g.barbadense_cottongen_reftransV1_0092932, g.barbadense_cottongen_reftransV1_0092932 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092932
Unique Nameg.barbadense_cottongen_reftransV1_0092932
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2813
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: A0A0D2N409_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G005500 PE=4 SV=1)

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 331/337 (98.22%), Postives = 332/337 (98.52%), Query Frame = -2
Query:  323 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARVM 1333
            I D  YFETLQKELAPYDCVLYEMVASRESLENRRNPSAAKRLKSSRSRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVG LIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFC TAVNWISEIASEVAQYADKA+VM
Sbjct:  124 IADTEYFETLQKELAPYDCVLYEMVASRESLENRRNPSAAKRLKSSRSRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGFLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCSTAVNWISEIASEVAQYADKAQVM 460          
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: A0A0B0MIT1_GOSAR (Thermosome subunit gamma OS=Gossypium arboreum GN=F383_06179 PE=4 SV=1)

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 332/337 (98.52%), Postives = 333/337 (98.81%), Query Frame = -2
Query:  323 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARVM 1333
            I D  YFETLQKELAPYDCVLYEMVASRESLENRRNPSAAKRLKSSRSRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQAS YPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITK+DLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARVM
Sbjct:  124 IADTEYFETLQKELAPYDCVLYEMVASRESLENRRNPSAAKRLKSSRSRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASEYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKRDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARVM 460          
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: A0A061GNR8_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_037877 PE=4 SV=1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 305/336 (90.77%), Postives = 319/336 (94.94%), Query Frame = -2
Query:  326 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARV 1333
            I D  YFETLQKELAPYDCVLYEMVASRESLENRRNP+AAKRLKSSRSRGFNILGCIQRQMA IL L+FQLDCLDYQADNW HADLDYETFKLLQLEKGE+FFTFARDMTLKSTKALVQPASIP+DLDPWRSKLLWASRVLPMPLVGLLII GVCAD GSQAS+YPELEALS LDFGAAMKVFLAKRLTSEFTQVTADVEE+SVIIGERNRAA EALRRA++DGH KIAILYGGGHMPDLGRRLREEFDLVPS+V WITAWSITK+DL+S+SLPFLK MAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFC TAVNWISE+ SEVAQY D A+V
Sbjct:  125 IADKEYFETLQKELAPYDCVLYEMVASRESLENRRNPAAAKRLKSSRSRGFNILGCIQRQMAWILKLDFQLDCLDYQADNWCHADLDYETFKLLQLEKGENFFTFARDMTLKSTKALVQPASIPEDLDPWRSKLLWASRVLPMPLVGLLIIGGVCADVGSQASDYPELEALSTLDFGAAMKVFLAKRLTSEFTQVTADVEERSVIIGERNRAAIEALRRAIDDGHIKIAILYGGGHMPDLGRRLREEFDLVPSQVQWITAWSITKRDLESSSLPFLKTMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCSTAVNWISEVVSEVAQYIDNAQV 460          
