g.barbadense_cottongen_reftransV1_0092930, g.barbadense_cottongen_reftransV1_0092930 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092930
Unique Nameg.barbadense_cottongen_reftransV1_0092930
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2655
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: A0A0B0PMF4_GOSAR (INO80 complex subunit B OS=Gossypium arboreum GN=F383_10249 PE=4 SV=1)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 442/447 (98.88%), Postives = 443/447 (99.11%), Query Frame = -2
Query:  735 MEESGSRFNGANNAVXXXXXXXXXXPDSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEV 2075
            MEE GSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENA V+ANSKRKEFNLNQHVSRISPDIGFE DKSHKRKKQDGGFNAFYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESKVKKVKLKVGGVTRTIHANSTVNGLPGTGSYARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAPGSSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESE 
Sbjct:    1 MEELGSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENAVVNANSKRKEFNLNQHVSRISPDIGFEVDKSHKRKKQDGGFNAFYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESKVKKVKLKVGGVTRTIHANSTVNGLPGTGSYARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAPGSSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEA 447          

HSP 2 Score: 214.157 bits (544), Expect = 0.000e+0
Identity = 116/117 (99.15%), Postives = 116/117 (99.15%), Query Frame = -3
Query:  293 AEAIRKILGQDSSXXXXXXXXXXXXXEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPRIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 643
            AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFP IFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE
Sbjct:  447 AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPSIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 563          
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: A0A0D2PZ24_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G144600 PE=4 SV=1)

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 438/447 (97.99%), Postives = 442/447 (98.88%), Query Frame = -2
Query:  735 MEESGSRFNGANNAVXXXXXXXXXXPDSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEV 2075
            MEESGSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENAGVDA+SKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFN FYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESKVKKVKLKVGGVTRTIHANSTVNGLPGTGS ARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRK+KRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVS +ENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPV+DSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAP SSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESE 
Sbjct:    1 MEESGSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENAGVDASSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNVFYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESKVKKVKLKVGGVTRTIHANSTVNGLPGTGSSARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKNKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSIIENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVTDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAPASSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEA 447          

HSP 2 Score: 118.627 bits (296), Expect = 1.382e-24
Identity = 72/74 (97.30%), Postives = 72/74 (97.30%), Query Frame = -3
Query:  422 AEAIRKILGQDSSXXXXXXXXXXXXXEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPRIFNSKPSSY 643
            AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFP IFNSKPS Y
Sbjct:  447 AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPSIFNSKPSRY 520          
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: A0A0D2QQH9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G144600 PE=4 SV=1)

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 438/447 (97.99%), Postives = 442/447 (98.88%), Query Frame = -2
Query:  735 MEESGSRFNGANNAVXXXXXXXXXXPDSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEV 2075
            MEESGSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENAGVDA+SKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFN FYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESKVKKVKLKVGGVTRTIHANSTVNGLPGTGS ARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRK+KRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVS +ENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPV+DSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAP SSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESE 
Sbjct:    1 MEESGSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENAGVDASSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNVFYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESKVKKVKLKVGGVTRTIHANSTVNGLPGTGSSARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKNKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSIIENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVTDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAPASSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEA 447          

HSP 2 Score: 214.157 bits (544), Expect = 0.000e+0
Identity = 116/117 (99.15%), Postives = 116/117 (99.15%), Query Frame = -3
Query:  293 AEAIRKILGQDSSXXXXXXXXXXXXXEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPRIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 643
            AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFP IFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE
Sbjct:  447 AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPSIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 563          
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: A0A0D2PRG5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G144600 PE=4 SV=1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 438/448 (97.77%), Postives = 442/448 (98.66%), Query Frame = -2
Query:  735 MEESGSRFNGANNAVXXXXXXXXXXPDSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYARKNSLQ-GSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEV 2075
            MEESGSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENAGVDA+SKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFN FYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESKVKKVKLKVGGVTRTIHANSTVNGLPGTGS ARKNSLQ GSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRK+KRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVS +ENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPV+DSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAP SSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESE 
Sbjct:    1 MEESGSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENAGVDASSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNVFYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESKVKKVKLKVGGVTRTIHANSTVNGLPGTGSSARKNSLQVGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKNKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSIIENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVTDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAPASSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEA 448          

