDS +P++G L        R    K  E W+TP  SI+D+     N+  G L+  PWS++  +  E   I   L ++N    +TINSQP VNG RS+    GWG   GYVYQK YLEF     KL  L+    +   LTY A++ +G+LLSN    +  NAVTWG+FP +EI+QPT+V+  SF+ WK+E + I   W  + +    D   S   ++ +   Y LV++VDN+Y+
Sbjct:    1 MKITEKLEQHRQTSGKPTYSFEYFVPKTTQGVQNLYDRMDRMYEASLPQFIDITWNAGGGRLSHLSTDLVATAQSVLGLETCMHLTCTNMPISMIDDALENAYHSGCQNILALRGDPPRDAENWTPVEGGFQYAKDLIKYIKSKYGDHFAIGVAGYPECHPELPNKD-------VKLDLEYLKQKIDAGGDFIITQMFYDVDNFINWCSQVRAAGMDVPIIPGIMPITTYAAFLRRAQWGQISIPQHFSSRLDPIKDDDELVRDIGTNLIVEMCQKLLDSGYVSHLHIYTMNLEKAPLMILERLNILPTESEFNAHPLAVLPWRKSLNPKRKNEEVRPIFWKRRPYSYVARTSQWAVDEFPNGRFGDSSSPAFGDLDLCGSDLIRQSANKCLELWSTP-TSINDVAFLVINYLNGNLKCLPWSDI-PINDEINPIKAHLIELNQHSIITINSQPQVNGIRSNDKIHGWGPKDGYVYQKQYLEFMLPKTKLPKLIDTLKNNEFLTYFAIDSQGDLLSNHPDNSKSNAVTWGIFPGREILQPTIVEKISFLAWKEEFYHILNEWKLNMNKY--DKPHSAQFIQSLIDDYCLVNIVDNDYI 587          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NE02_GOSAR0.000e+096.30Methylenetetrahydrofolate reductase OS=Gossypium a... [more]
A0A0D2QEY3_GOSRA0.000e+095.80Methylenetetrahydrofolate reductase OS=Gossypium r... [more]
A0A0B0P0L2_GOSAR0.000e+093.76Methylenetetrahydrofolate reductase OS=Gossypium a... [more]
A0A0D2UUH8_GOSRA0.000e+092.58Methylenetetrahydrofolate reductase OS=Gossypium r... [more]
A0A061ELE3_THECC0.000e+089.48Methylenetetrahydrofolate reductase OS=Theobroma c... [more]
A0A0D2VMP2_GOSRA0.000e+093.65Methylenetetrahydrofolate reductase OS=Gossypium r... [more]
M5W952_PRUPE0.000e+084.87Methylenetetrahydrofolate reductase OS=Prunus pers... [more]
B9HG95_POPTR0.000e+084.21Methylenetetrahydrofolate reductase OS=Populus tri... [more]
V4VQH3_9ROSI0.000e+085.86Methylenetetrahydrofolate reductase OS=Citrus clem... [more]
U5FIP4_POPTR0.000e+084.96Methylenetetrahydrofolate reductase OS=Populus tri... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0001550 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
MTHR2_ARATH0.000e+082.32Methylenetetrahydrofolate reductase 2 OS=Arabidops... [more]
MTHR_ORYSJ0.000e+081.82Probable methylenetetrahydrofolate reductase OS=Or... [more]
MTHR1_ARATH0.000e+080.20Methylenetetrahydrofolate reductase 1 OS=Arabidops... [more]
MTHR1_MAIZE0.000e+081.08Methylenetetrahydrofolate reductase 1 OS=Zea mays ... [more]
MTHR_HUMAN1.257e-17243.11Methylenetetrahydrofolate reductase OS=Homo sapien... [more]
MTHR_MACFA2.747e-17043.02Methylenetetrahydrofolate reductase OS=Macaca fasc... [more]
MTHR_BOVIN6.036e-17042.97Methylenetetrahydrofolate reductase OS=Bos taurus ... [more]
MTHR_MOUSE1.645e-16942.37Methylenetetrahydrofolate reductase OS=Mus musculu... [more]
MTHR1_SCHPO1.507e-16143.41Methylenetetrahydrofolate reductase 1 OS=Schizosac... [more]
MTHR2_YEAST4.938e-16044.15Methylenetetrahydrofolate reductase 2 OS=Saccharom... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003171Methylenetetrahydrofolate reductasePFAMPF02219MTHFRcoord: 8..300
e-value: 9.3E-126
score: 418.8
IPR029041FAD-linked oxidoreductase-likeGENE3D3.20.20.220coord: 8..304
e-value: 1.4E-126
score: 421.1
IPR029041FAD-linked oxidoreductase-likeSUPERFAMILY51730FAD-linked oxidoreductasecoord: 8..301
IPR004621Eukaryotic-type methylenetetrahydrofolate reductaseTIGRFAMTIGR00677TIGR00677coord: 16..304
