g.barbadense_cottongen_reftransV1_0092929, g.barbadense_cottongen_reftransV1_0092929 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092929
Unique Nameg.barbadense_cottongen_reftransV1_0092929
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length1921
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: DTX1_ARATH (MATE efflux family protein DTX1 OS=Arabidopsis thaliana GN=DTX1 PE=2 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 4.388e-129
Identity = 202/442 (45.70%), Postives = 287/442 (64.93%), Query Frame = -2
Query:  352 EVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERV 1677
            E+K+   LA P+  V++ QY + ++SVM+ GH GEL L+G ++  SF +VTGFS++ G+  AL+TLCGQ+YGAKQY  +G +   A+   + +   ++ +W+    IL+  GQD EIS  AG YA +++P+LF   ++  L +FL TQ +V P++  +  T   H+L+CW +VF  GLG  G A+A S+S WF  ++L  YV+ S SC KT    S++   +I  F +  IPSA M+CLE W FE+++L SGLLPNPKL+TS LSICL      ++I  G++ AVSTRVSN LGAGNP+ AR++V   + + I E+     +L   RNI+GYA+SN  EV+ YVA L PL+  S +LD    VL+G ARG GWQ IGA+ N  SYY+VG P  + LAF   + GKGLW G++    VQ T L+IVT   NW+++A KA +R+
Sbjct:   27 ELKRVSRLAAPMATVTIAQYLLPVISVMVAGHNGELQLSGVALANSFTNVTGFSIMCGLVGALETLCGQAYGAKQYEKIGTYAYSAIASNIPICFLISILWLYIEKILISLGQDPEISRIAGSYAFWLIPALFGQAIVIPLSRFLLTQGLVIPLLFTAVTTLLFHVLVCWTLVFLFGLGCNGPAMATSVSFWFYAVILSCYVRFSSSCEKTRGFVSRDFVSSIKQFFQYGIPSAAMICLEWWLFEILILCSGLLPNPKLETSVLSICLTIETLHYVISAGVAAAVSTRVSNNLGAGNPQVARVSVLAGLCLWIVESAFFSILLFTCRNIIGYAFSNSKEVLDYVADLTPLLCLSFILDGFTAVLNGVARGSGWQHIGAWNNTVSYYLVGAPVGIYLAFSRELNGKGLWCGVVVGSTVQATILAIVTASINWKEQAEKARKRI 468          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: MATE7_ARATH (MATE efflux family protein 7 OS=Arabidopsis thaliana GN=DTXL3 PE=2 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 2.635e-128
Identity = 200/442 (45.25%), Postives = 290/442 (65.61%), Query Frame = -2
Query:  352 EVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERV 1677
            E+KK   LA P+  V++ QY + ++SVM+ GH GEL LAG ++ TSF +V+GFS++ G+  AL+TLCGQ+YGA+QY  +G +   AM   + +   ++ +WI    +L+  GQ+ +IS  AG Y+ ++VP+LFA+ +   L +FL  Q +V  ++  +  T   HI +CW +VF  GLG  GAA+A S+S WF  ++L  +V+   SC KT    S +   +I  + +  +PSA ++CLE W FE+++L SGLLPNPKL+TS LSICL      ++IP G++ AVSTRVSN+LGAGNP+ AR++V   + + + E+    ++L   RNI+GY +SN  EVV YVA + PL+  S +LD L  VL+G ARGCGWQ IGA IN+ +YY+VG P  V LAF     GKGLW G++   AVQ T L+IVT   NW+++A KA +R+
Sbjct:   27 ELKKVSRLAAPMATVTIAQYLLPVISVMVAGHIGELELAGVALATSFTNVSGFSIMFGLVGALETLCGQAYGAEQYEKIGTYTYSAMASNIPICFIISILWIYIEKLLITLGQEPDISRVAGSYSLWLVPALFAHAIFLPLTRFLLAQGLVISLLYSAMTTLLFHIAVCWTLVFALGLGSNGAAIAISLSFWFYAVILSCHVRFFSSCEKTRGFVSNDFMSSIKQYFQYGVPSAGLICLEWWLFELLILCSGLLPNPKLETSVLSICLTIGTLHYVIPSGVAAAVSTRVSNKLGAGNPQVARVSVLAGLCLWLVESAFFSTLLFTCRNIIGYTFSNSKEVVDYVADISPLLCLSFILDGLTAVLNGVARGCGWQHIGALINVVAYYLVGAPVGVYLAFSREWNGKGLWCGVMVGSAVQATLLAIVTASMNWKEQAEKARKRI 468          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: MATE5_ARATH (MATE efflux family protein 5 OS=Arabidopsis thaliana GN=DTXL1 PE=3 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 1.799e-127
Identity = 207/442 (46.83%), Postives = 290/442 (65.61%), Query Frame = -2
Query:  352 EVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERV 1677
            E+KK   LA P+  V++ QY + ++SVM+ GH GEL L+G ++ TSF +V+GFS+L G+A AL+TLCGQ+YGAKQY  +G +   A    + + + ++ +WI    +L+  GQD +IS  AG YA +++P+LFA+     L +FL  Q +V P++ C+  T   HI +CW  V+  GLG  GAA+A S+S WF V++L  YV+ S SC KT    S +    I  F    +PSA MVCLE W FE+++L SGLLPNPKL+TS LSICL TA+  ++IP G++ AVSTRVSN+LGAG P+ AR++V   + + + E+    ++L   RNI+GYA+SN  EVV YVA L PL+  S +LD    VL+G ARG GWQ IGA  N+ +YY+VG P  V LAF   + GKGLW G++   AVQ   L+ VT   NW+++A KA +R+
Sbjct:   27 ELKKVSSLAAPMAAVTIAQYLLPVISVMVAGHNGELQLSGVALATSFTNVSGFSILFGLAGALETLCGQAYGAKQYEKIGTYTYSATASNIPICVLISVLWIYIEKLLISLGQDPDISRVAGSYALWLIPALFAHAFFIPLTRFLLAQGLVLPLLYCTLTTLLFHIPVCWAFVYAFGLGSNGAAMAISVSFWFYVVILSCYVRYSSSCDKTRVFVSSDFVSCIKQFFHFGVPSAAMVCLEWWLFELLILCSGLLPNPKLETSVLSICLTTASLHYVIPGGVAAAVSTRVSNKLGAGIPQVARVSVLAGLCLWLVESAFFSTLLFTCRNIIGYAFSNSKEVVDYVANLTPLLCLSFILDGFTAVLNGVARGSGWQHIGALNNVVAYYLVGAPVGVYLAFNRELNGKGLWCGVVVGSAVQAIILAFVTASINWKEQAEKARKRM 468          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: MATE6_ARATH (MATE efflux family protein 6 OS=Arabidopsis thaliana GN=DTXL2 PE=3 SV=2)

HSP 1 Score: 391.734 bits (1005), Expect = 2.378e-127
Identity = 201/442 (45.48%), Postives = 290/442 (65.61%), Query Frame = -2