HSP 2 Score: 214.157 bits (544), Expect = 0.000e+0
Identity = 116/117 (99.15%), Postives = 116/117 (99.15%), Query Frame = -3
Query:  293 AEAIRKILGQDSSXXXXXXXXXXXXXEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPRIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 643
            AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFP IFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE
Sbjct:  448 AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPSIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 564          
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: A0A0D2LYT2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G144600 PE=4 SV=1)

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 404/447 (90.38%), Postives = 410/447 (91.72%), Query Frame = -2
Query:  735 MEESGSRFNGANNAVXXXXXXXXXXPDSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYARKNSLQGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEV 2075
            MEESGSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENAGVDA+SKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFN FYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESK                               +K  L+GSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRK+KRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVS +ENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPV+DSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAP SSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESE 
Sbjct:    1 MEESGSRFNGANNAVRKKRSSRRPRPDSLSYTESQNHSPLSSTPPSDDVSKVSSDENAGVDASSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNVFYDNEPGRSGSNSKRSSKGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVIDNNESK------------------------------VKKVKLKGSSNDGHSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKNKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSIIENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVTDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQSSKDASSAPASSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEA 417          

HSP 2 Score: 214.157 bits (544), Expect = 0.000e+0
Identity = 116/117 (99.15%), Postives = 116/117 (99.15%), Query Frame = -3
Query:  293 AEAIRKILGQDSSXXXXXXXXXXXXXEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPRIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 643
            AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFP IFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE
Sbjct:  417 AEAIRKILGQDSSRKKREEKIKKRQEEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPSIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 533          
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: A0A061DZ49_THECC (HIT zinc finger,PAPA-1-like conserved region isoform 1 OS=Theobroma cacao GN=TCM_004823 PE=4 SV=1)

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 368/459 (80.17%), Postives = 404/459 (88.02%), Query Frame = -2
Query:  735 MEE-SGSRFNGANNAVXXXXXXXXXXP--DSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEI--------QSSTQEAVIDNNESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYARKNSLQGSSNDGHSPPG-RSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEV 2075
            MEE SG+RF+G NNAVRKKR+    RP  DS S+ ESQ+HSPLSSTPPSDDVSKVSSDENAG DANSKRKEFNLNQ V  ISP +G EG+K++KRKK+DGGFNAFY+NEPGRSGSN+KRSS+GVLAPANWKS++K KEWS  ESR+ +I        QSS Q AVID NESKVKKVKLKVGG+TRTIHANS  NG+PG+GS  RKN+LQGS+++GHSPP  RSGLQGVPWKDFS+GGF  GKE SLMGKTSGKN SGKQGD AG VRKSKR PKRR+LDG+F EDD D+EIRYLE+LKTSKISPAYKEDD E GKKQKKLSRVSN ENFG+S S+KDEKRKHRSDR+S DTDYEEEDEPVSDSELEGKKK+KQRKESV+  ME+KRE+TLTTRQRALQSSKDASSAPGSSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKA RESE 
Sbjct:    1 MEEFSGTRFDGMNNAVRKKRTQTSRRPRPDSQSFAESQDHSPLSSTPPSDDVSKVSSDENAGGDANSKRKEFNLNQCV-WISPAVGVEGEKTNKRKKEDGGFNAFYNNEPGRSGSNNKRSSEGVLAPANWKSTSKAKEWSVSESRNVDIYGGRNGEFQSSVQGAVIDGNESKVKKVKLKVGGITRTIHANSAANGMPGSGSSTRKNNLQGSTDEGHSPPDKRSGLQGVPWKDFSKGGFNFGKEDSLMGKTSGKNISGKQGDQAGLVRKSKRVPKRRVLDGDFGEDDEDEEIRYLERLKTSKISPAYKEDD-ESGKKQKKLSRVSNPENFGSSRSSKDEKRKHRSDRISGDTDYEEEDEPVSDSELEGKKKKKQRKESVDTLMENKREMTLTTRQRALQSSKDASSAPGSSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKAARESEA 457          

