g.arboreum_cottongen_reftransV1_0015644, g.arboreum_cottongen_reftransV1_0015644 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0015644
Unique Nameg.arboreum_cottongen_reftransV1_0015644
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1912
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr10chromosomeg.arboreum_cottongen_reftransV1_0015644:1..1912 .
Chr10:79774079..79776441 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: A0A0B0NC15_GOSAR (Patellin-5-like protein OS=Gossypium arboreum GN=F383_14231 PE=4 SV=1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 585/585 (100.00%), Postives = 585/585 (100.00%), Query Frame = 2
Query:  158 MAQETLDSESAPAAPAQEVSVVVEKPQVTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVETDAPAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDGAKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSEETKEAQVPPPPPEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            MAQETLDSESAPAAPAQEVSVVVEKPQVTEKEPQPSAPAPLPEPEVPEKPAVVAVEEEAVEVEKPKVEEKEETKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFTAKPKAEEKPVAEPEPEPKKEEEENKEEKKEEKEEETPAAEISEEPKVETDAPAAVEVKEEENTPPPPPPADAPAAEVVVVETEVAEKAKAVDDDGAKTVEAIEESVVAVAAPPAEKEKEEPSAEVAPQSEETKEAQVPPPPPEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK
Sbjct:    1 MAQETLDSESAPAAPAQEVSVVVEKPQVTEKEPQPSAPAPLPEPEVPEKPAVVAVEEEAVEVEKPKVEEKEETKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFTAKPKAEEKPVAEPEPEPKKEEEENKEEKKEEKEEETPAAEISEEPKVETDAPAAVEVKEEENTPPPPPPADAPAAEVVVVETEVAEKAKAVDDDGAKTVEAIEESVVAVAAPPAEKEKEEPSAEVAPQSEETKEAQVPPPPPEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 585          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: A0A0D2S9Z3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G288200 PE=4 SV=1)

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 549/585 (93.85%), Postives = 566/585 (96.75%), Query Frame = 2
Query:  158 MAQETLDSESAPAAPAQEVSVVVEKPQVTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVETDAPAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDGAKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSEETKEAQVPPPPPEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            MAQETL+SES PAAPAQE+SVVVEKPQVTEKEPQPSAPAPLPEPEVPEKPAVVAVEEEAVEVEKPKVEEKEETKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFTAKP+AEEKPVAEPEP+ ++EE + ++++++E+E    A       K+ TDAPAAVEVKEEENTPPPPPPA+APAAEVVVVETEVAEKAKAVDDDGAKTVEAIEESVVAVAAPPAEKEKEEPSAEVAPQSEETKEAQVP PPPE+VSIWGIPLLADEKSDVILLKFLRARDFKVKDAF MIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSS DETVISDSFKTGEPGKVVLTIDNQTSK
Sbjct:    1 MAQETLNSESPPAAPAQELSVVVEKPQVTEKEPQPSAPAPLPEPEVPEKPAVVAVEEEAVEVEKPKVEEKEETKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFTAKPEAEEKPVAEPEPKKEEEENKEEKKEEKEEETPAAAISEEP--KIVTDAPAAVEVKEEENTPPPPPPAEAPAAEVVVVETEVAEKAKAVDDDGAKTVEAIEESVVAVAAPPAEKEKEEPSAEVAPQSEETKEAQVPSPPPEEVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFAMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSVDETVISDSFKTGEPGKVVLTIDNQTSK 583          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: A0A0D2UVJ3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G288200 PE=4 SV=1)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 453/495 (91.52%), Postives = 470/495 (94.95%), Query Frame = 2
Query:  428 LPEPQKKALDELKQLIQEALNNHEFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVETDAPAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDGAKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSEETKEAQVPPPPPEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            LPEP+   + E   LIQEALNNHEFTAKP+AEEKPVAEPEP+ ++EE + ++++++E+E    A       K+ TDAPAAVEVKEEENTPPPPPPA+APAAEVVVVETEVAEKAKAVDDDGAKTVEAIEESVVAVAAPPAEKEKEEPSAEVAPQSEETKEAQVP PPPE+VSIWGIPLLADEKSDVILLKFLRARDFKVKDAF MIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSS DETVISDSFKTGEPGKVVLTIDNQTSK
Sbjct:   41 LPEPE---VPEKPALIQEALNNHEFTAKPEAEEKPVAEPEPKKEEEENKEEKKEEKEEETPAAAISEEP--KIVTDAPAAVEVKEEENTPPPPPPAEAPAAEVVVVETEVAEKAKAVDDDGAKTVEAIEESVVAVAAPPAEKEKEEPSAEVAPQSEETKEAQVPSPPPEEVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFAMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSVDETVISDSFKTGEPGKVVLTIDNQTSK 530          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: A0A0D2W5X0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G138100 PE=4 SV=1)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 301/343 (87.76%), Postives = 326/343 (95.04%), Query Frame = 2
Query:  887 QSEET-KEAQVPPPPPEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            QSEE  +EA+VPPP P++VSIWGIPLLADE+SDVILLKFLRARDFKVKDAFTMIKNTV WRKEFG++ LLDE+LGNELEKVVFM GFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDF+P GI+T+VQVNDLKNSPGPGK+ELRQATNQAL+LLQDNYPEFVAKQVFINVPWWYLAFN MISPFLTQRTKSKFV ASPAKS++ LF+YIAPEQVPVQYGGLSR+GEQEF+VADA TEVTIKPA KHSVEFP+TE   +VWE+RVVGW+VNYGAEFVPTAEDGYTVIVSKTRKV  ADETVIS+SFKTGEPGK+VLTIDNQT+K
Sbjct:  234 QSEEKPEEAEVPPPTPQEVSIWGIPLLADERSDVILLKFLRARDFKVKDAFTMIKNTVIWRKEFGVDGLLDEELGNELEKVVFMHGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFSPNGISTIVQVNDLKNSPGPGKRELRQATNQALHLLQDNYPEFVAKQVFINVPWWYLAFNMMISPFLTQRTKSKFVCASPAKSSDILFRYIAPEQVPVQYGGLSRDGEQEFTVADAATEVTIKPATKHSVEFPVTEKSTVVWEVRVVGWDVNYGAEFVPTAEDGYTVIVSKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTK 576          