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: D7TBN6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_11s0016g03910 PE=4 SV=1)

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 287/337 (85.16%), Postives = 311/337 (92.28%), Query Frame = -2
Query:  323 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARVM 1333
            I D  YF TLQKEL PYDCVLYEMVASRESLENRRNP+A KRLKSSRSRGFNILGCIQRQMAR+LML+FQLDCLDYQA+NWYHADLDYETFKLLQ+EKGESFFTFARDMTLKSTKA+V PASIP++L  WRSKLLWASRVLPMPLVGLLII  VCAD G+QAS YPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAA EALRRA+++GHNKIAILYGGGHMPDLGRRLREEFDL+PS+V W+TAWSI  + L+S+SLPFLK MAEVSGWPLNRYQTLAL IFSSVLALDLWFWELF GTAVNW+S + S+V QY + +R+M
Sbjct:  108 IADKEYFATLQKELEPYDCVLYEMVASRESLENRRNPAATKRLKSSRSRGFNILGCIQRQMARVLMLDFQLDCLDYQAENWYHADLDYETFKLLQVEKGESFFTFARDMTLKSTKAMVLPASIPENLGFWRSKLLWASRVLPMPLVGLLIIGSVCADTGTQASEYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAAVEALRRAMDEGHNKIAILYGGGHMPDLGRRLREEFDLIPSQVQWVTAWSIRNRYLKSSSLPFLKAMAEVSGWPLNRYQTLALAIFSSVLALDLWFWELFFGTAVNWVSHLGSQVVQYVENSRLM 444          
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: A0A059CP14_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_C01037 PE=4 SV=1)

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 281/337 (83.38%), Postives = 314/337 (93.18%), Query Frame = -2
Query:  323 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARVM 1333
            I D  YF TLQ+EL PYDCVLYEMVASRESLENRR+P A KRL+SSR+RGFNILGCIQRQMARILML+FQLDCLDYQA+NWYHADLD+ETFKLLQ+EKGESFFTFARDMTL+STKA++QPASIP+DL PWRSKLLWASRVLPMPLVGLLII GVCAD GS AS YPELEALSRLD GAAMKVFLA+RLTSEFTQVTADVEE+SVIIGERN+AA EALRRA++DGH++IAILYGGGHMPDLGRRLREEFDLVPSRV WITAWSI+ ++++++S+PFLK MAEVSGWPLNRYQTLALLIFSSVLA+DLWFWELF GT V+WISE A+E++QY D  +VM
Sbjct:  126 IADKEYFSTLQRELEPYDCVLYEMVASRESLENRRSPVATKRLRSSRARGFNILGCIQRQMARILMLDFQLDCLDYQAENWYHADLDFETFKLLQVEKGESFFTFARDMTLRSTKAMIQPASIPEDLGPWRSKLLWASRVLPMPLVGLLIIGGVCADVGSPASEYPELEALSRLDLGAAMKVFLARRLTSEFTQVTADVEEESVIIGERNKAAIEALRRAIDDGHSRIAILYGGGHMPDLGRRLREEFDLVPSRVQWITAWSISNRNIENSSIPFLKTMAEVSGWPLNRYQTLALLIFSSVLAVDLWFWELFFGTTVSWISETATELSQYIDSLQVM 462          
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: A0A067KPG3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_07245 PE=4 SV=1)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 285/337 (84.57%), Postives = 304/337 (90.21%), Query Frame = -2
Query:  323 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARVM 1333
            I D  YF TLQKELAPYDCVLYEMVASRESLENRRNP+  KRLK SR RGFNILGCIQRQMARILML+FQLDCLDY+A+NWYHADLDYETFKLLQLEKGESFFTFARDMT+KSTKA+VQP +IP+DL PWRSKLLWASRVLPMPLVGL II  VC D GSQAS YPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEE SVIIGERN+AA EAL+RA++DGHNKIAILYGGGHMPDLGRRLREEFDL+PS V WITAWSI  + L+SNSLPFL  MAEV GWPLNRYQTLAL IFSSVLALDLWFWELF GT VNWIS+IASEV +Y   A++M