e-value: 5.7E-152
score: 502.8
IPR0046205,10-methylenetetrahydrofolate reductaseTIGRFAMTIGR00676TIGR00676coord: 17..299
e-value: 1.6E-88
score: 294.6
NoneNo IPR availablePANTHERPTHR21091:SF31METHYLENETETRAHYDROFOLATE REDUCTASEcoord: 177..592
coord: 128..146
NoneNo IPR availablePANTHERPTHR21091METHYLTETRAHYDROFOLATE:HOMOCYSTEINE METHYLTRANSFERASE RELATEDcoord: 177..592
coord: 128..146

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0001550 ID=g.arboreum_cottongen_reftransV1_0001550|Name=g.arboreum_cottongen_reftransV1_0001550|organism=Gossypium arboreum|type=contig|length=2126bp
GCAAAATTTACGATCTCTATCTGAAGATATTAATTCTCTTTATATAGTCA
TTATTACAAATAAAGTTACAATTGAAAATTCAACCAGGAGGAGACTATAA
TAAAGTAGAAAGACAACATAAACATAAAATCATAAGCATAAGTGGAACAC
TGCACTGCAGCATAATAATATCTCAAGTCTCATCTTCAAAGATCTTCAAA
AACACCAAAAATATTACCATCCATGTAATTGTTATCTACCAAGCTCACCA
AATAGTAGCTGCTCTGAATCTCTTCGAGCAAATTCTTGGAAGGATCGCCG
TCCGGGTACAAGGCGGACCATGATCGAGACCAGATTTCAAATGCTTCGTC
CTTCCACACCACAAAACTGGCAGGATCCACCACAGTTGGTTGGATTATTT
CTTTAGCAGGGAAGACTCCCCAAGTTACTGCATTCACATCTGTGAGGCCA
ATGTTTGATAACAAATTCCCCTTTTTGTTGACAGCAACATAGGTCAATGA
TGAAAAGGAATTGCACTTTTTCACTAGTACATCTAATTTATCCAGTGAGC
AGAAAAACTCGAGGTAAGCCTTCTGGTAAACGTACCCTCCTGGGCCACCC
CAACCGACAGATGGAGAATCAGAGCGCTCCCCATTGACGGCTGGTTGGCT
ATTGATGGTAAGGAAGCCCTTCAAATTGATCTTTCCTAGTTGCTCATGTA
TGATCTTTGTCTCTGGCTGAAGACCATCCAACTCGGACCAAGGGCTACTT
CTCAACTTACCCAGACAATGGTTTTTAAATTTCTCTTGAATGTCATCAAT
GCTTTTCAAAGGAGTAGCCCATTCTTCCTGAAGTTTCTTGTCACGTGCAC
GGGGCCTCATGAACTGATAGTCGGATAGTGCACCATACGATGGATTTCGA
GAATCACCCCATCGCCCCTGTGGGTACTGATCCCAACCAATAGTCCTAGA
TAAGTAACTCTTTGGACGGTTAGCCCAAAATATTGGGCGAACATCTTCCT
TAACACGGAAGACATTTGCAGGGCGTCTCCAAGGTAAGGACCTAGAAATT
TTGGACTCTTCAATCAGTCCAAGGTTCATTAGTATAGCTAATGCAGATTT
CTCCATGTTTAATGTATAAAGGTGCAATGTCTTAACCCCATGAGCTAAAA
TCTTGCGGCACATTTCTGTTCCAAGGTGAACTCCATAGGCTTTGACAGCT
TCTTCGTTGTCCTTGATAGCCTCTAAGGCAGCAGTAATCTCAGCTGGTAT
CTTAGTTTTGCAAAAGCCAGTCATTCGCAAGAAACCCTTGTAGTTATTAA
TGGGCATAATACCAGGCACGATGGGACAAGTAATTCCAATTTGGCGACAA
TCATTGACAAATTTGAGAAAGATATCAGTATCATAAAACAGTTGAGTAAC
AATCAGATCAGCTCCTGCATCAACCTTTCTCTTTAAGTAGGCAAGATCAT
TCTGATAAGCTTCAGATGTGGCTACACCGTCATTTCCTATGGCATCGGGA
TGTGCCTCTGGATAACCAGCAACTGTGATGCCAAAGTAGTCACCATATTT
AGATCTGATATGTTTCACCAGATCAAGGGCACAGGAGAAGCCGCCTTCGA
CCTGGACAAACTTATCCTGGCCGTGAGGGGGATCACCTCGGAGGGCGAGA
ACATTCTGAATACCGTTGGACTTGATGGTCTGAAGAGCATGGTCAATCTT
CTCTACGGGCATATTGGTGCAAGTGAGGTGCATCATCGTCTCCACACAGA
TGATATTCTGCATCTTGTTAGCAATGTCGAGGGTGAGATCAGCAGTGGAA
CCACCTGCACCCCATGTAATGTCACAGAAGGACGGGTTATGAGCAACCAT
ACGATCCATTCTCTCGAATAGGTTGTCTACTCCATCCTCAGTCTTTGGAG
GGAAGAACTCAAAGGAAAACACCACTTTCCCTTCTTGCAAAGATTGGATC
TTCTCTATCACCTTCATCTTTAATTGGATCTTGAACTCTCGGTGTCACCA
ACACCAACTTAAATGGGTTTGTGGTTGGTTAAGAGAGAGATGGGAGGTGG
AGGCATTGCAATGGGAGTATTTGCATTTGAGAGAGGAAGGGAACGGATGG
GGGTTGGTGTCTTTTGAAATGACGTT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR003171Mehydrof_redctse
IPR029041FAD-linked_oxidoreductase-like
IPR004621Fadh2_euk
IPR004620MTHF_reductase_bac
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006555methionine metabolic process
GO:0009086methionine biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0004489methylenetetrahydrofolate reductase (NADPH) activity
Vocabulary: Cellular Component
TermDefinition
GO:0005829cytosol