HSP 2 Score: 82.4185 bits (202), Expect = 3.911e-13
Identity = 39/44 (88.64%), Postives = 42/44 (95.45%), Query Frame = 2
Query:  374 TKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT 505
            TK+T+S SFKEETNIAGELP+PQKKALDELKQLIQEALN HEFT
Sbjct:   59 TKVTESASFKEETNIAGELPDPQKKALDELKQLIQEALNKHEFT 102          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: A0A0D2VDH6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G138100 PE=4 SV=1)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 301/343 (87.76%), Postives = 326/343 (95.04%), Query Frame = 2
Query:  887 QSEET-KEAQVPPPPPEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            QSEE  +EA+VPPP P++VSIWGIPLLADE+SDVILLKFLRARDFKVKDAFTMIKNTV WRKEFG++ LLDE+LGNELEKVVFM GFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDF+P GI+T+VQVNDLKNSPGPGK+ELRQATNQAL+LLQDNYPEFVAKQVFINVPWWYLAFN MISPFLTQRTKSKFV ASPAKS++ LF+YIAPEQVPVQYGGLSR+GEQEF+VADA TEVTIKPA KHSVEFP+TE   +VWE+RVVGW+VNYGAEFVPTAEDGYTVIVSKTRKV  ADETVIS+SFKTGEPGK+VLTIDNQT+K
Sbjct:  216 QSEEKPEEAEVPPPTPQEVSIWGIPLLADERSDVILLKFLRARDFKVKDAFTMIKNTVIWRKEFGVDGLLDEELGNELEKVVFMHGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFSPNGISTIVQVNDLKNSPGPGKRELRQATNQALHLLQDNYPEFVAKQVFINVPWWYLAFNMMISPFLTQRTKSKFVCASPAKSSDILFRYIAPEQVPVQYGGLSRDGEQEFTVADAATEVTIKPATKHSVEFPVTEKSTVVWEVRVVGWDVNYGAEFVPTAEDGYTVIVSKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTK 558          

HSP 2 Score: 82.4185 bits (202), Expect = 3.703e-13
Identity = 39/44 (88.64%), Postives = 42/44 (95.45%), Query Frame = 2
Query:  374 TKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT 505
            TK+T+S SFKEETNIAGELP+PQKKALDELKQLIQEALN HEFT
Sbjct:   59 TKVTESASFKEETNIAGELPDPQKKALDELKQLIQEALNKHEFT 102          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: A0A061FS37_THECC (SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein isoform 1 OS=Theobroma cacao GN=TCM_036500 PE=4 SV=1)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 297/325 (91.38%), Postives = 313/325 (96.31%), Query Frame = 2
Query:  938 VSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            VSIWGIPLLADE+SDVILLKFLRARDFKVKDAFTMIKNT  WRKEFGIE LLDE+LG+ELEKVVFM GFDKEGHPVCYNVYGEFQNKELYQN FADEEKRSKFLRWRIQFLEKSIRKLDF+P+GI T+VQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWY AFN MISPFLTQRTKSKFVFA PAKSAETLF+YIAPEQVPVQYGGLSREGEQEF+VADAVTEVTIKP+ KH+VEFPITE CNLVWELRVVGW+VNYGAEFVP+AEDGYTVIVSKTRKV++ADE VISDSFKTG+PGKVVLT+DNQTSK
Sbjct:  286 VSIWGIPLLADERSDVILLKFLRARDFKVKDAFTMIKNTARWRKEFGIEGLLDEELGHELEKVVFMHGFDKEGHPVCYNVYGEFQNKELYQNAFADEEKRSKFLRWRIQFLEKSIRKLDFSPSGICTIVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYRAFNMMISPFLTQRTKSKFVFAGPAKSAETLFRYIAPEQVPVQYGGLSREGEQEFTVADAVTEVTIKPSTKHTVEFPITEKCNLVWELRVVGWDVNYGAEFVPSAEDGYTVIVSKTRKVTTADEAVISDSFKTGDPGKVVLTVDNQTSK 610          

HSP 2 Score: 77.0258 bits (188), Expect = 2.022e-11
Identity = 38/42 (90.48%), Postives = 39/42 (92.86%), Query Frame = 2
Query:  380 ITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT 505
            ITQSVSFKEETNI GELPE QKKAL+ELKQLIQEALN HEFT
Sbjct:   78 ITQSVSFKEETNIVGELPESQKKALEELKQLIQEALNKHEFT 119          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: A0A0D2U133_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G138100 PE=4 SV=1)