Query:  352 EVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERV 1677
            E+KK   LA P+  V++ QY + ++SVM+ GH GEL L+G ++ TSF +V+GFS++ G+  +L+TL GQ+YGAKQY  +G +   A+   + + + ++ +WI    +L+  GQD +IS  AG YA  ++P+LFA+ ++  L +FL  Q +V P++  +  T   HI +CW +V   GLG  GAALA S+S WF  + L  YV+ S SC KT    S++   ++  F R  +PSA M+CLE W FE+++L SGLL NPKL+TS LSICL TA   ++IP G++ AVSTRVSN+LGAG P+ AR++V   + + + E+     +L   RNI+GYA+SN  EVV YVA L PL+  S +LD    VL+G ARGCGWQ IGA  N+ +YY+VG P  + LAF   + GKGLW G++   AVQ   L+IVT   NW+++A+KA +R+
Sbjct:   27 ELKKVSRLAVPMATVTIAQYLLPVISVMVAGHNGELQLSGVALATSFTNVSGFSIMFGLVGSLETLSGQAYGAKQYEKMGTYTYSAISSNIPICVLISILWIYMEKLLISLGQDPDISRVAGSYALRLIPTLFAHAIVLPLTRFLLAQGLVLPLLYFALTTLLFHIAVCWTLVSALGLGSNGAALAISVSFWFFAMTLSCYVRFSSSCEKTRRFVSQDFLSSVKQFFRYGVPSAAMLCLEWWLFELLILCSGLLQNPKLETSVLSICLTTATLHYVIPVGVAAAVSTRVSNKLGAGIPQVARVSVLAGLCLWLVESSFFSILLFAFRNIIGYAFSNSKEVVDYVADLSPLLCLSFVLDGFTAVLNGVARGCGWQHIGALNNVVAYYLVGAPVGIYLAFSCELNGKGLWCGVVVGSAVQAIILAIVTASMNWKEQAKKARKRL 468          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: MATE9_ARATH (MATE efflux family protein 9 OS=Arabidopsis thaliana GN=DTXL5 PE=2 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 5.434e-125
Identity = 200/448 (44.64%), Postives = 287/448 (64.06%), Query Frame = -2
Query:  352 RKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERV 1695
            R     E+K    +A P+  V++ QY + ++SVM+ GH  EL L+G ++ TSF +V+GFS++ G+A AL+TLCGQ+YGAKQY+ +G +   A++  V + + ++ +W     + +  GQD +IS  AG YA  ++P+L A  + Q L +FLQTQ +V P++ C+  T   HI +C ++V+  GLG  GAALA  +S WFNVL+L LYV+ S SC KT    S +   ++  F +  IPSA M  +E   FE ++L SGLLPNPKL+TS LSICL T++  ++IP G+  A S RVSNELGAGNPE ARLAV   I +   EA +  ++L + R+I GYA+SN  EVV YV  L PL+  S L+D    VL G ARG GWQ IGA+ N+ +YY++G P  + L F  ++ GKGLW+G++     Q   L+IVT   +W ++A KA +R+
Sbjct:   24 RMNFTAELKNLSRMALPMATVTVAQYLLPVISVMVAGHRSELQLSGVALATSFTNVSGFSVMFGLAGALETLCGQAYGAKQYAKIGTYTFSAIVSNVPIVVLISILWFYMDKLFVSLGQDPDISKVAGSYAVCLIPALLAQAVQQPLTRFLQTQGLVLPLLYCAITTLLFHIPVCLILVYAFGLGSNGAALAIGLSYWFNVLILALYVRFSSSCEKTRGFVSDDFVLSVKQFFQYGIPSAAMTTIEWSLFEFLILSSGLLPNPKLETSVLSICLTTSSLHYVIPMGIGAAGSIRVSNELGAGNPEVARLAVFAGIFLWFLEATICSTLLFICRDIFGYAFSNSKEVVDYVTELSPLLCISFLVDGFSAVLGGVARGSGWQHIGAWANVVAYYLLGAPVGLFLGFWCHMNGKGLWIGVVVGSTAQGIILAIVTACMSWNEQAAKARQRI 471          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: MATE8_ARATH (MATE efflux family protein 8 OS=Arabidopsis thaliana GN=DTXL4 PE=3 SV=2)

HSP 1 Score: 383.259 bits (983), Expect = 4.421e-124
Identity = 198/442 (44.80%), Postives = 285/442 (64.48%), Query Frame = -2
Query:  352 EVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERV 1677
            E+K    +A P+  V++ QY + ++SVM+ GH GEL L+G ++ T+FA+V+GF ++ G+  AL+TLCGQ+YGAKQY+ +G +   A++  V + + ++ +W     + +  GQD +IS  AG YA  ++P+L A  + Q L +FLQTQ +V P++ C+  T   HI +C ++V+  GLG  GAALA  +S WFNVL+L LYV+ S +C KT    S +   ++  F +  IPSA M  +E   FE+++L SGLLPNPKL+TS LSICL T++   +IP G+  A STR+SNELGAGNPE ARLAV   I +   EA +  ++L   +NI GYA+SN  EVV YV  L  L+  S ++D    VL G ARG GWQ IGA+ N+ +YY++G P    L F  ++ GKGLW+G+I     Q   L+IVT   +WE++A KA ER+
Sbjct:   30 ELKNVSSMAAPMATVTVSQYLLPVISVMVAGHCGELQLSGVTLATAFANVSGFGIMYGLVGALETLCGQAYGAKQYTKIGTYTFSAIVSNVPIVVLISILWFYMDKLFVSLGQDPDISKVAGSYAVCLIPALLAQAVQQPLTRFLQTQGLVLPLLYCAITTLLFHIPVCLILVYAFGLGSNGAALAIGLSYWFNVLILALYVRFSSACEKTRGFVSDDFVLSVKQFFQYGIPSAAMTTIEWSLFELLILSSGLLPNPKLETSVLSICLTTSSLHCVIPMGIGAAGSTRISNELGAGNPEVARLAVFAGIFLWFLEATICSTLLFTCKNIFGYAFSNSKEVVDYVTELSSLLCLSFMVDGFSSVLDGVARGSGWQNIGAWANVVAYYLLGAPVGFFLGFWGHMNGKGLWIGVIVGSTAQGIILAIVTACLSWEEQAAKARERI 471          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: LAL5_ARATH (MATE efflux family protein LAL5 OS=Arabidopsis thaliana GN=LAL5 PE=2 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 9.502e-115
Identity = 193/461 (41.87%), Postives = 288/461 (62.47%), Query Frame = -2
Query:  379 ENDDFTLHQAVSSNGINEVRRKKIWD--EVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQ 1755
              DD   H        +    +K+ D  E K Q+  + P+I  +LF YCI + SVM     G+L LAGA++  S+A+VTGF+ + G++ AL+TLCGQ +GAK Y MLGIH+Q + ++ ++ +I +  +W  T  + L   QD  IS  A  Y  ++ P L AYG LQ +++F QTQ IV P+++ S +   ++I   + +V  +GLGF GA +A SIS W   + L  YV  S    +TWTGFS E+FH++   L L+IPSA MVCLE W+FE++V L+GL+ NP++ TS ++IC+NT +  +M+  GLS A STRVSNELGAGN + A+ A +V + +++  AL V   +++  +     +SN   + +  A+L   +A S  LDS+Q VLSG ARGCGWQ++   INLG++Y++G+P +VL  F L +  KGLW+G+IC +  Q  SL ++TI   W +