HSP 2 Score: 187.963 bits (476), Expect = 0.000e+0
Identity = 101/117 (86.32%), Postives = 109/117 (93.16%), Query Frame = -3
Query:  293 AEAIRKILGQDSSXXXXXXXXXXXXXEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPRIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 643
            AEAIRKILGQDSSRKKREEK+KKRQEE+AQ KA  AEMLASNT+RLVMGP GTTVTFPRD+GFP +F+SKPSSYP PRENCAGPSC NPYKYRDSKSKLPLCSLQCYKAIQ+Q +AE
Sbjct:  457 AEAIRKILGQDSSRKKREEKMKKRQEELAQGKAANAEMLASNTVRLVMGPTGTTVTFPRDMGFPSLFDSKPSSYPPPRENCAGPSCNNPYKYRDSKSKLPLCSLQCYKAIQEQLLAE 573          
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: A0A061DRF0_THECC (HIT zinc finger,PAPA-1-like conserved region isoform 3 OS=Theobroma cacao GN=TCM_004823 PE=4 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 3.283e-162
Identity = 338/432 (78.24%), Postives = 377/432 (87.27%), Query Frame = -2
Query:  819 MEE-SGSRFNGANNAVXXXXXXXXXXP--DSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEI--------QSSTQEAVIDNNESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYARKNSLQGSSNDGHSPPG-RSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQK-EKLS 2075
            MEE SG+RF+G NNAVRKKR+    RP  DS S+ ESQ+HSPLSSTPPSDDVSKVSSDENAG DANSKRKEFNLNQ V  ISP +G EG+K++KRKK+DGGFNAFY+NEPGRSGSN+KRSS+GVLAPANWKS++K KEWS  ESR+ +I        QSS Q AVID NESKVKKVKLKVGG+TRTIHANS  NG+PG+GS  RKN+LQGS+++GHSPP  RSGLQGVPWKDFS+GGF  GKE SLMGKTSGKN SGKQGD AG VRKSKR PKRR+LDG+F EDD D+EIRYLE+LKTSKISPAYKEDD E GKKQKKLSRVSN ENFG+S S+KDEKRKHRSDR+S DTDYEEEDEPVSDSELEGKKK+KQRKESV+  ME+KRE+TLTTRQRALQSSKDASSAPGSSLIEFPNGLPPAPSR++  +KLS
Sbjct:    1 MEEFSGTRFDGMNNAVRKKRTQTSRRPRPDSQSFAESQDHSPLSSTPPSDDVSKVSSDENAGGDANSKRKEFNLNQCV-WISPAVGVEGEKTNKRKKEDGGFNAFYNNEPGRSGSNNKRSSEGVLAPANWKSTSKAKEWSVSESRNVDIYGGRNGEFQSSVQGAVIDGNESKVKKVKLKVGGITRTIHANSAANGMPGSGSSTRKNNLQGSTDEGHSPPDKRSGLQGVPWKDFSKGGFNFGKEDSLMGKTSGKNISGKQGDQAGLVRKSKRVPKRRVLDGDFGEDDEDEEIRYLERLKTSKISPAYKEDD-ESGKKQKKLSRVSNPENFGSSRSSKDEKRKHRSDRISGDTDYEEEDEPVSDSELEGKKKKKQRKESVDTLMENKREMTLTTRQRALQSSKDASSAPGSSLIEFPNGLPPAPSRRRNFQKLS 430          
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: M5W6G0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa003322mg PE=4 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 1.480e-140
Identity = 272/443 (61.40%), Postives = 330/443 (74.49%), Query Frame = -2
Query:  735 DSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEI-------QSSTQEAVIDN--NESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYAR------------KNSLQGSSNDGHSPPGR-SGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEV 1997
            DS  Y E  + S LSS  PSDD SKVSSDENAG DANSKRKE +LN+ ++R+S  +G  G+K HK   +DG FN+FY+NEPGR+G N+KRSS+GVLAPANWKS++  K+    ESR A+          ST+ + +D   NE+KVKKVKLKVGGVTRTI ANS  NG    GS  +            K +L  +S+D HSP  + SGL+G+PWKDFS+ GF LG++   MG+ SGKN SGK+GD +  VRKSKR PKRR+LDGEF +D+ DDEIRYLEKLKTSK++  Y+E+D+E  KK +KLS VSN +N G S   KD K+K R+DR S DTDYEE+++ +SD ELEGKK  KQ+KESV+  M+ K+E+TLTTRQRALQSSKD SS+PGSSLIEFPNGLPPAPSRKQK KLS+VEQQLKKAEAAQRRRMQVEKA RESE 
Sbjct:   31 DSQPYNELHDQSSLSSATPSDDQSKVSSDENAGCDANSKRKECSLNECMARVSSAVG-NGEKPHKNDSKDGEFNSFYNNEPGRNGINNKRSSEGVLAPANWKSTSIMKDGLISESRSADAFDGMNGESPSTRLSGLDGFGNENKVKKVKLKVGGVTRTIQANSAFNGTAEGGSSTKTSRLSDVSRQRQKPNLPENSDDNHSPSDKKSGLKGIPWKDFSRSGFSLGRDNCSMGRISGKNTSGKEGDRSEPVRKSKRVPKRRVLDGEFGDDEEDDEIRYLEKLKTSKVTAGYRENDEESSKKHRKLSAVSNSDNAGASRLGKDLKKKSRTDRASGDTDYEEDEDSLSDGELEGKK--KQKKESVDSLMDGKKEMTLTTRQRALQSSKDVSSSPGSSLIEFPNGLPPAPSRKQKGKLSDVEQQLKKAEAAQRRRMQVEKAARESEA 470          

HSP 2 Score: 157.147 bits (396), Expect = 1.480e-140
Identity = 88/116 (75.86%), Postives = 97/116 (83.62%), Query Frame = -3
Query:  296 AEAIRKILGQDSSXXXXXXXXXXXXXEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPRIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMA 643
            AEAIRKILGQDSSRKKRE+KIKKRQEE+AQEKA     L SN+IR VMGP GT V F  D+G P +F+SKP SYP PRENCAGPSC NPYKYRDSKSKLPLCSL+CYKAIQ++  A
Sbjct:  470 AEAIRKILGQDSSRKKREDKIKKRQEELAQEKAANMLTLPSNSIRYVMGPTGTVVIFSNDMGLPSLFDSKPCSYPPPRENCAGPSCTNPYKYRDSKSKLPLCSLKCYKAIQEKMQA 585          
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: K7KGE4_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 5.237e-136
Identity = 280/467 (59.96%), Postives = 330/467 (70.66%), Query Frame = -2
Query:  735 GSRFNGANNAVXXXXXXXXXXP--DSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEIQSSTQEAVID-----------NNESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYARKNS---------LQGSSNDGHSPPG-RSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLL-DGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEV 2063
            G++F+G +NAVR+KRS    RP  DS   +E Q  SPLSSTP  D     S  EN G DANSKRKEFNLN  VS+ S   G E +KSHK+ K+DGGF+ FY NEP RSGSN+KR S+GVLAPANWK S+K K+  + E R+A++        +             NE++VKKVKLKVGGVTRTI ANS  NG  G+G+  +  S          Q +S+D +SP   RS LQGVPWKDFS+GGF LGKE SLMGK SGKN + K GD +  VRKSKR PKRR+L      +DD DDEIRYLEKLKTSK+S  Y+ D++E  KK +KLS VSN+EN     S KD K++ RSDRV EDTDYE+EDE  SD ELE KKK+KQRKESV+  M+SKRE+TLTTRQRALQ S   +SA  +S+IEFPNGLPPAP RKQKEKLSEV+QQLKKAEAAQRRRMQVEKA RESE 
Sbjct:    6 GTQFDGLSNAVRRKRSQTSRRPRPDSQHASEGQELSPLSSTPSEDAGKASSD-ENVGYDANSKRKEFNLNHCVSQTSSGTGAEDEKSHKKSKKDGGFHTFYSNEPVRSGSNNKRCSEGVLAPANWKGSSKTKDSLDSELRNADLYGGRNPESMSLAQFGGSQDGLGNENRVKKVKLKVGGVTRTIQANSATNGASGSGTTMKSRSSDASRPRQKQQSNSDDNNSPSDKRSRLQGVPWKDFSRGGFGLGKEESLMGKISGKNTTSKLGDKSEPVRKSKRVPKRRVLDGEFGDDDDEDDEIRYLEKLKTSKVSAVYR-DEEELNKKHRKLSSVSNLEN-AAPRSGKDGKKRSRSDRVYEDTDYEDEDESGSDGELEDKKKKKQRKESVDVLMDSKREMTLTTRQRALQ-SSKDASASSASVIEFPNGLPPAPPRKQKEKLSEVDQQLKKAEAAQRRRMQVEKAARESEA 468          