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 301/343 (87.76%), Postives = 327/343 (95.34%), Query Frame = 2
Query:  887 QSEET-KEAQVPPPPPEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            QSEE  +EA+VPPP P++VSIWGIPLLADE+SDVILLKFLRARDFKVKDAFTMIKNTV WRKEFG++ LLDE+LGNELEKVVFM GFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDF+P GI+T+VQVNDLKNSPGPGK+ELRQATNQAL+LLQDNYPEFVAKQVFINVPWWYLAFN MISPFLTQRTKSKFV ASPAKS++ LF+YIAPEQVPVQYGGLSR+GEQEF+VADA TEVTIKPA KHSVEFP+TE+  +VWE+RVVGW+VNYGAEFVPTAEDGYTVIVSKTRKV  ADETVIS+SFKTGEPGK+VLTIDNQT+K
Sbjct:  234 QSEEKPEEAEVPPPTPQEVSIWGIPLLADERSDVILLKFLRARDFKVKDAFTMIKNTVIWRKEFGVDGLLDEELGNELEKVVFMHGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFSPNGISTIVQVNDLKNSPGPGKRELRQATNQALHLLQDNYPEFVAKQVFINVPWWYLAFNMMISPFLTQRTKSKFVCASPAKSSDILFRYIAPEQVPVQYGGLSRDGEQEFTVADAATEVTIKPATKHSVEFPVTEST-VVWEVRVVGWDVNYGAEFVPTAEDGYTVIVSKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTK 575          

HSP 2 Score: 82.4185 bits (202), Expect = 3.769e-13
Identity = 39/44 (88.64%), Postives = 42/44 (95.45%), Query Frame = 2
Query:  374 TKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT 505
            TK+T+S SFKEETNIAGELP+PQKKALDELKQLIQEALN HEFT
Sbjct:   59 TKVTESASFKEETNIAGELPDPQKKALDELKQLIQEALNKHEFT 102          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: A0A061FJ29_THECC (SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein isoform 2 OS=Theobroma cacao GN=TCM_036500 PE=4 SV=1)

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 297/326 (91.10%), Postives = 313/326 (96.01%), Query Frame = 2
Query:  938 VSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITEN-CNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            VSIWGIPLLADE+SDVILLKFLRARDFKVKDAFTMIKNT  WRKEFGIE LLDE+LG+ELEKVVFM GFDKEGHPVCYNVYGEFQNKELYQN FADEEKRSKFLRWRIQFLEKSIRKLDF+P+GI T+VQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWY AFN MISPFLTQRTKSKFVFA PAKSAETLF+YIAPEQVPVQYGGLSREGEQEF+VADAVTEVTIKP+ KH+VEFPITE  CNLVWELRVVGW+VNYGAEFVP+AEDGYTVIVSKTRKV++ADE VISDSFKTG+PGKVVLT+DNQTSK
Sbjct:  286 VSIWGIPLLADERSDVILLKFLRARDFKVKDAFTMIKNTARWRKEFGIEGLLDEELGHELEKVVFMHGFDKEGHPVCYNVYGEFQNKELYQNAFADEEKRSKFLRWRIQFLEKSIRKLDFSPSGICTIVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYRAFNMMISPFLTQRTKSKFVFAGPAKSAETLFRYIAPEQVPVQYGGLSREGEQEFTVADAVTEVTIKPSTKHTVEFPITEQKCNLVWELRVVGWDVNYGAEFVPSAEDGYTVIVSKTRKVTTADEAVISDSFKTGDPGKVVLTVDNQTSK 611          

HSP 2 Score: 77.0258 bits (188), Expect = 2.096e-11
Identity = 38/42 (90.48%), Postives = 39/42 (92.86%), Query Frame = 2
Query:  380 ITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT 505
            ITQSVSFKEETNI GELPE QKKAL+ELKQLIQEALN HEFT
Sbjct:   78 ITQSVSFKEETNIVGELPESQKKALEELKQLIQEALNKHEFT 119          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: A0A0B0MHZ6_GOSAR (Patellin-5-like protein OS=Gossypium arboreum GN=F383_18032 PE=4 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 280/327 (85.63%), Postives = 300/327 (91.74%), Query Frame = 2
Query:  932 EKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            ++VSIWGIPLLADE+SDVILLKFLRARDFKVKDAFTMIKNTV WRKEFG++ LLDE+LGNELEKVVFM GFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDF+P GI+T+VQVNDLKNSPGPGK+ELRQATNQAL+LLQDNYPEFVAKQVFINVPWWYLAFN MISPFLTQRTKS               KYIAPEQVPVQYGGLSR+GEQEF+VADA TEVTIKPA KHSVEFP+TE   +VWE+RVVGW+VNYGAEFVPTAEDGYTVIVSKTRKV  ADETVIS+SFKTGEPGK+VLTIDNQT+K
Sbjct:  195 DEVSIWGIPLLADERSDVILLKFLRARDFKVKDAFTMIKNTVIWRKEFGVDGLLDEELGNELEKVVFMHGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFSPNGISTIVQVNDLKNSPGPGKRELRQATNQALHLLQDNYPEFVAKQVFINVPWWYLAFNMMISPFLTQRTKS---------------KYIAPEQVPVQYGGLSRDGEQEFTVADAATEVTIKPATKHSVEFPVTEKSTVVWEVRVVGWDVNYGAEFVPTAEDGYTVIVSKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTK 506          

