g.barbadense_cottongen_reftransV1_0092928, g.barbadense_cottongen_reftransV1_0092928 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092928
Unique Nameg.barbadense_cottongen_reftransV1_0092928
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length1998
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
At05chromosomeg.barbadense_cottongen_reftransV1_0092928:1..1998 .
At05:31124694..31130712 -
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: A0A0B0PJ03_GOSAR (Putative transporter C5D6.04 OS=Gossypium arboreum GN=F383_05650 PE=4 SV=1)

HSP 1 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 414/417 (99.28%), Postives = 415/417 (99.52%), Query Frame = -2
Query:  183 MGFLDLLLVALIPVIKVLFITGVGLFLALDHVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLLF 1433
            MGFLDLLLVALIPVIKVLFITGVGLFLALD VNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDW+AASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSIIIGIIAVRNVFMPLLGIGVV AAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLLF
Sbjct:    1 MGFLDLLLVALIPVIKVLFITGVGLFLALDRVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWIAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSIIIGIIAVRNVFMPLLGIGVVKAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLLF 417          
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: A0A0D2SB33_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G306100 PE=4 SV=1)

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 410/417 (98.32%), Postives = 411/417 (98.56%), Query Frame = -2
Query:  183 MGFLDLLLVALIPVIKVLFITGVGLFLALDHVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLLF 1433
            MGFLDLLLVALIPVIKVLFITGVGLFLALD VNLLGPDARNHLNKIVFYVFGPALVATNLAQT TYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNS SESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEK SALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQ LIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSIIIGIIAVRNVFMPLLGIGVV AAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESS+IMLWTYVVAAFSLTLWSTVFMWLLF
Sbjct:    1 MGFLDLLLVALIPVIKVLFITGVGLFLALDRVNLLGPDARNHLNKIVFYVFGPALVATNLAQTTTYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSNSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKSSALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQTLIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSIIIGIIAVRNVFMPLLGIGVVKAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSIIMLWTYVVAAFSLTLWSTVFMWLLF 417          
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: A0A0D2TUD1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G306100 PE=4 SV=1)

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 338/343 (98.54%), Postives = 339/343 (98.83%), Query Frame = -2
Query:  183 MPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLLF 1211
            MPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNS SESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEK SALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQ LIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSIIIGIIAVRNVFMPLLGIGVV AAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESS+IMLWTYVVAAFSLTLWSTVFMWLLF