HSP 2 Score: 162.925 bits (411), Expect = 5.237e-136
Identity = 92/117 (78.63%), Postives = 100/117 (85.47%), Query Frame = -3
Query:  293 AEAIRKILGQDSSXXXXXXXXXXXXXEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPRIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 643
            AEAIRKILGQDSSRKKREEKIKKRQEE+AQE+A  A MLASNTIR  MGP GT VTF  ++G P I NSKP SYP PRE CAGPSC NPYKYRDSKSKLPLCSLQCYKA+Q++ +AE
Sbjct:  468 AEAIRKILGQDSSRKKREEKIKKRQEELAQERAANALMLASNTIRYTMGPTGTFVTFSEEMGLPSILNSKPVSYPPPREKCAGPSCTNPYKYRDSKSKLPLCSLQCYKAVQEKVVAE 584          
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Match: W9QMD5_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_009737 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 4.226e-135
Identity = 276/475 (58.11%), Postives = 346/475 (72.84%), Query Frame = -2
Query:  735 MEESG--SRFNGANNAVXXXXXXXXXXP--DSLSYTESQNHSPLXXXXXXXXXXXXXXDENAGVDANSKRKEFNLNQHVSRISPDIGFEGDKSHKRKKQDGGFNAFYDNEPXXXXXXXXXXXXGVLAPANWKSSTKEKEWSELESRDAEI--------QSSTQEAVIDN--NESXXXXXXXXXXXVTRTIHANSTVNGLPGTGSYA-------------RKNSLQGSSNDG-HSPPGRSGLQGVPWKDFSQGGFRLGKEGSLMGKTSGKNASGKQGDHAGTVRKSKRAPKRRLLDGEFSEDDNDDEIRYLEKLKTSKISPAYKEDDDEPGKKQKKLSRVSNVENFGTSSSAKDEKRKHRSDRVSEDTDYEEEDEPVSDSELEGKKKRKQRKESVEPSMESKREITLTTRQRALQXXXXXXXXXXXSLIEFPNGLPPAPSRKQKEKLSEVEQQLKKAEAAQRRRMQVEKANRESEV 2075
            MEE G  +RF+G  N VRKKRS    RP  DS ++ E+ + SP+SSTPPSDDV+K SSDENAG D+NS RKEF+LNQ +S++S   G        R ++DGGFN ++ NEPGRSGSN+KRSS+GVLAPANWK S+  K+  E ESR A++         SS Q  ++D   NE+KVKKVKLKVGGVTRTI ANS  NG+ G    +             +K+S+Q  S++   S   RSGLQG+PWKDFS+ GF + ++ SLMGK SGK++SG++GD +  VRKSKR PKRR+LDG+  +D+ DDEIRYLEKLKTSK++P Y+EDD+EP KK +KLS VSN+E  G S SAKD K+K R DR+S DTDYEE++E         KK++KQRKE+V+  M+ KRE+TLTTRQRALQ S   +S  G+SLIEFPNGLPPAP R+QKEKL++VEQQLKKAEAAQRRR+QVEKANRE+E 
Sbjct:    1 MEEFGVAARFDGIGNTVRKKRSQTCRRPRPDSQTHVENNDESPMSSTPPSDDVNKASSDENAGYDSNSNRKEFSLNQCMSKVSSAAG--------RDRKDGGFNLYHSNEPGRSGSNNKRSSEGVLAPANWKGSSTGKDGVESESRGADVLSGRNGESSSSRQSVMLDGFGNENKVKKVKLKVGGVTRTIQANSASNGMSGGTGSSSKSSRASDASRPRQKHSIQADSDEYISSSDKRSGLQGIPWKDFSRAGFSIRRDDSLMGKASGKSSSGREGDKSEPVRKSKRVPKRRVLDGD-FDDEEDDEIRYLEKLKTSKVAPGYREDDEEPSKKHRKLSVVSNIEIGGPSRSAKDGKKKLRLDRLSGDTDYEEDEESSDGEIDGKKKRKKQRKETVDSLMDGKREMTLTTRQRALQ-SSKDASTSGTSLIEFPNGLPPAPPRRQKEKLTDVEQQLKKAEAAQRRRLQVEKANRETEA 465          