HSP 2 Score: 82.0333 bits (201), Expect = 3.797e-13
Identity = 39/44 (88.64%), Postives = 42/44 (95.45%), Query Frame = 2
Query:  374 TKITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT 505
            TK+T+S SFKEETNIAGELP+PQKKALDELKQLIQEALN HEFT
Sbjct:   59 TKVTESASFKEETNIAGELPDPQKKALDELKQLIQEALNKHEFT 102          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Match: B9S732_RICCO (Patellin-3, putative OS=Ricinus communis GN=RCOM_1332620 PE=4 SV=1)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 277/325 (85.23%), Postives = 296/325 (91.08%), Query Frame = 2
Query:  938 VSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            V IWGIP+L DEKSDVILLKFLRARDFKVKDAFTMIKNTV WRKEFGI+ LL+EDLGNELEK VFM GFD EGHPVCYNV+G FQ KELYQN FADEEKR KFLRWRIQFLEKSIRKLDF+P GI T+VQVNDLKNSPGP K+ELRQATNQAL +LQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFA P+KSAETLFKY+A EQVPVQYGGLSREG QEFSV+DAVTEVTIKPA KH+VEF  +E C LVWELRVVGW+V+YGAEFVP+A+DGYTVIVSK RKVS +DE VI D+FK  EPGKVVLTIDNQTSK
Sbjct:  288 VFIWGIPILGDEKSDVILLKFLRARDFKVKDAFTMIKNTVRWRKEFGIDALLEEDLGNELEKAVFMHGFDTEGHPVCYNVFGAFQEKELYQNCFADEEKRVKFLRWRIQFLEKSIRKLDFSPNGICTIVQVNDLKNSPGPAKRELRQATNQALAILQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFAGPSKSAETLFKYVAAEQVPVQYGGLSREGVQEFSVSDAVTEVTIKPATKHTVEFSFSERCLLVWELRVVGWDVSYGAEFVPSADDGYTVIVSKARKVSPSDEPVICDTFKISEPGKVVLTIDNQTSK 612          

HSP 2 Score: 77.411 bits (189), Expect = 1.562e-11
Identity = 37/43 (86.05%), Postives = 39/43 (90.70%), Query Frame = 2
Query:  377 KITQSVSFKEETNIAGELPEPQKKALDELKQLIQEALNNHEFT 505
            KI+QSVSFKEETN+ GELPE QKKALDE KQLIQEALN HEFT
Sbjct:   81 KISQSVSFKEETNVVGELPEAQKKALDEFKQLIQEALNKHEFT 123          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: PATL5_ARATH (Patellin-5 OS=Arabidopsis thaliana GN=PATL5 PE=1 SV=2)

HSP 1 Score: 491.5 bits (1264), Expect = 1.548e-163
Identity = 220/328 (67.07%), Postives = 273/328 (83.23%), Query Frame = 2
Query:  935 KVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLS---REGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTS 1909
            K SIWG+PLL D+++DV+LLKFLRARDFK ++A++M+  T+ WR +F IE LLDE+LG++L+KVVFMQG DKE HPVCYNVYGEFQNK+LYQ TF+DEEKR +FLRWRIQFLEKSIR LDF   G++T+ QVNDLKNSPGPGK ELR AT QAL+LLQDNYPEFV+KQ+FINVPWWYLAF R+ISPF++QR+KSK VFA P++SAETL KYI+PE VPVQYGGLS    E   +F+  D  TE+T+KP  K +VE  + E C +VWE+RVVGWEV+YGAEFVP  ++GYTVI+ K RK+++ +E V+S SFK GE G+++LT+DN TS
Sbjct:  324 KTSIWGVPLLKDDRTDVVLLKFLRARDFKPQEAYSMLNKTLQWRIDFNIEELLDENLGDDLDKVVFMQGQDKENHPVCYNVYGEFQNKDLYQKTFSDEEKRERFLRWRIQFLEKSIRNLDFVAGGVSTICQVNDLKNSPGPGKTELRLATKQALHLLQDNYPEFVSKQIFINVPWWYLAFYRIISPFMSQRSKSKLVFAGPSRSAETLLKYISPEHVPVQYGGLSVDNCECNSDFTHDDIATEITVKPTTKQTVEIIVYEKCTIVWEIRVVGWEVSYGAEFVPENKEGYTVIIQKPRKMTAKNELVVSHSFKVGEVGRILLTVDNPTS 651          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: PATL3_ARATH (Patellin-3 OS=Arabidopsis thaliana GN=PATL3 PE=1 SV=2)

HSP 1 Score: 479.174 bits (1232), Expect = 2.538e-161
Identity = 221/331 (66.77%), Postives = 269/331 (81.27%), Query Frame = 2
Query:  929 PEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLS---REGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            PE+V IWGIPLL D++SDV+LLKFLRAR+FKVKD+F M+KNT+ WRKEF I+ L++EDL ++L+KVVFM G D+EGHPVCYNVYGEFQNKELY  TF+DEEKR  FLR RIQFLE+SIRKLDF+  G++T+ QVND+KNSPG GKKELR AT QA+ LLQDNYPEFV KQ FINVPWWYL F  +I PF+T R+KSK VFA P++SAETLFKYI+PEQVPVQYGGLS    +   +FS+ D+ +E+T+KP  K +VE  I E C LVWE+RV GWEV+Y AEFVP  +D YTV++ K RK+  +DE V++ SFK  E GKV+LT+DN TSK
Sbjct:  147 PEEVKIWGIPLLEDDRSDVVLLKFLRAREFKVKDSFAMLKNTIKWRKEFKIDELVEEDLVDDLDKVVFMHGHDREGHPVCYNVYGEFQNKELYNKTFSDEEKRKHFLRTRIQFLERSIRKLDFSSGGVSTIFQVNDMKNSPGLGKKELRSATKQAVELLQDNYPEFVFKQAFINVPWWYLVFYTVIGPFMTPRSKSKLVFAGPSRSAETLFKYISPEQVPVQYGGLSVDPCDCNPDFSLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVTGWEVSYKAEFVPEEKDAYTVVIQKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSK 477          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: PATL2_ARATH (Patellin-2 OS=Arabidopsis thaliana GN=PATL2 PE=1 SV=2)