Sbjct:    6 SKDD---HDGEGGRDKSSTFVQKLIDVEEAKTQIIYSLPMIFTNLFYYCIPLTSVMFASQLGQLELAGATLANSWATVTGFAFMTGLSGALETLCGQGFGAKSYRMLGIHLQSSCIVSLVFTILITILWFFTESVFLLLRQDPSISKQAALYMKYLAPGLLAYGFLQNILRFCQTQCIVTPLVLFSFLPLVINIGTTYALVHLAGLGFIGAPIATSISLWIAFVSLGFYVICSDKFKETWTGFSMESFHHVVLNLTLSIPSAAMVCLEYWAFEILVFLAGLMRNPEITTSLVAICVNTESISYMLTCGLSAATSTRVSNELGAGNVKGAKKATSVSVKLSLVLALGVVIAILVGHDAWVGLFSNSHVIKEGFASLRFFLAASITLDSIQGVLSGVARGCGWQRLATVINLGTFYLIGMPISVLCGFKLKLHAKGLWIGLICGMFCQSASLLLMTIFRKWTK 463          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: ALF5_ARATH (MATE efflux family protein ALF5 OS=Arabidopsis thaliana GN=ALF5 PE=2 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.567e-114
Identity = 187/436 (42.89%), Postives = 284/436 (65.14%), Query Frame = -2
Query:  379 DEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYA--YSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQ 1680
            +E K Q+  + P+I  ++F YCI + SVM   H G+L LAGA++  S+A+V+GF+ ++G++ +L+TLCGQ +GAK+Y MLG+H+Q + ++ ++ SI +   W  T  I     QD  IS  A  Y  +  P L AYG LQ +++F QTQ+I+ P++I S +   ++I   +V+V+ +GLGF GA +A SIS W   L L  YV  S    +TWTGFS E+F  I   L L++PSA MVCLE W+FE++V L+G++PNP++ TS ++IC+NT A  +M+ +GLS A STRVSNELGAGN + A+ A +V + +++  AL  G +++L+    G+   +S+   + +  A+L   +A S  LDS+Q VLSG ARGCGWQ++   INL ++Y++G+P A    F L    KGLW+G+IC +  Q +SL ++TI   W +
Sbjct:   38 EEAKAQMIYSLPMILTNVFYYCIPITSVMFASHLGQLELAGATLANSWATVSGFAFMVGLSGSLETLCGQGFGAKRYRMLGVHLQSSCIVSLVFSILITIFWFFTESIFGLLRQDPSISKQAALYMKYQAPGLLAYGFLQNILRFCQTQSIIAPLVIFSFVPLVINIATAYVLVYVAGLGFIGAPIATSISLWIAFLSLGTYVMCSEKFKETWTGFSLESFRYIVINLTLSLPSAAMVCLEYWAFEILVFLAGVMPNPEINTSLVAICVNTEAISYMLTYGLSAAASTRVSNELGAGNVKGAKKATSVSVKLSLVLAL--GVVIVLLVGHDGWVGLFSDSYVIKEEFASLRFFLAASITLDSIQGVLSGVARGCGWQRLVTVINLATFYLIGMPIAAFCGFKLKFYAKGLWIGLICGIFCQSSSLLLMTIFRKWTK 471          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: TT12_ARATH (Protein TRANSPARENT TESTA 12 OS=Arabidopsis thaliana GN=TT12 PE=2 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 5.857e-102
Identity = 185/473 (39.11%), Postives = 288/473 (60.89%), Query Frame = -2
Query:  352 TPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVW-LAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPF--GLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERV 1761
            +PE ++F L +  S+       +  +W+   K +W L+G  I VS+  Y +  V+VM  GH G L LAGAS+ T       + ++LGMA+A+ T+CGQ+YGA+QYS +GI  QRAM++ +  ++ L F++  + PIL   GQ   I+     +A  M+P ++A+ L   + +FLQ QNIV P+   S     LH L+ W++      G  GAAL  S S W  V +  +Y+ +SP+C +TWTGFS  AF  I+ + +L + SA+M+CLE+W  + +V++SGLL NP +   A+SIC+      W + F  GLS A+S RVSNELGAGNP  A L+V VV +  +  + ++  I+++ R  L  A++++ EV+  V+ L PL+A S  L+ +Q +LSG A G GWQ + AY+NL +YY++G+P   +L F  ++G  G+W G+I  + +Q  +L ++T++TNW  E   A +RV
Sbjct:   25 SPEIEEF-LRRRGSTVTPRWWLKLAVWE--SKLLWTLSGASIVVSVLNYMLSFVTVMFTGHLGSLQLAGASIATVGIQGLAYGIMLGMASAVQTVCGQAYGARQYSSMGIICQRAMVLHLAAAVFLTFLYWYSGPILKTMGQSVAIAHEGQIFARGMIPQIYAFALACPMQRFLQAQNIVNPLAYMSLGVFLLHTLLTWLVTNVLDFGLLGAALILSFSWWLLVAVNGMYILMSPNCKETWTGFSTRAFRGIWPYFKLTVASAVMLCLEIWYNQGLVIISGLLSNPTISLDAISICMYYLN--WDMQFMLGLSAAISVRVSNELGAGNPRVAMLSVVVVNITTVLISSVLCVIVLVFRVGLSKAFTSDAEVIAAVSDLFPLLAVSIFLNGIQPILSGVAIGSGWQAVVAYVNLVTYYVIGLPIGCVLGFKTSLGVAGIWWGMIAGVILQTLTLIVLTLKTNWTSEVENAAQRV 492          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Match: YJ2D_SCHPO (Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.874e-81
Identity = 171/508 (33.66%), Postives = 280/508 (55.12%), Query Frame = -2
Query:  340 PQSQDPIIFFVKPRKKMEREDKKSLTSALIQITPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKS--GLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYA 1857
            PQ + P     KP  +++R        AL + T EN+      +V      +   K  W E+   +  A P++  SL QY   + +V  +GH G+  LA AS+    A++T F++  G+ +ALDT+  QS+G+  Y M+G+H+QR + IL+++  P+  IW     ILLF  QD    M A +Y   M+ +  AY L + L +FLQ Q I  P+     I   ++I + ++ V+    G GF GA +A +++ W    +L++Y+ +  +  + W GFS+EA  N     RLA+P  IM+C E W+FE++   SG+L   +L  +++S+   T+   + + FG++ A +TRV N +GAGN + A+LA +V I +     +++  IL L RN   Y ++++ +VV  VA ++PLVA  N+ D+ QCV  G  RG G Q+IG  +N  +YY++G+P A++L F L+ G  GLW+GI  A+ +     +  ++  NW+     A  R +D A