Sbjct:    1 MPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSNSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKSSALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQTLIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSIIIGIIAVRNVFMPLLGIGVVKAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSIIMLWTYVVAAFSLTLWSTVFMWLLF 343          
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: A0A061FVW9_THECC (Auxin efflux carrier family protein OS=Theobroma cacao GN=TCM_043509 PE=4 SV=1)

HSP 1 Score: 526.168 bits (1354), Expect = 1.839e-178
Identity = 266/417 (63.79%), Postives = 335/417 (80.34%), Query Frame = -2
Query:  186 MGFLDLLLVALIPVIKVLFITGVGLFLALDHVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWVAASDEYSVQQQ-PHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLL 1433
            MGFLDL +VA++PV+KVL +TGVGLFLA D +NLLGP+ARN+LNKIVFY+FGP+LV +NLA+T+T ESLVT+WFMPVNI LTF+IGSAL W+LIKIT+TP+HL+GMVIGCCSAGNLGNL LIIVP+VC ESN PFG+S  C + A+AYASLSMA GAIFIWSY Y  + +YA+   E       NSS+    S  D  +C E LLPS+D  + S++YS Q   P  N + + K+S ++K  + I + M KI+LK VFAPSAIA +VGF IGT+SPIR++LIG +APL VI+ S++L+ +  + CMTL++GANLLKGL RS++   +IIGI+AVRN+F+PL GIGVV AA H G+VG+D+L++FVLMLQYA+PPAM+VGTMTQLFQ GQ ESS+IMLWTY VA+ SLTLWS +FMWLL
Sbjct:    1 MGFLDLFVVAVMPVLKVLLVTGVGLFLATDGINLLGPEARNYLNKIVFYLFGPSLVVSNLAETVTLESLVTMWFMPVNIFLTFIIGSALGWILIKITKTPEHLRGMVIGCCSAGNLGNLLLIIVPAVCTESNTPFGDS--CSTYAEAYASLSMAVGAIFIWSYAYPFVYAYASKSMEQ------NSSEGAPQSFPD--SCTEALLPSRD-CSNSEDYSGQGVLPLTNSDKRIKMSVVKKTVESIKIIMGKIDLKRVFAPSAIAAVVGFIIGTISPIRKVLIGDNAPLHVIDTSVSLIAEAAIPCMTLIMGANLLKGLKRSEVSMLVIIGIVAVRNIFLPLSGIGVVKAAHHFGMVGSDSLYRFVLMLQYAVPPAMSVGTMTQLFQSGQGESSMIMLWTYAVASISLTLWSMLFMWLL 406          
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: A0A061FVX8_THECC (Auxin efflux carrier family protein OS=Theobroma cacao GN=TCM_043536 PE=4 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 2.361e-176
Identity = 258/423 (60.99%), Postives = 332/423 (78.49%), Query Frame = -2
Query:  186 IRCEYRLMGFLDLLLVALIPVIKVLFITGVGLFLALDHVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLL 1454
            +R  +  MGFL+L +VA++PV+K++ IT +GL LALD V LLGP+A++HLNKIVFYVF PAL A++LA+T+T++S  TLWFMPVNIL+TF++GSALAWLLIK TRTPKHLQG+VIGCCSAGNL NLPLI+VP+VCEE +NPFG+ S C +NA+ YASLS++ GAIF+WSYVYGIMR YAN   E+  T  INS +  S + S   T  +  LPS D   +    ++ +Q         K S L+K   CI M  +KI+LK+VFAP+A+A +VGF IG VSPIR+++IG+ APLRVI++S  +LG+ ++ CMTL++GANLL GL  SD+  ++IIGIIAVRN+F+PL GIGVV AA H GLVG+D+L+QFVLMLQYA+PPAM++GTMTQ FQ+GQ E+S+IMLW YV AA +LTLWST FMWLL
Sbjct:   32 VRETFLQMGFLNLFIVAVMPVLKIILITAIGLLLALDRVKLLGPEAKHHLNKIVFYVFSPALAASSLAETMTFKSFTTLWFMPVNILITFVLGSALAWLLIKFTRTPKHLQGIVIGCCSAGNLANLPLIMVPAVCEEPSNPFGDQSVCSTNAKPYASLSLSIGAIFMWSYVYGIMRMYANKSIESS-TTGINSPRDTSETVSGSRT--QAALPSSDCNNSDLPRTISRQ------RSTKTSGLKKIIPCIKMISRKIDLKKVFAPTAVAAIVGFIIGAVSPIRKLMIGSSAPLRVIDSSAYILGEASIPCMTLIMGANLLTGLKGSDVSRNVIIGIIAVRNIFLPLSGIGVVKAAHHFGLVGSDSLYQFVLMLQYAVPPAMSIGTMTQFFQLGQGETSMIMLWAYVTAAVTLTLWSTFFMWLL 445          