Sbjct:  130 IADKGYFTTLQKELAPYDCVLYEMVASRESLENRRNPATTKRLKGSRPRGFNILGCIQRQMARILMLDFQLDCLDYEAENWYHADLDYETFKLLQLEKGESFFTFARDMTIKSTKAMVQP-TIPEDLGPWRSKLLWASRVLPMPLVGLFIIGSVC-DVGSQASEYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEGSVIIGERNKAAMEALKRAIDDGHNKIAILYGGGHMPDLGRRLREEFDLIPSEVQWITAWSIRNRALKSNSLPFLTRMAEVLGWPLNRYQTLALFIFSSVLALDLWFWELFFGTTVNWISQIASEVDRYLLTAQIM 464          
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: A0A067EIY5_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g012527mg PE=4 SV=1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 284/332 (85.54%), Postives = 298/332 (89.76%), Query Frame = -2
Query:  338 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYAD 1333
            I D  YFETLQ+EL  YDCVLYEMVASRESLE RRN    K+LK SRSRGFNILGCIQRQMARILML+FQLDCLDYQA+NWYHADLDYETFKLLQLEKGES FTFARDMTLKSTKA+VQP SIP DLDPWRSKLLWASRVLPMPLVGLLII  VCAD GSQ   YPELEALS LDFGAAMKVFLAKRLTSEFTQVTADVEE SVIIGERNRAA EALRRA+++GHN+IAILYGGGHMPDLGRRLREEFDL+PSRV WITAWSI  +DL S+S PFLK MAEV GWPLNRYQTLALLIFSSVLALDLWFWELF GT VNWIS+IASEV QY +
Sbjct:  129 IADKEYFETLQRELELYDCVLYEMVASRESLEKRRNSVDTKKLKGSRSRGFNILGCIQRQMARILMLDFQLDCLDYQAENWYHADLDYETFKLLQLEKGESLFTFARDMTLKSTKAMVQP-SIPKDLDPWRSKLLWASRVLPMPLVGLLIIGSVCADVGSQPPEYPELEALSMLDFGAAMKVFLAKRLTSEFTQVTADVEESSVIIGERNRAAIEALRRAIDEGHNRIAILYGGGHMPDLGRRLREEFDLLPSRVQWITAWSIRNRDLSSSSFPFLKTMAEVLGWPLNRYQTLALLIFSSVLALDLWFWELFFGTTVNWISQIASEVHQYVE 459          
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: I1KIQ7_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 275/337 (81.60%), Postives = 302/337 (89.61%), Query Frame = -2
Query:  323 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARVM 1333
            I D  YF  LQKEL  YDCVLYEMVASRESLENRRN +  KRLKSSR+RGFNILGCIQRQMA IL L+FQLDCL+Y++ NWYHADLDYETFKLLQLEKGESFF+FA+DMTLKSTKA++QPASIP+DLDP RSKLLWASRVLPMPLVGLLII GVC D GSQAS YPE+EALSRLDFGAA+KVFLAKRLTSEFT VTADVEEKSVIIGERNR A EALR A+  GHNKIAILYGGGHMPDLGRRLRE+FDLVPS V WITAWSITK+DL ++S PFLK +A+ SGWPLNRYQTLALLIFSSVLALDLWFWELF GTAVNW+SE+ SE+ QY D ++++
Sbjct:  128 IADEEYFLALQKELESYDCVLYEMVASRESLENRRNATTTKRLKSSRTRGFNILGCIQRQMALILTLDFQLDCLNYESSNWYHADLDYETFKLLQLEKGESFFSFAKDMTLKSTKAVLQPASIPEDLDPLRSKLLWASRVLPMPLVGLLIIGGVCTDVGSQASEYPEIEALSRLDFGAALKVFLAKRLTSEFTLVTADVEEKSVIIGERNRVAIEALRAAMEKGHNKIAILYGGGHMPDLGRRLREDFDLVPSNVQWITAWSITKKDLNTDSFPFLKTIAKASGWPLNRYQTLALLIFSSVLALDLWFWELFFGTAVNWVSELGSELLQYVDNSQMI 464          
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: A0A0B2QKG3_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_018996 PE=4 SV=1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 275/337 (81.60%), Postives = 302/337 (89.61%), Query Frame = -2
Query:  323 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKARVM 1333
            I D  YF  LQKEL  YDCVLYEMVASRESLENRRN +  KRLKSSR+RGFNILGCIQRQMA IL L+FQLDCL+Y++ NWYHADLDYETFKLLQLEKGESFF+FA+DMTLKSTKA++QPASIP+DLDP RSKLLWASRVLPMPLVGLLII GVC D GSQAS YPE+EALSRLDFGAA+KVFLAKRLTSEFT VTADVEEKSVIIGERNR A EALR A+  GHNKIAILYGGGHMPDLGRRLRE+FDLVPS V WITAWSITK+DL ++S PFLK +A+ SGWPLNRYQTLALLIFSSVLALDLWFWELF GTAVNW+SE+ SE+ QY D ++++