Sbjct:   42 PQ-ERPTTSLRKPTPRVQRPATDVSYGALEE-TEENESIASGLSVQ----EDFNSKAWWKELTLLIKFATPVVLTSLLQYGEVVTTVFSLGHLGKTELAAASLSNMTATITAFAIYQGIVSALDTVGTQSFGSGNYEMVGLHLQRILAILLLIQFPIFLIWWKIEGILLFLRQDPLTCMFAAKYMRVMMLASPAYALFEALKRFLQVQGIFHPVTYILAIVVPINIFLNYLFVWSPWVGFGFLGAPVAVALTLWSACAVLIIYI-MKVNGRQAWGGFSREALKNWGPLCRLAVPGVIMICSEYWAFELVTFASGVLGTTEL--ASMSVLSTTSTLSYNLAFGVAAAAATRVGNLIGAGNTKLAKLATHVSINLGAAIGVIIAVILFLTRNTWTYIFTSDKDVVALVATIIPLVALINIADNTQCVAGGLLRGQGRQRIGGVVNFIAYYLLGLPVAIILCFKLDWGLYGLWIGIGAAILIIAGVETWCSLHVNWDHLVELA-NRQFDEA 539          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: A0A0D2QJ28_GOSRA (MATE efflux family protein OS=Gossypium raimondii GN=B456_007G004900 PE=3 SV=1)

HSP 1 Score: 959.903 bits (2480), Expect = 0.000e+0
Identity = 489/545 (89.72%), Postives = 491/545 (90.09%), Query Frame = -2
Query:  319 MEREDKKSLTSALIQITPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMV-------------CLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCV-----------------------------------LSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT 1809
            MEREDKKSLTSALIQITPENDDFTL QAVSS GINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQM+SVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIM               LEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQ                                     +SGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT
Sbjct:    1 MEREDKKSLTSALIQITPENDDFTLQQAVSSKGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMISVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMPWVKRKRSLSDCEHSLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQFSPLLTVTWIYISKVSEIGIPKLMMINSVGGDIDLYDISGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT 545          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: A0A061FVD4_THECC (MATE efflux family protein OS=Theobroma cacao GN=TCM_012553 PE=3 SV=1)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 404/498 (81.12%), Postives = 443/498 (88.96%), Query Frame = -2
Query:  319 MEREDKK-SLTSALIQITPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT 1809
            MERED+K SLTS+LI+I+ +NDD TL     S+  N  RRKKI++E KKQ+WLAGPL+ V+L QY IQM+S+M VGH GELAL+GASM TSFA+VTGFSLLLGMATALDTLCGQSYGAKQY MLGIHMQRAM ILVIVSIPLA IW+NT PIL+  GQDH+IS  AGEYAC MVPSLFAYGLLQCLVKFLQTQNI FPMMICSGITT LHIL+CW+MVFKSGLGF GAALANSISNW NV LLV YVK SPSCAKTW GFSKEAFHNIFTFLRLAIPSAIMVCLE+WSFEM+VLLSGLLPNP+LQTS LSICLNTA TVWMIP GLS AVSTRVSNELGAGNPEAAR AV  VIVM IFE LLVGSIL+LIRNI GYAYSNEVEVVKYVAA++P++ATS  LD LQ VLSG ARGCGWQKIGAYINLGSYY+VG+PCA+LLAFVL+VGGKGLWLGIICALAVQVTSLSI+TI+TNW++EARKA ERVY+Y I  E+V+
Sbjct:    1 MEREDQKFSLTSSLIRISWKNDDSTLSNRQRSSNENN-RRKKIFEESKKQLWLAGPLVAVTLLQYSIQMISLMFVGHLGELALSGASMATSFAAVTGFSLLLGMATALDTLCGQSYGAKQYPMLGIHMQRAMFILVIVSIPLAIIWVNTRPILVLLGQDHDISKKAGEYACLMVPSLFAYGLLQCLVKFLQTQNIFFPMMICSGITTLLHILVCWIMVFKSGLGFGGAALANSISNWINVFLLVFYVKFSPSCAKTWAGFSKEAFHNIFTFLRLAIPSAIMVCLELWSFEMVVLLSGLLPNPELQTSVLSICLNTAYTVWMIPVGLSSAVSTRVSNELGAGNPEAARFAVCFVIVMTIFEGLLVGSILILIRNIWGYAYSNEVEVVKYVAAMMPILATSCFLDGLQSVLSGIARGCGWQKIGAYINLGSYYLVGVPCAILLAFVLDVGGKGLWLGIICALAVQVTSLSIITIQTNWQEEARKAMERVYEYVIPVEVVS 497          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: A0A061FUK8_THECC (MATE efflux family protein OS=Theobroma cacao GN=TCM_012552 PE=3 SV=1)

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 401/499 (80.36%), Postives = 445/499 (89.18%), Query Frame = -2
Query:  319 MEREDKK-SLTSALIQITPENDDFTL-HQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT 1809
            MERED+K SLT  LI+ + ENDD TL ++  SSNG +   RK I++EVKKQ+WLAGPLI V+L QYCIQM+SVM VGH GELAL+GASM TSFA+VTGFSLL+GMA ALDTLCGQSYGAKQ+SMLGIHMQRA+++L IVSIPLA IW+NT PIL+  GQDH+IS  AGEYA FMVPS+FAYGLLQCLVKFLQTQNIVFPMMICSGITT LHIL+CW+MVFKSGLG RGAAL+N+ISNW NV LLVLYVK SPSCAKTW GFSKEAFHNIF+FLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNP LQTS LSICLNTAATVWMIP GLSGA STRVSNELGAG+ EAARLAV VVIVMAI E LLVGSIL+LIRNI GYAYSNEVEV+KYVAA++P++A SN LD +QCVLSG ARGCGWQKIGAY+NLGSYY+VGIPCA+LL FVL+VGG+GLWLGIICAL VQVTSLSI+TIRTNW+QEA KA ERVYDY I  E+V+
Sbjct:    1 MEREDQKLSLTFPLIRKSGENDDLTLSNEQKSSNGSDT--RKNIFEEVKKQLWLAGPLIAVNLLQYCIQMISVMFVGHLGELALSGASMATSFATVTGFSLLMGMAAALDTLCGQSYGAKQHSMLGIHMQRAIIVLEIVSIPLAIIWVNTRPILVLLGQDHDISKEAGEYARFMVPSIFAYGLLQCLVKFLQTQNIVFPMMICSGITTLLHILVCWIMVFKSGLGSRGAALSNAISNWINVFLLVLYVKFSPSCAKTWAGFSKEAFHNIFSFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPVLQTSVLSICLNTAATVWMIPSGLSGAASTRVSNELGAGHSEAARLAVYVVIVMAISEGLLVGSILILIRNIWGYAYSNEVEVIKYVAAMMPILAISNFLDGIQCVLSGIARGCGWQKIGAYVNLGSYYLVGIPCAILLGFVLDVGGRGLWLGIICALIVQVTSLSIITIRTNWQQEASKAVERVYDYVIPVEVVS 497          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: A0A067F671_CITSI (MATE efflux family protein OS=Citrus sinensis GN=CISIN_1g010345mg PE=3 SV=1)