HSP 2 Score: 177.948 bits (450), Expect = 4.226e-135
Identity = 97/117 (82.91%), Postives = 105/117 (89.74%), Query Frame = -3
Query:  293 AEAIRKILGQDSSXXXXXXXXXXXXXEMAQEKAVKAEMLASNTIRLVMGPAGTTVTFPRDLGFPRIFNSKPSSYPAPRENCAGPSCGNPYKYRDSKSKLPLCSLQCYKAIQKQQMAE 643
            AEAIRKILGQDSSRKKRE+KIKKRQEE+AQEKA  A +LASNTIR VMGP GT VTFP ++GFP IFNSKPSSYP PRENCAGP C NPYKYRDSKSKLPLCSLQCYKAIQ++ +AE
Sbjct:  465 AEAIRKILGQDSSRKKREDKIKKRQEELAQEKAANALLLASNTIRWVMGPTGTVVTFPNEMGFPSIFNSKPSSYPPPRENCAGPLCSNPYKYRDSKSKLPLCSLQCYKAIQEKMLAE 581          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092930 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PMF4_GOSAR0.000e+098.88INO80 complex subunit B OS=Gossypium arboreum GN=F... [more]
A0A0D2PZ24_GOSRA1.382e-2497.99Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QQH9_GOSRA0.000e+097.99Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PRG5_GOSRA0.000e+097.77Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2LYT2_GOSRA0.000e+090.38Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061DZ49_THECC0.000e+080.17HIT zinc finger,PAPA-1-like conserved region isofo... [more]
A0A061DRF0_THECC3.283e-16278.24HIT zinc finger,PAPA-1-like conserved region isofo... [more]
M5W6G0_PRUPE1.480e-14061.40Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
K7KGE4_SOYBN5.237e-13659.96Uncharacterized protein OS=Glycine max PE=4 SV=1[more]
W9QMD5_9ROSA4.226e-13558.11Uncharacterized protein OS=Morus notabilis GN=L484... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 418..448
NoneNo IPR availablePANTHERPTHR21561:SF15SUBFAMILY NOT NAMEDcoord: 9..453
IPR006880INO80 complex subunit B-like conserved regionPFAMPF04795PAPA-1coord: 429..453
e-value: 8.5E-5
score: 23.1
IPR029523INO80 complex, subunit Ies2PANTHERPTHR21561FAMILY NOT NAMEDcoord: 9..453