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: A0A061FPZ3_THECC (Auxin efflux carrier family protein OS=Theobroma cacao GN=TCM_043548 PE=4 SV=1)

HSP 1 Score: 507.294 bits (1305), Expect = 4.052e-171
Identity = 249/416 (59.86%), Postives = 324/416 (77.88%), Query Frame = -2
Query:  186 MGFLDLLLVALIPVIKVLFITGVGLFLALDHVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLL 1433
            MGFL+L +VA++PV+K++ IT +GL LALD + LLGP+A++HLN IVFYVF PAL A++LA+T+T++S  TLWFMPVNIL+TF++GSALAWL+IKITRTPKHLQG+VIGCCSAGN+GNLPL++VP++CEE  NPFG+ S C  NA+ YASLS++ G IF+WSYVYGIMR YAN   E+  T  +NS +  S + S   +C +  LPS D   +    ++        E+  ++S L K    I M   KI+LK++FAP+AIA +VGF IG  SPIR+++IG  APLRVI+   ++LG+ T+ C+TL++GANLL GL  SD+  ++IIGIIAVRN+F+PL GIGVV AA H GLVG+D+L+QFVLMLQYA+PPAM++GTMTQ FQ+GQ E+SVIMLWTY VAA +LTLWST FMWLL
Sbjct:    1 MGFLNLFIVAVMPVLKIILITAIGLLLALDRMKLLGPEAKHHLNNIVFYVFSPALAASSLAETMTFKSFTTLWFMPVNILITFVLGSALAWLIIKITRTPKHLQGIVIGCCSAGNMGNLPLVMVPALCEEPRNPFGDPSVCSRNAKPYASLSLSIGVIFMWSYVYGIMRMYANKSIESS-TTGVNSPRDTSETVSG--SCTQAALPSSDCNTSHLPRTISS------ESSTRMSGLMKIMMRIKMISGKIDLKKMFAPAAIAAIVGFIIGAASPIRKLMIGNSAPLRVIDGCAHILGEATIPCVTLIMGANLLIGLKGSDVSRNVIIGIIAVRNIFLPLSGIGVVKAAHHFGLVGSDSLYQFVLMLQYAVPPAMSIGTMTQFFQLGQGETSVIMLWTYAVAAVTLTLWSTFFMWLL 407          
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: A0A061FPG6_THECC (Auxin efflux carrier family protein OS=Theobroma cacao GN=TCM_043525 PE=4 SV=1)

HSP 1 Score: 504.597 bits (1298), Expect = 4.743e-170
Identity = 259/416 (62.26%), Postives = 331/416 (79.57%), Query Frame = -2
Query:  186 MGFLDLLLVALIPVIKVLFITGVGLFLALDHVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLL 1433
            MGFL+LL+VA++PV+K++ IT +GL LALD + LLGP+A +H+N IVFYVF PAL A++LA+T+T++SL TLWFMPVN+LLTF++GSALAWLLIKITRTPKHLQG+VIGCCSAGNLGNLPLI+VP+VCEE +NPFG+ S C +NA+ YASLS++ GAIFIWSYVYGIMR YAN   E+  T  INS      SE+    C + +LPS +   +    ++        E   K+S L+K    + M   KI+LK+VFAP+A+A +VGF IG VSPIR+++IG  APLRVI++S  +LG+ T+ CMTL++GANLL GL  SD+  ++IIGIIAVRN+F+PL GIGVV AA H GLVG+D+L+QFVLMLQYA+PPAMA+GTMTQ FQ+GQ E+S+IMLWTYV+AA +LTLWST+FMWLL
Sbjct:    1 MGFLNLLIVAVMPVLKIILITAIGLLLALDRLKLLGPEANHHMNNIVFYVFSPALAASSLAETVTFKSLTTLWFMPVNLLLTFVLGSALAWLLIKITRTPKHLQGIVIGCCSAGNLGNLPLIMVPAVCEEPSNPFGDPSVCSTNAKPYASLSLSIGAIFIWSYVYGIMRMYANKSNESS-TTGINSPIDT--SETVPGGCTQAVLPSSNCNTSYLPRTISG------ERSTKMSGLKKIMPRVKMISGKIDLKKVFAPTAVAAIVGFIIGAVSPIRKLMIGKSAPLRVIDSSAYILGEATIPCMTLIMGANLLIGLKGSDVSRTVIIGIIAVRNIFLPLSGIGVVKAAHHFGLVGSDSLYQFVLMLQYAVPPAMAIGTMTQFFQLGQGETSMIMLWTYVIAAVTLTLWSTLFMWLL 407          
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: U5GX65_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s46060g PE=4 SV=1)

HSP 1 Score: 499.59 bits (1285), Expect = 3.884e-168
Identity = 251/416 (60.34%), Postives = 318/416 (76.44%), Query Frame = -2
Query:  186 MGFLDLLLVALIPVIKVLFITGVGLFLALDHVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLL 1433