HSP 1 Score: 406.757 bits (1044), Expect = 1.367e-130
Identity = 196/330 (59.39%), Postives = 250/330 (75.76%), Query Frame = 2
Query:  929 PEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDL-GNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQ-RTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            PE+VSIWGIPLL DE+SDVILLKFLRARDFKVK+AFTM+KNTV WRKE  I+ L+ EDL G+E EK+VF  G DK+GH V Y+ YGEFQNKE+    F+D+EK SKFL+WRIQF EK +R LDF+P   ++ V V+D +N+PG G++ L Q   +A+   +DNYPEFVAK++FINVPWWY+ + +     +T  RT+SK V + P+KSAET+FKY+APE VPV+YGGLS++    F+V D VTE  +K  +K++++ P TE   L WELRV+G +V+YGA+F P+ E  YTVIVSK RKV   DE VI+DSFK  E GKVV+TIDNQT K
Sbjct:  348 PEEVSIWGIPLLEDERSDVILLKFLRARDFKVKEAFTMLKNTVQWRKENKIDDLVSEDLEGSEFEKLVFTHGVDKQGHVVIYSSYGEFQNKEI----FSDKEKLSKFLKWRIQFQEKCVRSLDFSPEAKSSFVFVSDFRNAPGLGQRALWQFIKRAVKQFEDNYPEFVAKELFINVPWWYIPYYKTFGSIITSPRTRSKMVLSGPSKSAETIFKYVAPEVVPVKYGGLSKDSP--FTVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADVSYGAQFEPSNEASYTVIVSKNRKVGLTDEPVITDSFKASEAGKVVITIDNQTFK 671          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: PATL1_ARATH (Patellin-1 OS=Arabidopsis thaliana GN=PATL1 PE=1 SV=2)

HSP 1 Score: 391.349 bits (1004), Expect = 5.651e-126
Identity = 190/327 (58.10%), Postives = 243/327 (74.31%), Query Frame = 2
Query:  941 SIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDE-DLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDF-NPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQ-RTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            SIWG+PLL DE+SDVIL KFLRARDFKVK+A TM+KNTV WRKE  I+ L++  +  +E EK+VF  G DKEGH V Y+ YGEFQNKEL    F+D+EK +KFL WRIQ  EK +R +DF NP   ++ V V+D +N+PG GK+ L Q   +A+   +DNYPEF AK++FINVPWWY+ + +     +T  RT+SK V A P+KSA+T+FKYIAPEQVPV+YGGLS++        + +TE  +KPAA +++E P +E C L WELRV+G +V+YGA+F PT E  Y VIVSKTRK+ S DE VI+DSFK GEPGK+V+TIDNQTSK
Sbjct:  243 SIWGVPLLQDERSDVILTKFLRARDFKVKEALTMLKNTVQWRKENKIDELVESGEEVSEFEKMVFAHGVDKEGHVVIYSSYGEFQNKEL----FSDKEKLNKFLSWRIQLQEKCVRAIDFSNPEAKSSFVFVSDFRNAPGLGKRALWQFIRRAVKQFEDNYPEFAAKELFINVPWWYIPYYKTFGSIITSPRTRSKMVLAGPSKSADTIFKYIAPEQVPVKYGGLSKDTPL---TEETITEAIVKPAANYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSK 562          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: PATL6_ARATH (Patellin-6 OS=Arabidopsis thaliana GN=PATL6 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 1.189e-112
Identity = 168/327 (51.38%), Postives = 231/327 (70.64%), Query Frame = 2
Query:  944 IWGIPLLA-DEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLG-NELE-KVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFP-ITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            +WG+ LL  D+K+DVILLKFLRARDFKV D+  M++  + WR+EF  E L +EDLG  +LE KV +M+G+DKEGHPVCYN YG F+ KE+Y+  F DEEK +KFLRWR+Q LE+ ++ L F P G+N+++QV DLK+ P   K+ELR A+NQ L+L QDNYPE VA ++FINVPW++     M SPFLTQRTKSKFV +    +AETL+K+I PE +PVQYGGLSR  + +       +E +IK   K +++   I     + W++ V GW++ Y AEFVP AE+ Y ++V K +K+ + DE V  +SF T E GK++L++DN  S+
Sbjct:   69 MWGVSLLGGDDKADVILLKFLRARDFKVADSLRMLEKCLEWREEFKAEKLTEEDLGFKDLEGKVAYMRGYDKEGHPVCYNAYGVFKEKEMYERVFGDEEKLNKFLRWRVQVLERGVKMLHFKPGGVNSIIQVTDLKDMP---KRELRVASNQILSLFQDNYPELVATKIFINVPWYFSVIYSMFSPFLTQRTKSKFVMSKEGNAAETLYKFIRPEDIPVQYGGLSRPTDSQNGPPKPASEFSIKGGEKVNIQIEGIEGGATITWDIVVGGWDLEYSAEFVPNAEESYAIVVEKPKKMKATDEAV-CNSFTTVEAGKLILSVDNTLSR 391          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: PATL4_ARATH (Patellin-4 OS=Arabidopsis thaliana GN=PATL4 PE=1 SV=2)