Sbjct:  128 IADEEYFLALQKELESYDCVLYEMVASRESLENRRNATTTKRLKSSRTRGFNILGCIQRQMALILTLDFQLDCLNYESSNWYHADLDYETFKLLQLEKGESFFSFAKDMTLKSTKAVLQPASIPEDLDPLRSKLLWASRVLPMPLVGLLIIGGVCTDVGSQASEYPEIEALSRLDFGAALKVFLAKRLTSEFTLVTADVEEKSVIIGERNRVAIEALRAAMEKGHNKIAILYGGGHMPDLGRRLREDFDLVPSNVQWITAWSITKKDLNTDSFPFLKTIAKASGWPLNRYQTLALLIFSSVLALDLWFWELFFGTAVNWVSELGSELLQYVDNSQMI 464          
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Match: I1L4I5_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 274/334 (82.04%), Postives = 301/334 (90.12%), Query Frame = -2
Query:  332 IGDCRYFETLQKELAPYDCVLYEMVASRESLENRRNPXXXXXXXXXXXRGFNILGCIQRQMARILMLNFQLDCLDYQADNWYHADLDYETFKLLQLEKGESFFTFARDMTLKSTKALVQPASIPDDLDPWRSKLLWASRVLPMPLVGLLIISGVCADGGSQASNYPELEALSRLDFGAAMKVFLAKRLTSEFTQVTADVEEKSVIIGERNRAATEALRRAVNDGHNKIAILYGGGHMPDLGRRLREEFDLVPSRVHWITAWSITKQDLQSNSLPFLKMMAEVSGWPLNRYQTLALLIFSSVLALDLWFWELFCGTAVNWISEIASEVAQYADKA 1333
            I D  YF  LQKEL  YDCVLYEMVASRESLENRRN +  KRLKSSR+RGFNILGCIQRQMARIL L+FQLDCL+Y++ NWYHADLDYETFKLLQLEKGESFF+FA+DMTLKSTKA++QPASIP+DLDP RSKLLWASRVLPMPLVGLLII GVC D G+QAS YPE+EALSRLDFGAA+KVFLAKRLTSEFT VTADVEEKSVIIGERNR A EALR A++ GHNKIAILYGGGHMPDLGRRLRE+FDLVPS V WITAWSITK+DL ++S PFLK +A+ SGWPLNRYQTLALLIFSSVLALDLWFWELF GTAVNW+SE+ SE+ +Y D +
Sbjct:  128 IADEEYFLALQKELESYDCVLYEMVASRESLENRRNATNTKRLKSSRTRGFNILGCIQRQMARILTLDFQLDCLNYESSNWYHADLDYETFKLLQLEKGESFFSFAKDMTLKSTKAVLQPASIPEDLDPLRSKLLWASRVLPMPLVGLLIIGGVCTDVGTQASEYPEIEALSRLDFGAALKVFLAKRLTSEFTLVTADVEEKSVIIGERNRVAIEALRAAMDKGHNKIAILYGGGHMPDLGRRLREDFDLVPSNVQWITAWSITKKDLNTDSFPFLKTIAKASGWPLNRYQTLALLIFSSVLALDLWFWELFFGTAVNWVSELGSELLRYVDNS 461          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092932 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2N409_GOSRA0.000e+098.22Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MIT1_GOSAR0.000e+098.52Thermosome subunit gamma OS=Gossypium arboreum GN=... [more]
A0A061GNR8_THECC0.000e+090.77Uncharacterized protein OS=Theobroma cacao GN=TCM_... [more]
D7TBN6_VITVI0.000e+085.16Putative uncharacterized protein OS=Vitis vinifera... [more]
A0A059CP14_EUCGR0.000e+083.38Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]
A0A067KPG3_JATCU0.000e+084.57Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
A0A067EIY5_CITSI0.000e+085.54Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
I1KIQ7_SOYBN0.000e+081.60Uncharacterized protein OS=Glycine max PE=4 SV=1[more]
A0A0B2QKG3_GLYSO0.000e+081.60Uncharacterized protein OS=Glycine soja GN=glysoja... [more]
I1L4I5_SOYBN0.000e+082.04Uncharacterized protein OS=Glycine max PE=4 SV=1[more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR35757FAMILY NOT NAMEDcoord: 1..317

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092932 ID=g.barbadense_cottongen_reftransV1_0092932|Name=g.barbadense_cottongen_reftransV1_0092932|organism=Gossypium barbadense|type=contig|length=2813bp
GAGTAAAAAAAATAACTTACTGATAGTTAGATGAGTACTAAATATAATAT
CAACACAAGCATGCACATAAATTTGCAAAGCGAACCTATTTGATCAATTA
GTTTATTCTTCCACTATGAATGAGTTCAATAAACTTGCTACTTTTACATT
TTTTCTTTTTTCCCTAACATCAGTTATATCCGAAACTCGAAATTCGAAAC
TTGAAACTCGAAACCCGAAACCCGAAACCTGAAACCCGAAGTGTTCATAT
TTACACCGGTACGAATATATATACGTATCCGTGTTGAATGTCAATCGAAA
CAATATATCCAAATAAGGCTCACATCACCCGTGCTTTATCTGCATATTGA
GCAACTTCCGATGCTATTTCAGAGATCCAATTAACCGCGGTGCCGCAAAA
GAGTTCCCAAAACCAGAGATCCAATGCGAGGACCGAGGAAAAGATGAGTA
ATGCCAATGTCTGGTAACGGTTCAATGGCCAGCCGGAAACTTCAGCCATC
ATCTTCAAAAACGGAAGGGAATTGCTCTGGAGATCTTGTTTCGTAATGGA
CCAAGCTGTTATCCAATGTACTCGGGAAGGAACAAGGTCGAATTCCTCTC
TTAAACGCCTACCTAAGTCCGGCATGTGACCACCCCCATAGAGTATTGCT
ATCTTGTTATGACCATCATTGACCGCTCGTCTCAATGCTTCTGTTGCAGC
CCTGTTCCTCTCGCCGATGATAACCGATTTCTCTTCCACATCGGCTGTCA
CTTGAGTGAACTCGGAGGTTAGTCGTTTTGCCAGGAAAACCTTCATGGCG
GCACCAAAATCAAGCCTTGATAAAGCTTCTAGCTCGGGATAATTGGATGC
TTGGCTTCCTCCATCAGCACAAACACCGCTAATAATAAGAAGACCAACGA
GTGGCATAGGTAGCACACGAGAAGCCCATAGAAGCTTGGATCTCCAAGGA
TCAAGGTCATCCGGGATTGAAGCGGGCTGCACTAAAGCTTTCGTTGATTT
AAGGGTCATATCCCTTGCAAATGTAAAGAAACTTTCGCCTTTTTCTAGCT
GAAGTAACTTGAAGGTCTCATAGTCAAGATCTGCGTGGTACCAATTATCA
GCCTGGTAATCGAGACAATCTAATTGGAAATTGAGCATGAGTATCCGAGC
CATCTGCCGTTGAATGCATCCCAGAATGTTGAAACCTCGTGATCGTGAAC
TTTTGAGTCGTTTTGCTGCCGAAGGGTTCCTTCGGTTTTCCAAACTCTCC
CTACTAGCAACCATCTCATACAGAACACAATCATATGGTGCAAGTTCCTT
CTGAAGAGTCTCAAAGTACCTGCAGTCACCAATTTAATCAGGAAAATCCA
TACATAGCAAAGTCGGTACAAGAAAACCGAACATTTTAGCCACACAAGCA
CAAGGAAATTGTCAGAGAGTGAGAACTCAATCCGCTACACTCCGACAAAG
GTTCCGAATGAGATATTAAGAAGACAAAAGTACTCTCATCTTTAACATGT
TCTAATCATTCTTCATGTAGGCACGCAAAACCGAAACCTGAATTATAGAA
CAACACAAACAATTCACAAACCGTACAATCCCAATCACAGAACAATAGCA
ATCCAATTCAGTATGACTAACGATTCAATTATATAAATACAAAAGCTACA
TGCATACATTCAAACCGACGAATCGTATTTCGTTCCTATTAGACTATCCC
TATCGAATAAGGTTTCATATAACCGTTGTGTTCCACTTTCTGTTTGTCGT
ACCGAACCGATCCAATGACAACCCTCCATTCAAAATAAATAATCATGAAA
AATCACGGAAAAATAGAATCCAATTCAGTATGACTAACAATTCGATTATA
TAAACACAAGCTATATGTATAAAATCAAACGATGAATCGTATTTCTTTCC
TCTTAGACTAACCCTATCAAATAAGGTTTCATATAAGTAACTATTTGCAT
TTCAATTTCTGTTCCTCGTACTAAACCAATCCAATGTCAACCCTCCATTC
AAAATACATAATCATGTGTAATCTCATATAAAAATCAAGAAACAATAGCA
ATCCAATTCAATATGACTAGCGATTCGATTATATAAACACAAAAGCTATA
TGTATACATTCAAACCGATGAGTCGTATTTCATTCCTATTAGACTATCCC
TACCGAATAAGGTTTCATATAAGTAACCATTGCGTTCCTCATACCGAACC
GATCCAATGACAACCCTCCATTCAAAATACATAATCAAGAAAATCAATGA
ACAATAGCAATCCAATTCAGTATGACTAACGATTCGATTATATAAACAAA
AAACTATATATATAGATTCAAACCGATGAATCGTATTTTGTTCCTATTAG
ACTATCCCCTACCGAATAAGGTTTCCTATAAACAACCACTCGCATTCCAA
TTTCCGTTCCTCGTACCGAACCGATAAACATATTTAATAATAGTGATTAG
AAAACAATTGTTGAAAGTAACATTGAAATAAACTATAACCAGATAACCAA
AAGCTATATGTATATATAAGTTGTGTTCCGATTTTTGCTCCTCGTACCGA
ACCGATCAGCATTCCTAGTAACATTGAAATAAACTAAAACCAAATAACCA
AGGACTCGATTATATAAACACAAAAGCTATATGTATAAATTCAAACGGAT
GAATCGTATTACGTTCCTAGTAGACTATCCCCTGTCGAATAAGGTGTTAT
ATAAGTTGTGTTCCGATTTTTGCTCCTCGTACCGAACCGATCAGCATTCC
TAGTAACATTGAAATAAACTAAAACCAAATAACCAAGGACTCGATTATAT
AAACACAAAAGCT
back to top