            MGFLDL +VA++PV+KVL IT VGLFLALD ++LLG  AR +LN ++FYVF PALV++ LA TIT +SL +LWFMPVNILLTF+IGS LAW+LIKITRTP HLQG+VIGCCSAGNLGNL LIIVP+VC ESN+PFG+S+ C S   AYASLSMA GAI+IW+YVY IMR YA+N  E   T N++ +   SY+E+        LLPS +  +  D +SV  +        +K++ + + F          NLK+VFAP+ IA M GF IGT+SPIR+++IG  APLRV+E+S +LLG  ++ CM L++G+NLLKGL RS+I  S+I GI+ VRN F+PL+GIG+V AA H GLVG+D+L+QF+L+LQYALPPAMA+G M QLF+ G+SE SVIMLW YV+AAFSLTLWST +MWLL
Sbjct:    1 MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQLAGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLLLIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIYIWTYVYIIMRIYADNSAEN--TKNVSIADSESYTEA--------LLPSSEKSSCHD-HSVHAELPETMSEGKKVTFMERTFWNFKKFAANTNLKKVFAPATIAAMFGFVIGTISPIRKVIIGDSAPLRVLESSASLLGQASIPCMALIMGSNLLKGLRRSEISVSVIAGIVVVRNFFLPLIGIGIVKAAHHFGLVGSDSLYQFILLLQYALPPAMAIGVMAQLFKAGESECSVIMLWCYVLAAFSLTLWSTFYMWLL 405          
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: D7U495_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_04s0044g01860 PE=4 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.650e-167
Identity = 252/421 (59.86%), Postives = 324/421 (76.96%), Query Frame = -2
Query:  186 MGFLDLLLVALIPVIKVLFITGVGLFLALDHVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDL-----ETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLL 1433
            MGFL L +VAL+P++KVL +TGVGL +AL+ ++LLG +AR +LN IVFYVF PALV++NLA+TIT+ SLVT+WFMPVNILLTF+IGSAL W+LIKITRTP+HLQG+V+GCCSAGNLGNL LII+P++CEE +NPFG+S  C +N +AYASLS+A GAI IWSYVY IMR  AN  K+    IN++ S  +  +  +      E C E LLPSKD  ++ +     +  H   E ++K+  L K  Q + + M+KI+LK+VFAPS I  +VGFFIG +SPIR+++IG  APL VIE+S   +G+  V   TL++GANLLKGL  SD+   +I+GI+AVR + +PLLG+ VV AA H GLVG+++LFQFVLMLQYALPPAM+ GTM+QLF+ GQSE SVIMLWTY VAAFSLTLWS+ FMWL+
Sbjct:    1 MGFLSLFVVALVPILKVLLVTGVGLLIALERIDLLGANARRNLNAIVFYVFNPALVSSNLAKTITFSSLVTMWFMPVNILLTFVIGSALGWVLIKITRTPQHLQGLVLGCCSAGNLGNLLLIIIPAICEEEDNPFGDSD-CSTNGEAYASLSLAIGAIGIWSYVYTIMRISANKCKK---EINLDDSTISIRTSGETLEILSEGCTEALLPSKDCPSSRECSDEVELAHAGSEGKQKVPFLEKIKQQVEILMEKIDLKKVFAPSTIGVIVGFFIGLISPIRKLIIGDSAPLHVIESSAYFVGEAAVPSTTLIMGANLLKGLKGSDVSIVVILGIMAVRYIALPLLGVVVVKAAHHFGLVGSNSLFQFVLMLQYALPPAMSTGTMSQLFEFGQSECSVIMLWTYAVAAFSLTLWSSFFMWLV 417          
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Match: U5GUR2_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s46060g PE=4 SV=1)

HSP 1 Score: 497.278 bits (1279), Expect = 3.383e-167
Identity = 250/416 (60.10%), Postives = 317/416 (76.20%), Query Frame = -2
Query:  186 MGFLDLLLVALIPVIKVLFITGVGLFLALDHVNLLGPDARNHLNKIVFYVFGPALVATNLAQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLPLIIVPSVCEESNNPFGESSTCFSNAQAYASLSMATGAIFIWSYVYGIMRSYANNYKEAGLTININSSQKNSYSESDLETCREPLLPSKDWVAASDEYSVQQQPHGNFETQEKISALRKRFQCITMTMKKINLKEVFAPSAIAGMVGFFIGTVSPIRQILIGADAPLRVIENSINLLGDPTVACMTLLVGANLLKGLTRSDIRPSXXXXXIAVRNVFMPLLGIGVVNAAQHLGLVGTDALFQFVLMLQYALPPAMAVGTMTQLFQMGQSESSVIMLWTYVVAAFSLTLWSTVFMWLL 1433
            MGFLDL +VA++PV+KVL IT VGLFLALD ++LLG  AR +LN ++FYVF PALV++ LA TIT +SL +LWFMPVNILLTF+IGS LAW+LIKITRTP HLQG+VIGCCSAGNLGNL LIIVP+VC ESN+PFG+S+ C S   AYASLSMA GAI+IW+YVY IMR YA+N  E   T N++ +   SY+E+        LLPS +  +  D     + P     ++ K++ + + F          NLK+VFAP+ IA M GF IGT+SPIR+++IG  APLRV+E+S +LLG  ++ CM L++G+NLLKGL RS+I  S+I GI+ VRN F+PL+GIG+V AA H GLVG+D+L+QF+L+LQYALPPAMA+G M QLF+ G+SE SVIMLW YV+AAFSLTLWST +MWLL