HSP 1 Score: 349.747 bits (896), Expect = 2.263e-110
Identity = 168/329 (51.06%), Postives = 227/329 (69.00%), Query Frame = 2
Query:  938 VSIWGIPLL---ADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEKVVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVEFPITEN-CNLVWELRVVGWEVNYGAEFVPTAEDGYTVIVSKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSK 1912
            + +WG+PLL     E +DVILLKFLRARDFKV +AF M+K T+ WRK+  I+++L E+ G +L    +M G D+E HPVCYNV+ E    ELYQ T   E+ R KFLRWR Q +EK I+KL+  P G+ +++Q++DLKN+PG  + E+     + +  LQDNYPEFV++ +FINVP+W+ A   ++SPFLTQRTKSKFV A PAK  ETL KYI  +++PVQYGG     + EFS  + V+EV +KP +  ++E P  E    LVW++ V+GWEVNY  EFVPT E  YTVIV K +K+  A+E  I +SFK  + GK+VLT+DN + K
Sbjct:  203 IELWGVPLLPSKGAESTDVILLKFLRARDFKVNEAFEMLKKTLKWRKQNKIDSILGEEFGEDLATAAYMNGVDRESHPVCYNVHSE----ELYQ-TIGSEKNREKFLRWRFQLMEKGIQKLNLKPGGVTSLLQIHDLKNAPGVSRTEIWVGIKKVIETLQDNYPEFVSRNIFINVPFWFYAMRAVLSPFLTQRTKSKFVVARPAKVRETLLKYIPADELPVQYGGFKTVDDTEFS-NETVSEVVVKPGSSETIEIPAPETEGTLVWDIAVLGWEVNYKEEFVPTEEGAYTVIVQKVKKM-GANEGPIRNSFKNSQAGKIVLTVDNVSGK 524          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: SFH5_YARLI (Phosphatidylinositol transfer protein SFH5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SFH5 PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.434e-22
Identity = 69/214 (32.24%), Postives = 109/214 (50.93%), Query Frame = 2
Query:  974 KSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFGIETLLDEDLGNELEK--VVFMQGFDKEGHPVCYNVYGEFQNKELYQNTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTM-VQVNDLKN-SPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPWWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGG 1603
            K D+ILLKFL+ARD+ +     M+ + + WRKEF           ++ +K  V+  +G   E     +N+YG   N+   +  F D      FLRWR+  +E+S+  LDF   G  +M +Q++D KN S      E + A+ + + + Q  YPE + ++ F+NVP         ++ FL++ T +KFV  S  K    L K +    VP +YGG
Sbjct:   57 KRDIILLKFLKARDYDIAQTKDMLTDALKWRKEFDPLDCASAKHDSKFDKLGVITDKGAGGEPQVTNWNLYGAVSNR---KEIFGD---LKGFLRWRVGIMERSLALLDFTKPGAGSMLLQIHDYKNVSFLRLDAETKAASKETIRVFQSYYPETLERKFFVNVPTLMQFVFGFVNKFLSRETVAKFVVYSNGKD---LHKSLG-SWVPAEYGG 260          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: SFH5_PICGU (Phosphatidylinositol transfer protein SFH5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SFH5 PE=3 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 8.208e-22
Identity = 77/270 (28.52%), Postives = 132/270 (48.89%), Query Frame = 2
Query:  893 EETKEAQVPPPPPEKVSIWGIPLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFG-IETLLDEDLGNELEKVVFMQGFDKEG---HPVCYNVYGEFQN-KELYQNTFAD---EEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSP----GPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPW---WYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEV 1657
            EET ++        +++  G+  + DE  + I+LKFL A ++K ++A T + NT  WRK+F  +     E    EL+ +  +  +D      H V +N+YG  ++ K+L+Q    D   E++ S FLRWRI  +E+++  +DF     + + QV+D  N       PG   ++ AT + + +  DNYPE ++ + FINVP    W   F R I   +++ T  KF   +       L  +   + +P  Y G +    +    ++A TE 
Sbjct:   59 EETGDSSYDEIYGYRINKSGLEHVHDEIRNEIVLKFLIAEEYKFEEARTRLINTFKWRKKFQPLSAAYSETFDKELDDLGVITKYDGTNENLHVVTWNLYGNLKSPKKLFQKFGQDDKAEKEGSPFLRWRIGLMERALSLIDFTDKSNSKIAQVHDYNNVSMFRMDPG---MKAATKEIIKIFGDNYPELLSTKFFINVPTIMSWVFTFFRTIG-LVSEDTWKKFQVLNSG----NLATWFGEKNLPKAYNGSNDSTVESLFASEAKTEA 320          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: SFH5_PICST (Phosphatidylinositol transfer protein SFH5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SFH5 PE=3 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 2.544e-21
Identity = 74/250 (29.60%), Postives = 123/250 (49.20%), Query Frame = 2
Query:  986 ILLKFLRARDFKVKDAFTMIKNTVSWRKEFG-IETLLDEDLG---NELEKVVFMQGFDKEG-HPVCYNVYGEFQNKELYQ------NTFADEEKRSKFLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKN-SPGPGKKELRQATNQALNLLQDNYPEFVAKQVFINVP---WWYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAVTEVTIKPAAKHSVE 1690
            ILLKFL A ++ V+ A   + +T++WR +F  +    DE+     N+L  +    G   +  + V +N YG    K+L++       T  ++   S+FLRWRI  +EKS++ +DF     N + QV+D  N S     K +R AT + + +  DNYPE ++ + FINVP    W   F + I   +++ T  KF   +     E    +     +P  YGG S+   +E +VA     + + P  ++ +E
Sbjct:   73 ILLKFLAADEYDVELATKRLIDTLNWRNKFHPLSAAFDENFNKALNDLGAITNFVGLKSDNLNVVTWNFYGATTPKKLFEEYGDNAGTTTNQRPGSQFLRWRIGLMEKSLQLVDFTDPKNNKIAQVHDYNNVSMFKVDKGMRAATKEIIKIFGDNYPELLSTKFFINVPSLMSWVFTFFKTIG-VISEATLKKFQVLNSGNLTE----WFGKSNLPPTYGGDSKSSMKELNVA----SIKLSPYGEYILE 313          
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Match: SFH5_CANAL (Phosphatidylinositol transfer protein SFH5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFH5 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.610e-20
Identity = 69/245 (28.16%), Postives = 120/245 (48.98%), Query Frame = 2
Query:  956 PLLADEKSDVILLKFLRARDFKVKDAFTMIKNTVSWRKEFG-IETLLDEDLGNELEKVVFMQGFDKEGHPVC-YNVYGEFQNKELYQNTFADEEKRSK-----FLRWRIQFLEKSIRKLDFNPTGINTMVQVNDLKNSP----GPGKKELRQATNQALNLLQDNYPEFVAKQVFINVPW---WYLAFNRMISPFLTQRTKSKFVFASPAKSAETLFKYIAPEQVPVQYGGLSREGEQEFSVADAV 1648
            P + +   + ILLKFL A D+ ++ +   + ++++WR EF  +    +E    EL ++  +  F      +  +N+YG  +N +     F    K SK     FLRWR+  +EKS++ +DF  T  N + QV+D  N       PG   +++AT + + +   NYPE ++ + FINVP    W   F + I   +T+ T  KF   +    +E+      P+++P  YGG   +   +  V+D +
Sbjct:   58 PYVDESIRNEILLKFLAADDYNLELSEKRLIDSLNWRNEFQPLSAAFEETFDKELNELGVITNFPNSNLKITTWNLYGNLKNPKKIFEKFGANNKVSKLPGSQFLRWRVGLMEKSLQLIDFTSTTDNRIAQVHDYNNVSMFKIDPG---MKKATKEIITIFGANYPELLSTKFFINVPLIMGWVFTFFKTIR-VITEATLKKFQVLNHGNLSESF----NPDELPKVYGGKVEKSLFDIDVSDDI 294          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NC15_GOSAR0.000e+0100.00Patellin-5-like protein OS=Gossypium arboreum GN=F... [more]
A0A0D2S9Z3_GOSRA0.000e+093.85Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2UVJ3_GOSRA0.000e+091.52Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2W5X0_GOSRA3.911e-1387.76Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2VDH6_GOSRA3.703e-1387.76Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FS37_THECC2.022e-1191.38SEC14 cytosolic factor family protein / phosphogly... [more]
A0A0D2U133_GOSRA3.769e-1387.76Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FJ29_THECC2.096e-1191.10SEC14 cytosolic factor family protein / phosphogly... [more]
A0A0B0MHZ6_GOSAR3.797e-1385.63Patellin-5-like protein OS=Gossypium arboreum GN=F... [more]
B9S732_RICCO1.562e-1185.23Patellin-3, putative OS=Ricinus communis GN=RCOM_1... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0015644 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
PATL5_ARATH1.548e-16367.07Patellin-5 OS=Arabidopsis thaliana GN=PATL5 PE=1 S... [more]
PATL3_ARATH2.538e-16166.77Patellin-3 OS=Arabidopsis thaliana GN=PATL3 PE=1 S... [more]
PATL2_ARATH1.367e-13059.39Patellin-2 OS=Arabidopsis thaliana GN=PATL2 PE=1 S... [more]
PATL1_ARATH5.651e-12658.10Patellin-1 OS=Arabidopsis thaliana GN=PATL1 PE=1 S... [more]
PATL6_ARATH1.189e-11251.38Patellin-6 OS=Arabidopsis thaliana GN=PATL6 PE=2 S... [more]
PATL4_ARATH2.263e-11051.06Patellin-4 OS=Arabidopsis thaliana GN=PATL4 PE=1 S... [more]
SFH5_YARLI1.434e-2232.24Phosphatidylinositol transfer protein SFH5 OS=Yarr... [more]
SFH5_PICGU8.208e-2228.52Phosphatidylinositol transfer protein SFH5 OS=Meye... [more]
SFH5_PICST2.544e-2129.60Phosphatidylinositol transfer protein SFH5 OS=Sche... [more]
SFH5_CANAL3.610e-2028.16Phosphatidylinositol transfer protein SFH5 OS=Cand... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001251CRAL-TRIO lipid binding domainSMARTSM00516sec14_4coord: 318..485
e-value: 1.2E-39
score: 147.8
IPR001251CRAL-TRIO lipid binding domainGENE3D3.40.525.10coord: 89..115
e-value: 9.6E-66
score: 221.1
coord: 273..532
e-value: 9.6E-66
score: 221.1
IPR001251CRAL-TRIO lipid binding domainPFAMPF00650CRAL_TRIOcoord: 322..482
e-value: 9.6E-31
score: 106.5
IPR001251CRAL-TRIO lipid binding domainPROSITEPS50191CRAL_TRIOcoord: 313..488
score: 18.783
IPR001251CRAL-TRIO lipid binding domainSUPERFAMILY52087CRAL/TRIO domaincoord: 323..484
IPR011074CRAL/TRIO, N-terminal domainSMARTSM01100CRAL_TRIO_N_2coord: 274..299
e-value: 4.6E-8
score: 42.8
IPR011074CRAL/TRIO, N-terminal domainPFAMPF03765CRAL_TRIO_Ncoord: 262..298
e-value: 1.2E-9
score: 38.0
IPR011074CRAL/TRIO, N-terminal domainSUPERFAMILY46938CRAL/TRIO N-terminal domaincoord: 273..315
coord: 76..115
NoneNo IPR availablePANTHERPTHR23324:SF67PATELLIN-1-RELATEDcoord: 258..585
NoneNo IPR availablePANTHERPTHR23324SEC14 RELATED PROTEINcoord: 258..585
NoneNo IPR availablePANTHERPTHR23324SEC14 RELATED PROTEINcoord: 10..102
NoneNo IPR availablePANTHERPTHR23324:SF67PATELLIN-1-RELATEDcoord: 10..102
IPR009038GOLD domainPROSITEPS50866GOLDcoord: 490..585
score: 11.86
IPR009038GOLD domainSUPERFAMILY101576Supernatant protein factor (SPF), C-terminal domaincoord: 495..585