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092930 ID=g.barbadense_cottongen_reftransV1_0092930|Name=g.barbadense_cottongen_reftransV1_0092930|organism=Gossypium barbadense|type=contig|length=2655bp
GTGGGACTGAATATTGCTTTATAGCTTAAAATTATTAAGCCAAGAAAGAA
AGAATTGTAGCCTCTCTGGATTGGAATGGAGAGGAATTCTTTTATTTATG
GATTATACTAAAATAAACACAACTAAGATTTTCTTGTACCTGTAATAATT
ACATTAATATTACTCCAAAAAGAAGTTTGCATTTGGCTCTATTTTCTAAT
CCGTCCCTGGGTTGAAATGGAACATAAATGTGCAGAATTTACCACATGCA
CAAGAGGGAAGTGCTGGATTTTCAGCAACACTAGCAGGTAGTTTCAGCCA
TCTGCTGTTTTTGAATTGCCTTGTAGCACTGCAGACTACAAAGAGGTAGC
TTCGACTTTGAATCTCGATATTTGTATGGGTTACCACACGATGGACCCGC
ACAGTTCTCTCGAGGAGCAGGGTAACTAGAGGGTTTGGAGTTAAATATAC
GAGGGAAACCCAAATCCCTGGGAAATGTTACTGTTGTTCCTGCAGGACCC
ATGACCAATCTGATGGTATTTGATGCAAGCATCTCCGCTTTAACAGCCTT
CTCCTGTGCCATCTCTTCCTGACGCTTTTTGATTTTTTCTTCCCGCTTCT
TCCTGCTAGAGTCTTGGCCAAGTATTTTTCTAATAGCCTCAGCCTACATC
AATTAATTCAAACACACTCAATTTTTGCATTGTAGTTCTAAAATCCATAT
GCAAAGACATTGTAATCCCGAAGCAACAGAAACAAACCTCAGATTCCCTA
TTGGCCTTCTCAACTTGCATCCTTCGTCTCTGAGCAGCCTCTGCCTTCTT
TAGCTGCTGCTCCACTTCCGAGAGTTTCTCCTTTTGCTTTCTTGATGGGG
CAGGTGGTAGACCATTTGGAAACTCGATTAAGCTTGAGCCAGGCGCAGAA
GAGGCATCTTTGCTAGACTGAAGAGCCCGTTGACGTGTTGTGAGAGTTAT
TTCCCTCTTACTCTCCATTGATGGCTCAACAGATTCTTTCCTTTGCTTCC
TTTTCTTCTTACCTTCAAGCTCACTATCAGATACTGGTTCATCTTCCTCC
TCATAATCGGTATCCTCAGAAACCCTATCTGATCTATGCTTCCTTTTCTC
ATCTTTGGCAGAACTTGAAGTGCCAAAGTTTTCTACGTTGGAAACCCTGG
AGAGTTTTTTCTGTTTCTTGCCTGGTTCATCATCATCTTCCTTATATGCT
GGACTAATCTTCGAAGTTTTAAGTTTTTCCAAGTAACGGATCTCATCATC
ATTGTCATCTTCACTGAATTCCCCATCAAGTAGACGTCTCTTAGGGGCCC
GCTTGCTTTTACGAACCGTGCCGGCATGGTCTCCTTGTTTACCAGAGGCA
TTCTTTCCAGATGTCTTTCCCATCAAAGAACCCTCCTTCCCAAGTCTAAA
ACCACCTTGGGAGAAATCTTTCCAGGGTACACCTTGCAAACCACTCCTAC
CTGGAGGTGAGTGCCCATCATTGCTACTTCCCTGGAGACTGTTCTTCCTT
GCATAGGACCCAGTCCCTGGCAATCCATTAACTGTTGAGTTTGCATGAAT
TGTGCGCGTAACTCCACCAACCTTGAGCTTAACCTTTTTAACCTTGCTTT
CATTATTATCAATAACAGCTTCTTGTGTTGAACTCTGAATCTCCGCATCT
CTTGACTCTAATTCCGACCACTCTTTCTCCTTGGTACTGCTTTTCCAATT
AGCAGGGGCAAGTACACCCTTGCTAGAACGCTTACTATTTGACCCGCTTC
GCCCGGGCTCATTGTCGTAAAATGCATTGAACCCTCCATCTTGTTTCTTT
CTTTTATGGGATTTGTCACCTTCAAAACCAATGTCAGGAGAAATCCTAGA
AACGTGTTGATTAAGATTAAATTCTTTCCGCTTTGAATTAGCATCGACAC
CGGCATTCTCATCACTGGAGACTTTGCTCACATCATCCGAAGGTGGTGTC
GATGACAATGGAGAGTGATTCTGGCTTTCAGTATAAGACAGCGAATCAGG
ACGAGGCCGACGAGAACTCCTCTTCTTCCTCACAGCATTATTTGCGCCGT
TAAACCGACTACCCGACTCTTCCATGGTGGTAAATAACTTTACCAGAAGG
ATAATCTAGCAAGACCGCTAATCCTTCTTGAGCTAACCGTACAGAAGAAA
CCGAGGAAATCAGGGAAGAGAAAAGAAGAGAGAAGAAGAGGAAAGAGAGA
AGGAGAAGGCGGAAGGTAAAATAGATTAGGTGGGAATGTGAAAAAGAATA
AAAGGATTTTCGTAGAGAAGGGGAAAAGAAAGAAAGGGAAGAGATGGGAA
TGGAAGGGTTAAAAAGAAAAAGAGGTTTTAGGGTTAGAGAAGGATAGGCA
GATGTTGTTATAGTAACAATTATCTGCTGGTTCACCATTATTTTGCTATT
GCCACACCACCCCTGTGTTTTCCTTTTTATCGTTTGGGTGTGGGCTGGAA
CTTGGAAGGGTGGGTTTTGAGATTGATTTTTTTGGATATTTGACTCGGTC
ACTCGACTCGCCGAACCGACTCAGCCCCCTTCCCCTCTCTTTCTCGCGCT
TTTCTTTTTTCTTTCATTCCGTTCGTCCTTCTTCGTTTCTTAGTCTTAAC
GATTTTAATTTTTTTTTTACACGGTTTACGCTGCAAGAGCGTGCGTAGGT
TAAAT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR006880INO80B_C
IPR029523INO80B/Ies2
Vocabulary: Cellular Component
TermDefinition
GO:0031011Ino80 complex
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-dependent
GO:0006338chromatin remodeling