Sbjct:    1 MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQLAGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLLLIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIYIWTYVYIIMRIYADNSAEN--TKNVSIADSESYTEA--------LLPSSEKSSCHDHSVHAELPET--MSEGKVTFMERTFWNFKKFAANTNLKKVFAPATIAAMFGFVIGTISPIRKVIIGDSAPLRVLESSASLLGQASIPCMALIMGSNLLKGLRRSEISVSVIAGIVVVRNFFLPLIGIGIVKAAHHFGLVGSDSLYQFILLLQYALPPAMAIGVMAQLFKAGESECSVIMLWCYVLAAFSLTLWSTFYMWLL 404          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092928 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PJ03_GOSAR0.000e+099.28Putative transporter C5D6.04 OS=Gossypium arboreum... [more]
A0A0D2SB33_GOSRA0.000e+098.32Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2TUD1_GOSRA0.000e+098.54Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FVW9_THECC1.839e-17863.79Auxin efflux carrier family protein OS=Theobroma c... [more]
A0A061FVX8_THECC2.361e-17660.99Auxin efflux carrier family protein OS=Theobroma c... [more]
A0A061FPZ3_THECC4.052e-17159.86Auxin efflux carrier family protein OS=Theobroma c... [more]
A0A061FPG6_THECC4.743e-17062.26Auxin efflux carrier family protein OS=Theobroma c... [more]
U5GX65_POPTR3.884e-16860.34Uncharacterized protein OS=Populus trichocarpa GN=... [more]
D7U495_VITVI1.650e-16759.86Putative uncharacterized protein OS=Vitis vinifera... [more]
U5GUR2_POPTR3.383e-16760.10Uncharacterized protein OS=Populus trichocarpa GN=... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004776Membrane transport proteinPFAMPF03547Mem_transcoord: 31..428
e-value: 1.6E-67
score: 227.4
NoneNo IPR availablePANTHERPTHR31651:SF6SUBFAMILY NOT NAMEDcoord: 22..436
NoneNo IPR availablePANTHERPTHR31651FAMILY NOT NAMEDcoord: 22..436
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 27..54
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 167..186
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 66..86
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 368..378
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 115..125
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 296..314
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 315..333
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 187..274
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..26
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 345..367
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 126..147
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 437..437
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 55..65
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 415..436
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 87..91
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 334..344
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 379..403
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 92..114