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0015644 ID=g.arboreum_cottongen_reftransV1_0015644|Name=g.arboreum_cottongen_reftransV1_0015644|organism=Gossypium arboreum|type=contig|length=1912bp
CGGGGGTCCACTCCTTAACTCACTCCTATTAGATAAGCTAGCTGTCATTC
CACTCTCACACTCTTGTTTCTTCCATTTTTAAGCCCCCTCTTCTTCCTTC
CCCCTCTTCATTCTTCGCCCTTTCTTACGACTTTCATTCTTCCTCTCTTA
CTTACCCATGGCCCAGGAGACTCTTGACTCTGAATCTGCACCTGCTGCCC
CCGCCCAGGAGGTGTCTGTGGTTGTCGAGAAGCCTCAAGTTACTGAGAAA
GAGCCACAACCCTCCGCACCTGCTCCCCTGCCGGAACCTGAGGTGCCCGA
GAAGCCGGCTGTTGTTGCTGTTGAAGAAGAAGCTGTTGAAGTTGAGAAGC
CCAAGGTTGAAGAAAAGGAAGAAACTAAGATAACCCAGTCTGTTTCTTTC
AAAGAGGAAACTAATATCGCAGGTGAACTTCCTGAGCCTCAAAAGAAGGC
CCTTGATGAGCTTAAGCAGCTTATTCAAGAAGCCCTTAACAACCACGAGT
TCACTGCCAAACCCAAAGCAGAAGAAAAACCTGTAGCTGAGCCTGAGCCT
GAGCCAAAGAAAGAAGAAGAAGAAAACAAGGAAGAGAAAAAAGAAGAAAA
AGAGGAAGAGACACCTGCTGCTGAAATTTCAGAAGAACCCAAGGTAGAAA
CGGATGCACCCGCCGCTGTTGAAGTCAAGGAAGAAGAGAATACTCCTCCT
CCACCACCACCAGCCGATGCTCCTGCGGCCGAAGTGGTTGTAGTGGAAAC
AGAGGTAGCTGAAAAAGCGAAAGCCGTAGACGATGATGGCGCCAAGACAG
TGGAGGCGATTGAGGAGTCTGTAGTCGCTGTTGCCGCTCCTCCGGCAGAG
AAAGAAAAGGAGGAGCCCTCCGCCGAAGTGGCTCCTCAATCCGAAGAGAC
CAAAGAAGCCCAAGTTCCTCCACCTCCACCCGAGAAGGTGTCCATATGGG
GGATCCCACTTCTCGCAGACGAGAAAAGCGACGTGATCTTGTTGAAATTC
TTGAGGGCAAGAGATTTCAAGGTGAAGGACGCATTCACTATGATCAAAAA
CACTGTCAGCTGGCGAAAAGAATTCGGAATCGAAACCTTGCTCGATGAAG
ATCTAGGGAACGAACTAGAAAAGGTTGTTTTTATGCAGGGGTTCGATAAA
GAAGGTCATCCCGTCTGTTACAACGTCTATGGAGAATTCCAAAACAAAGA
GCTGTATCAAAACACTTTCGCTGATGAAGAAAAACGATCCAAGTTCTTGA
GATGGAGGATTCAGTTCCTGGAAAAGAGCATCCGAAAACTCGACTTCAAT
CCTACTGGTATCAATACCATGGTTCAAGTGAACGACCTCAAGAATTCACC
TGGACCTGGTAAAAAGGAACTCAGACAAGCTACCAACCAAGCCCTTAACT
TGCTTCAAGATAACTATCCCGAATTTGTGGCCAAACAAGTGTTCATCAAC
GTTCCATGGTGGTACTTGGCTTTCAATAGGATGATCAGTCCTTTCCTGAC
TCAGAGAACCAAGAGCAAGTTCGTATTTGCAAGTCCAGCCAAATCTGCTG
AGACCCTCTTCAAATATATTGCTCCGGAGCAAGTACCAGTTCAATATGGT
GGACTGAGCAGAGAAGGTGAACAAGAATTTAGCGTGGCCGATGCCGTCAC
AGAGGTTACAATCAAGCCAGCAGCGAAGCACAGTGTTGAATTCCCTATAA
CTGAGAATTGTAATCTGGTTTGGGAACTCCGAGTAGTGGGATGGGAAGTC
AATTACGGAGCCGAATTCGTGCCGACCGCCGAAGATGGGTATACCGTGAT
CGTATCGAAAACAAGGAAAGTTTCTTCGGCCGATGAAACCGTGATCTCCG
ATAGCTTCAAGACCGGTGAGCCTGGAAAGGTTGTTCTCACCATTGATAAT
CAAACATCAAAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR001251CRAL-TRIO_dom
IPR011074CRAL/TRIO_N_dom
IPR009038GOLD_dom
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral to membrane
Vocabulary: Biological Process
TermDefinition
GO:0006810transport