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 353/498 (70.88%), Postives = 421/498 (84.54%), Query Frame = -2
Query:  319 MEREDKKS-LTSALIQITPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT 1809
            MERE++KS L S LIQI+ E  +   HQ  S        +KKI +EVK+Q+WL+GPLI VSL Q+C+QM+SVM VGH GEL L+GASM TSFA+VTGFS L+G+++AL+TLCGQSYGAKQY MLGIHMQR M +L+++S+PLA IW NT  +L+   QD EIS  AG YA +M+PS+FAY +LQCLV+FLQTQNIVFPM++ SGIT  LHIL+CW++VFKSGLG RGAALANSIS W NVLLL +YVK S SCAKTWTGFSKEA +N+F F+RLAIPSA+MVCLEMWSFEMMVLLSGLLPNP L+TS LSI LNTA+TVWMIPFGLSGA STRVSNELGAG+PEAARLAV VV+VMA+ E +LVGS+L+LIRN+ GYAYSNE+EVVKYVA++LP++A SN LD LQCVLSG ARGCGWQ IGA++NLGSYY+VGIP A+LLAF+L+ GG+GLWLGIICAL VQ TSL I+T RTNWE+EA+KAT+RVY+ A   EIV+
Sbjct:    1 MEREEQKSTLNSPLIQISSEEINNN-HQTCS-------EKKKIIEEVKRQLWLSGPLISVSLLQFCLQMISVMFVGHLGELPLSGASMATSFATVTGFSFLVGLSSALETLCGQSYGAKQYHMLGIHMQRGMFVLLLISVPLALIWANTESLLVAAHQDSEISKEAGLYARYMIPSIFAYAILQCLVRFLQTQNIVFPMVLSSGITALLHILVCWILVFKSGLGSRGAALANSISYWINVLLLAIYVKFSSSCAKTWTGFSKEALNNVFNFVRLAIPSAVMVCLEMWSFEMMVLLSGLLPNPALETSVLSISLNTASTVWMIPFGLSGAASTRVSNELGAGHPEAARLAVCVVLVMAVTEGILVGSVLILIRNVWGYAYSNEIEVVKYVASMLPILAASNFLDGLQCVLSGIARGCGWQMIGAFVNLGSYYLVGIPSAILLAFLLHFGGRGLWLGIICALIVQATSLGIITARTNWEKEAKKATDRVYNSAPPVEIVS 490          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: F6GTS8_VITVI (MATE efflux family protein OS=Vitis vinifera GN=VIT_17s0000g02970 PE=3 SV=1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 370/495 (74.75%), Postives = 418/495 (84.44%), Query Frame = -2
Query:  328 MEREDKK-SLTSALIQITPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAE 1809
            M+R D+K +L S LIQ   E+          S G    +R K+ +EVKKQ+WLAGPLI VSL QYC+Q++SVM VGH GELAL+GASM TSFASVTG SLL+GMA+ALDTLCGQSYGAKQY ML IHMQRAMLIL+IVSIPLA IW  T  IL+  GQD EIS  A  YA FM+PSLFAYGLLQCLV+FLQTQNIVFPMM+ SGITT LH+L+CW +VFKSGLG +GAALANSIS W NVLLL LYVK S SC+KT TGFSKEA HNI +FLRLAIPSA+MVCLEMWSFE+MVLLSGLLPNPKLQTS LSICLNTAATVWMIPFGLSGAVSTRVSNELGAG+P+AARLAV VV+VMAI E  L+G +L+LIRNI GYAYSNE+EVVKYVAA++P+VA SN LD +QCVLSG ARGCGWQKIGA++NLGSYY+VGIPCA+LLAFV ++GG+GLWLGIICAL VQV SL IVT+RTNWE EA+KAT+RVYD  I  E
Sbjct:    1 MDRGDEKPTLRSPLIQSCGEDG------GERSKG-KVFQRDKVVEEVKKQLWLAGPLISVSLLQYCLQLISVMFVGHLGELALSGASMATSFASVTGSSLLMGMASALDTLCGQSYGAKQYHMLSIHMQRAMLILLIVSIPLATIWAYTGTILMAVGQDPEISQEAELYARFMIPSLFAYGLLQCLVRFLQTQNIVFPMMLSSGITTLLHVLVCWFLVFKSGLGSKGAALANSISCWINVLLLALYVKFSSSCSKTRTGFSKEALHNIPSFLRLAIPSAVMVCLEMWSFELMVLLSGLLPNPKLQTSVLSICLNTAATVWMIPFGLSGAVSTRVSNELGAGHPQAARLAVFVVLVMAIAEGTLLGLLLILIRNIWGYAYSNEIEVVKYVAAMMPIVALSNFLDGMQCVLSGTARGCGWQKIGAFVNLGSYYLVGIPCAILLAFVFHIGGRGLWLGIICALIVQVLSLLIVTLRTNWEDEAKKATDRVYDAIIPIE 488          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: I1KQG4_SOYBN (MATE efflux family protein OS=Glycine max PE=3 SV=1)

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 350/497 (70.42%), Postives = 418/497 (84.10%), Query Frame = -2
Query:  322 MEREDKK-SLTSALIQITPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIV 1809
            M+RED+K SL S LI IT E+     +   + +    + R ++++EV+KQ+WLAGPLI VS+  Y  Q++SVM VGH G+L L+GASM TSFASVTGFSLL+GMA+ALDTLCGQSYGAKQ+ MLGIHMQRAML+L+IVSI LAFIW NT  IL+  GQD EIS  AG+YA  M+PSLFAYG+LQCL +FLQTQNIVFPM+  SG+TT LHILICW MVFKSGLG +GAA+AN+IS W NVL+L+LYVK SPSC+KTWTGFSKEA H I +FL+LAIPSA+MVCLEMWSFEMMVLLSGLLPNPKL+TS LSICLNT+ +VWMIPFGLSGAVSTRVSNELGAG+P AARLAV  V +MAI E   VG+++++IRNI GYAYSNE EVV+YVA +LP++ATS  LD+LQCVLSG ARGCGWQK GA+INLGSYY+VGIP A+L AFVL++GGKGLWLGIICAL VQV+ L I+TIRT+WEQEA+K  +RVYD ++ AE++
Sbjct:    1 MDREDQKASLLSQLIHITVEDRLKVDNIQRNKDKQQAIERAELYEEVRKQLWLAGPLISVSMLNYSQQIISVMFVGHLGQLPLSGASMATSFASVTGFSLLVGMASALDTLCGQSYGAKQHHMLGIHMQRAMLVLMIVSINLAFIWANTRSILVALGQDPEISAEAGQYAQLMIPSLFAYGILQCLNRFLQTQNIVFPMVFSSGVTTLLHILICWTMVFKSGLGNKGAAIANAISYWINVLILILYVKFSPSCSKTWTGFSKEALHGIPSFLKLAIPSALMVCLEMWSFEMMVLLSGLLPNPKLETSVLSICLNTSTSVWMIPFGLSGAVSTRVSNELGAGHPRAARLAVYFVFIMAIIEGTFVGAVMIIIRNIWGYAYSNEAEVVQYVAIMLPILATSIFLDALQCVLSGTARGCGWQKKGAFINLGSYYLVGIPSAILFAFVLHIGGKGLWLGIICALVVQVSCLLIITIRTDWEQEAKKVKDRVYD-SMRAEVI 496          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: V4UR20_9ROSI (MATE efflux family protein OS=Citrus clementina GN=CICLE_v10008114mg PE=3 SV=1)

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 351/498 (70.48%), Postives = 419/498 (84.14%), Query Frame = -2
Query:  319 MEREDKKS-LTSALIQITPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT 1809
            MERE++KS L S LIQI+ E  +   HQ  S        +KKI +EVK+Q+WL+GPLI VSL Q+C+QM+SVM VGH GEL L+GASM TSFA+VTGFS L+G+++AL+TLCGQSYGAKQY MLGIHMQR M +L+++S+PLA IW NT  +L+   QD EIS  AG YA +M+PS+FAY +LQCLV+FLQTQNIVFPM++ SGIT  LHIL+CW++VFKSGLG RGAALANSIS W NVLLL +YVK S SCAKTWTGFSKEA +N+F F+RLAIPSA+MVCLEMWSFEMMVLLSGLLPNP L+TS LSI LNTA+TVWMIPFGLSGA STRVSNELGAG+ EAARLAV VV+VMA+ E +LVGS+L+LIRN+ GYAYSNE+EVVKYVA++LP++A SN LD LQCVLSG ARGCGWQ IGA++NLGSYY+VGIP A+LLAF+L+ GG+GLWLGIIC L VQ TSL I+T RTNWE+EA+KAT+RVY+ A   EIV+
Sbjct:    1 MEREEQKSTLNSPLIQISSEEINNN-HQTCS-------EKKKIIEEVKRQLWLSGPLISVSLLQFCLQMISVMFVGHLGELPLSGASMATSFATVTGFSFLVGLSSALETLCGQSYGAKQYHMLGIHMQRGMFVLLLISVPLALIWANTESLLVAAHQDSEISKEAGLYARYMIPSIFAYAILQCLVRFLQTQNIVFPMVLSSGITALLHILVCWILVFKSGLGSRGAALANSISYWINVLLLAIYVKFSSSCAKTWTGFSKEALNNVFNFVRLAIPSAVMVCLEMWSFEMMVLLSGLLPNPALETSVLSISLNTASTVWMIPFGLSGAASTRVSNELGAGHQEAARLAVCVVLVMAVTEGILVGSVLILIRNVWGYAYSNEIEVVKYVASMLPILAASNFLDGLQCVLSGIARGCGWQMIGAFVNLGSYYLVGIPSAILLAFLLHFGGRGLWLGIICGLIVQATSLGIITARTNWEKEAKKATDRVYNSAPPVEIVS 490          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: B9I2H9_POPTR (MATE efflux family protein OS=Populus trichocarpa GN=POPTR_0012s04810g PE=3 SV=2)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 358/506 (70.75%), Postives = 417/506 (82.41%), Query Frame = -2
Query:  319 MEREDKK-SLTSALIQITPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVS--------TRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT 1809
            MERE +  SL + L     E +   L++    N    + +K+I +EVK+Q+WLAGPLI VSL QYCIQM+SVM VGH GEL+L+GASM TSFASVTGFSLLLGMA+ALDT CGQ+YGA+Q+ ML IHMQRAM++L++VSIPLA IW NT PIL+  GQ  +I+  AG YA FM+PSLFAYGLLQCLVKFLQTQNIVFPMM+C+GITT LHIL+CWV+VFKSGLG+ GAALA+S S W NVLLLVLYVK S SC+KTWTGFSKEAFH+I  F+RLAIPSA+MVCLEMWSFE MVL+SGLLPNP+L+TS LSI LNTAATVWMIP+GLSGA          TRVSNELGA +P  ARLAV VVI +A+ E +LVG +L+LIRN+ GYAYSN++EVV YVA +LP+VATSN LD LQCVLSG ARGCGWQKIGAYINLGSYY+VGIP A+LLAFV +VGGKGLWLGIICAL VQV SL+ +TIRTNWEQEA+KATERVYD  I  + V+
Sbjct:    1 MEREQQSLSLNTPLC----EGNGVGLYE--ERNQERGISKKEILEEVKRQLWLAGPLISVSLLQYCIQMISVMFVGHLGELSLSGASMATSFASVTGFSLLLGMASALDTFCGQAYGARQFHMLSIHMQRAMVVLLLVSIPLAIIWANTRPILMACGQQKDIAEEAGLYARFMIPSLFAYGLLQCLVKFLQTQNIVFPMMLCAGITTLLHILVCWVLVFKSGLGYIGAALASSFSYWINVLLLVLYVKFSSSCSKTWTGFSKEAFHDIVNFMRLAIPSAVMVCLEMWSFESMVLMSGLLPNPELETSVLSISLNTAATVWMIPYGLSGAARQVMLNWKYTRVSNELGAQHPYRARLAVCVVITIAVAEGILVGIVLILIRNVWGYAYSNDIEVVDYVAVMLPVVATSNFLDGLQCVLSGVARGCGWQKIGAYINLGSYYLVGIPIAILLAFVFHVGGKGLWLGIICALIVQVFSLATITIRTNWEQEAKKATERVYDEVIPVDTVS 500          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: V7C603_PHAVU (MATE efflux family protein OS=Phaseolus vulgaris GN=PHAVU_004G152500g PE=3 SV=1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 352/503 (69.98%), Postives = 418/503 (83.10%), Query Frame = -2
Query:  319 MEREDKKS---LTSALIQITPEN---DDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT 1809
            MERED+     L S LIQ +  +   D   +++  SS     + RK + +EVKKQ+WL+GPLI V+L  +C+ ++SVM VGH GELAL+GASM TSFASVTGFSLL+GMA+ALDT CGQSYGAKQY MLGIHMQRAM IL+ VSIPLA IW NT+ IL+FFGQD EI+  AG YA FM+PSLFAYGLLQCL +FLQTQNIVFPMM  SGITT LH+LICW++VFKSGLG +GAA+AN+IS W NV +L LY+K SPSCAKTW GFSKEA HNI TFLRLAIPSA+MVCLEMWSFEMMVLLSGLLPNPKL+TS LSICLNT ATVWMIPFGLSGA+S RVSNELGAG P  A LAV+VV+V+ I E +L+G++++L+RNI GYAYSNE EVVKYVA +LP++A SN LD +QCVLSG ARGCGWQKIGA++NLGSYY+VGIP AV+LAFVL++GGKGLWLGIICAL VQV SL I+TIRT+WEQ+A++AT+RV++      +V+
Sbjct:    1 MEREDQNQSAYLQSPLIQHSYSSGLKDGSVVNEKQSS--WRRIERKDVVEEVKKQLWLSGPLITVTLLNFCLNVISVMFVGHLGELALSGASMATSFASVTGFSLLVGMASALDTFCGQSYGAKQYHMLGIHMQRAMFILMTVSIPLAVIWANTSSILIFFGQDPEIAAEAGIYATFMLPSLFAYGLLQCLNRFLQTQNIVFPMMCSSGITTLLHVLICWILVFKSGLGSKGAAVANAISYWLNVTILSLYIKFSPSCAKTWKGFSKEALHNILTFLRLAIPSAVMVCLEMWSFEMMVLLSGLLPNPKLETSVLSICLNTTATVWMIPFGLSGAISIRVSNELGAGRPWIANLAVHVVLVIVIIEGILMGTVMILVRNIWGYAYSNETEVVKYVAVMLPILAASNFLDGIQCVLSGTARGCGWQKIGAFVNLGSYYLVGIPSAVVLAFVLHIGGKGLWLGIICALIVQVCSLMIITIRTDWEQQAKEATDRVHNSVTPESLVS 501          
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Match: W9QE39_9ROSA (MATE efflux family protein OS=Morus notabilis GN=L484_020909 PE=3 SV=1)

HSP 1 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 358/498 (71.89%), Postives = 414/498 (83.13%), Query Frame = -2
Query:  319 MERED-KKSLTSALIQITPENDDFTLHQAVSSNGINEVRRKKIWDEVKKQVWLAGPLIGVSLFQYCIQMVSVMLVGHAGELALAGASMGTSFASVTGFSLLLGMATALDTLCGQSYGAKQYSMLGIHMQRAMLILVIVSIPLAFIWINTTPILLFFGQDHEISMAAGEYACFMVPSLFAYGLLQCLVKFLQTQNIVFPMMICSGITTFLHILICWVMVFKSGLGFRGAALANSISNWFNVLLLVLYVKLSPSCAKTWTGFSKEAFHNIFTFLRLAIPSAIMVCLEMWSFEMMVLLSGLLPNPKLQTSALSICLNTAATVWMIPFGLSGAVSTRVSNELGAGNPEAARLAVNVVIVMAIFEALLVGSILMLIRNILGYAYSNEVEVVKYVAALLPLVATSNLLDSLQCVLSGNARGCGWQKIGAYINLGSYYIVGIPCAVLLAFVLNVGGKGLWLGIICALAVQVTSLSIVTIRTNWEQEARKATERVYDYAISAEIVT 1809
            MERE+ K SL + LIQ   EN        V   GI   +RK+I +EVK+Q+WLAGPLI VSL QYC+QM+SVM VGH GEL+L+GASM TSFA+VTGFS LLGMA+AL+TL GQSYGAKQY MLGIH QR+M +L++VSIPLA IW NT PIL+  GQD +I+  AG YA FM+PS+FAYGLLQCLVKFLQTQNIVFPM++ SGI T LHIL+CWV+VFKSGLG +GAALANSIS W NVLLL LYVK S SCAKTWTGFSKEAF N  TF+RLAIPSA+MVCLEMWSFEM+VLLSGLLPNP+L+TS LSI LNTA+TVWMIPFGLSGAVSTRVSNELGAG+P AARLAV V +VM + EALLVG +L+LIRNI GYAYSNE+EVVKYVA ++P++A S+ L+ LQCVLSGNARGCGWQKIGAY+NLGSYYIVGIP A+LLAFV ++GGKGLWLGIICAL VQ   L +++I TNWE++A KA ERVY      E V+
Sbjct:    1 MERENYKPSLVTPLIQSCEENGLNNGRDRVGEEGI---KRKQILEEVKRQLWLAGPLIAVSLLQYCLQMISVMFVGHLGELSLSGASMATSFAAVTGFSFLLGMASALETLSGQSYGAKQYHMLGIHTQRSMFVLLLVSIPLAVIWANTEPILIAVGQDADIATEAGRYARFMIPSIFAYGLLQCLVKFLQTQNIVFPMVVSSGIATLLHILLCWVLVFKSGLGSKGAALANSISYWNNVLLLALYVKFSSSCAKTWTGFSKEAFENTPTFVRLAIPSAVMVCLEMWSFEMVVLLSGLLPNPELETSVLSISLNTASTVWMIPFGLSGAVSTRVSNELGAGHPGAARLAVWVAVVMTVTEALLVGLVLILIRNIWGYAYSNEIEVVKYVAKMMPILAGSHFLEGLQCVLSGNARGCGWQKIGAYVNLGSYYIVGIPSAILLAFVFHIGGKGLWLGIICALVVQSLFLLVISINTNWEEQANKAKERVYKSVAPVEAVS 495          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
DTX1_ARATH4.388e-12945.70MATE efflux family protein DTX1 OS=Arabidopsis tha... [more]
MATE7_ARATH2.635e-12845.25MATE efflux family protein 7 OS=Arabidopsis thalia... [more]
MATE5_ARATH1.799e-12746.83MATE efflux family protein 5 OS=Arabidopsis thalia... [more]
MATE6_ARATH2.378e-12745.48MATE efflux family protein 6 OS=Arabidopsis thalia... [more]
MATE9_ARATH5.434e-12544.64MATE efflux family protein 9 OS=Arabidopsis thalia... [more]
MATE8_ARATH4.421e-12444.80MATE efflux family protein 8 OS=Arabidopsis thalia... [more]
LAL5_ARATH9.502e-11541.87MATE efflux family protein LAL5 OS=Arabidopsis tha... [more]
ALF5_ARATH1.567e-11442.89MATE efflux family protein ALF5 OS=Arabidopsis tha... [more]
TT12_ARATH5.857e-10239.11Protein TRANSPARENT TESTA 12 OS=Arabidopsis thalia... [more]
YJ2D_SCHPO1.874e-8133.66Uncharacterized transporter C4B3.13 OS=Schizosacch... [more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092929 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2QJ28_GOSRA0.000e+089.72MATE efflux family protein OS=Gossypium raimondii ... [more]
A0A061FVD4_THECC0.000e+081.12MATE efflux family protein OS=Theobroma cacao GN=T... [more]
A0A061FUK8_THECC0.000e+080.36MATE efflux family protein OS=Theobroma cacao GN=T... [more]
A0A067F671_CITSI0.000e+070.88MATE efflux family protein OS=Citrus sinensis GN=C... [more]
F6GTS8_VITVI0.000e+074.75MATE efflux family protein OS=Vitis vinifera GN=VI... [more]
I1KQG4_SOYBN0.000e+070.42MATE efflux family protein OS=Glycine max PE=3 SV=... [more]
V4UR20_9ROSI0.000e+070.48MATE efflux family protein OS=Citrus clementina GN... [more]
B9I2H9_POPTR0.000e+070.75MATE efflux family protein OS=Populus trichocarpa ... [more]
V7C603_PHAVU0.000e+069.98MATE efflux family protein OS=Phaseolus vulgaris G... [more]
W9QE39_9ROSA0.000e+071.89MATE efflux family protein OS=Morus notabilis GN=L... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002528Multi antimicrobial extrusion proteinTIGRFAMTIGR00797TIGR00797coord: 77..474
e-value: 1.6E-97
score: 324.9
IPR002528Multi antimicrobial extrusion proteinPFAMPF01554MatEcoord: 77..237
e-value: 3.2E-36
score: 124.3
coord: 298..460
e-value: 6.6E-29
score: 100.5
NoneNo IPR availablePANTHERPTHR11206MULTIDRUG RESISTANCE PROTEINcoord: 24..33
coord: 58..508
NoneNo IPR availablePANTHERPTHR11206:SF173SUBFAMILY NOT NAMEDcoord: 24..33
coord: 58..508
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 102..132
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 412..430
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 269..288
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 289..308
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 153..177
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 349..368
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 369..392
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 178..182
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 133..152
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 309..327
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 494..519
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 245..268
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 216..239
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 240..244
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 205..215
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 467..471
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 72..96
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 442..466
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 393..411
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 183..204
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..71
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 328..348
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 97..101
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 472..493
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 431..441
NoneNo IPR availableTMHMMTMhelixcoord: 471..493
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 248..270
NoneNo IPR availableTMHMMTMhelixcoord: 216..238
NoneNo IPR availableTMHMMTMhelixcoord: 327..349
NoneNo IPR availableTMHMMTMhelixcoord: 444..466
NoneNo IPR availableTMHMMTMhelixcoord: 369..391
NoneNo IPR availableTMHMMTMhelixcoord: 110..132
NoneNo IPR availableTMHMMTMhelixcoord: 153..175
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 406..423
NoneNo IPR availableTMHMMTMhelixcoord: 185..204

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092929 ID=g.barbadense_cottongen_reftransV1_0092929|Name=g.barbadense_cottongen_reftransV1_0092929|organism=Gossypium barbadense|type=contig|length=1921bp
TACTTATTACTTATTATTATTATTATTATTTTGTTATCCCTTAATTTTCT
CCTATTTTTAATTATTTGGTTTATTTTTGAATAATTTAAGAGCTTTATCT
TATTTGTTAATCACTCCCTCCTCGTTTATATATATATATGGATGTTTTTC
ATCATTAGTAAATGTAGAATGTGTTTTTTCTTTAAATGAGAACGATTCGT
CTTGCTGGAGTTGCTACTATCATAATAAACACTATTATTCAATTCAATCC
TGTCTCTCAACTTCCGTGGAAGTGCTAATTTCTCAAACTAGAAATCTCAA
GGTCGCCTAACAACTTCATGTCACAATTTCAGCTGAAATTGCATAATCAT
ATACTCTCTCCGTAGCTTTTCTCGCCTCTTGCTCCCAGTTTGTTCGAATG
GTAACAATACTAAGACTTGTAACTTGAACTGCAAGTGCACAGATGATCCC
AAGCCATAGCCCCTTTCCACCAACATTGAGTACAAAAGCTAACAAAACAG
CACATGGAATCCCAACTATATAGTAAGATCCCAAATTAATATATGCTCCA
ATCTTCTGCCACCCACAGCCTCTAGCATTGCCTGAGAGAACACACTGAAG
AGAATCTAAAAGGTTTGAAGTTGCTACTAATGGTAACAAAGCTGCTACGT
ATTTAACCACTTCGACTTCATTGCTATAAGCATAGCCCAAAATGTTTCGA
ATCAACATCAAGATGGATCCCACCAAAAGGGCCTCGAAGATGGCCATTAC
TATGACAACATTTACAGCTAAACGTGCTGCTTCCGGATTCCCTGCTCCTA
GTTCATTCGAGACTCGAGTGCTTACTGCACCACTGAGTCCAAAGGGTATC
ATCCAAACCGTGGCAGCAGTGTTAAGGCAAATAGAGAGTGCTGAAGTTTG
TAACTTTGGATTAGGAAGAAGACCTGATAGTAGAACCATCATTTCAAAGG
ACCACATCTCTAAGCAGACCATAATAGCCGATGGAATAGCAAGACGAAGG
AAAGTGAAAATATTGTGAAAGGCCTCCTTTGAAAATCCTGTCCATGTCTT
AGCACATGAAGGAGACAACTTAACGTACAGCACCAACAACAAGACATTGA
ACCAGTTGGAGATTGAATTGGCCAAGGCTGCTCCTCTAAACCCAAGCCCA
GATTTGAAAACCATGACCCAACAGATGAGAATGTGAAGGAAAGTTGTGAT
TCCAGAGCATATCATCATTGGGAATACGATATTTTGAGTTTGTAAGAACT
TGACTAGACATTGAAGGAGACCATATGCAAATAGACTGGGAACCATAAAA
CAAGCATACTCTCCAGCTGCCATGGATATTTCATGATCTTGGCCGAAAAA
AAGTAGAATGGGTGTAGTGTTTATCCATATAAAGGCAAGGGGTATGCTGA
CGATTACAAGAATGAGCATTGCCCTTTGCATGTGAATGCCCAGCATTGAA
TACTGTTTTGCCCCATACGATTGTCCGCAAAGGGTATCCAGGGCCGTTGC
CATTCCCAACAGCAAACTGAAACCTGTAACAGAAGCAAAGGAAGTACCCA
TTGAAGCACCAGCGAGAGCTAGCTCCCCAGCATGTCCAACCAACATCACT
GATACCATCTGTATACAGTACTGGAATAGGCTCACCCCTATGAGAGGACC
TGCCAGCCATACTTGTTTCTTCACTTCGTCCCATATTTTCTTTCTTCTAA
CTTCATTAATTCCATTGCTGCTCACTGCTTGATGTAGAGTGAAATCATCG
TTTTCTGGCGTTATCTGAATCAAAGCTGAAGTTAGAGACTTCTTGTCTTC
TCTCTCCATCTTCTTTCGAGGCTTGACGAAGAAGATGATGGGATCTTGGG
ATTGGGGTTCCCATTTAATAGCCAAGTGTGTTCATTTTTTCTTATTTTAA
GGATATTTTTGTTGGACTTCT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002528MATE_fam
Vocabulary: Molecular Function
TermDefinition
GO:0015297antiporter activity
GO:0015238drug transmembrane transporter activity
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0006855drug transmembrane transport
GO:0055085transmembrane transport