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 404..414
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 148..166
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 275..295
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
NoneNo IPR availableTMHMMTMhelixcoord: 275..297
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 165..187
NoneNo IPR availableTMHMMTMhelixcoord: 412..434
NoneNo IPR availableTMHMMTMhelixcoord: 346..368
NoneNo IPR availableTMHMMTMhelixcoord: 378..400
NoneNo IPR availableTMHMMTMhelixcoord: 312..333
NoneNo IPR availableTMHMMTMhelixcoord: 89..111

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092928 ID=g.barbadense_cottongen_reftransV1_0092928|Name=g.barbadense_cottongen_reftransV1_0092928|organism=Gossypium barbadense|type=contig|length=1998bp
TTTTGATAAATACTCCATTTCAAAATAATAATCGGAATAAATCTACCTAT
AGGAGATGGTAGGAAGAGAGAAGGAATTTGATTTCCATGTCAATGAGATT
CAGTACTTGAGAAAAAGTAAAATATTAAGTTCGTCAATAGAGAAACATGT
ATATGTGAACCAATAATTTCCAAACCAAATCAAAATAAAAGCCACATGAA
AACCGTTGACCAAAGGGTGAGGGAGAATGCTGCTACAACATATGTCCATA
GCATTATTACTGAACTTTCACTTTGACCCATCTGAAATAGTTGTGTCATT
GTGCCTACAGCCATGGCAGGCGGAAGGGCATACTGAAGCATTAGAACAAA
CTGGAACAAGGCGTCTGTTCCAACCAAGCCCAAATGCTGTGCAGCATTAA
CAACACCGATGCCCAAGAGAGGCATGAATACGTTCCTCACAGCTATTATC
CCTATAATGATTGAAGGACGAATATCTGATCTTGTTAAACCTTTTAGAAG
ATTTGCTCCCACCAGCAAGGTCATACATGCAACTGTTGGGTCCCCAAGCA
AATTTATAGAATTCTCGATAACACGAAGAGGAGCATCGGCACCAATTAGG
ATTTGTCGGATTGGTGAGACTGTCCCGATGAAGAATCCAACCATTCCTGC
AATTGCTGATGGTGCAAACACTTCCTTTAGGTTAATCTTCTTCATGGTCA
TAGTTATGCATTGAAATCTCTTCCTCAAAGCTGAAATCTTTTCTTGTGTT
TCAAAATTGCCGTGAGGCTGTTGTTGTACTGAATATTCATCTGAAGCAGC
AACCCAATCCTTTGAGGGTAGTAAAGGTTCTCGGCAAGTTTCCAAATCTG
ATTCCGAGTAGGAATTTTTTTGTGAAGAGTTGATGTTGATGGTTAACCCA
GCTTCTTTGTAGTTGTTTGCGTATGAACGCATAATGCCATACACATATGA
CCATATAAAGATGGCTCCTGTCGCCATAGACAGTGAAGCATAGGCCTGGG
CATTTGAAAAACAAGTGGATGATTCTCCAAATGGATTATTTGATTCCTCA
CAGACTGAAGGAACTATAATGAGTGGCAAATTTCCTAAATTCCCAGCAGA
ACAACAACCAATGACCATGCCTTGGAGGTGTTTAGGAGTTCTAGTGATTT
TTATAAGAAGCCAAGCAAGTGCTGACCCAATCATGAATGTGAGCAAAATA
TTCACCGGCATGAACCACAATGTCACTAAGCTTTCATAGGTTATGGTTTG
AGCCAAGTTCGTTGCCACAAGTGCAGGGCCAAACACATAGAATACAATTT
TGTTCAAATGGTTTCTGGCGTCTGGTCCCAACAGATTGACATGATCTAAA
GCAAGAAACAAGCCAACTCCGGTAATGAAAAGCACTTTTATAACCGGAAT
CAGTGCCACAAGGAGTAGATCAAGGAATCCCATTAGCCTATACTCACACC
TGATCTTCAACTTGATTATTCCACTTGTACATCCAATAAACAATCAATAT
TCAAAGTCCTAAAAGACTTGATTTAACAACTTCCATCTATCGTCAATGCC
ACCAAGTAGATGGAGACCGTAGGTGGCGTCAAGCCCTTAATACTTGGAAC
TATCACTGGCCCCCCTGTTTTTTTTATTAAGTGTTGTTATCATACGAGAA
GCTTCATTTGCATTCTTTAAGCAGCCTCAAGCACGTTAAAATGCCCCAGC
CGCGGCCGCTGCAACTTATCCGACGCTGATGGAGACTGAGATGATAAGTC
CTGCTAAACCGGATGTTCTCCTTCTCTCGTCTTTCGGATCAAAGGAATGG
TTGGGAAAGATCTAAGGTTGGATGGTAATGGGAGGTGGATGGGTTAATAG
AATAGTGGAGGGTTTTGTAATGGAGATGAGGGAGGGTTGTGACAATACTA
GTTATAAAGGGAGATTGGGAGATCTGGCAGAGGAGCTGGTAAGCCTGTGC
TGTCGGGCTATATGGTGGCTAGCCACTAGGAAAGCAGTGTTCTTTTTG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR004776Mem_trans
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral to membrane
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport