g.barbadense_cottongen_reftransV1_0092927, g.barbadense_cottongen_reftransV1_0092927 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092927
Unique Nameg.barbadense_cottongen_reftransV1_0092927
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length1907
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: Y2267_ARATH (Probable inactive receptor kinase At2g26730 OS=Arabidopsis thaliana GN=At2g26730 PE=1 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 1.474e-118
Identity = 181/271 (66.79%), Postives = 221/271 (81.55%), Query Frame = 3
Query: 1107 GTSSSKDDITGGST----EIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            G SSSK+++TG S+    E ER   NKLVF +G VYSFDLEDL+RASAE+LGKGS GTSY+ VL  GTTV VKRLKDV  SK+EF  +M ++GKI H NV+PLRA+YYS +EKLLV+D+M  GSL ALLHGSR S  TPL+WD+RM+IA++ ARGLAHLH S  ++HGNIK+SNILL P+ +T +S++GLN LF+ ++PP+R+AGY APEV++T KVT KSDVYSFGVLLLELLTG++P Q S+ EEG DLPRWV SVVREEW AEVFD E
Sbjct:  310 GASSSKEEVTGTSSGMGGETER---NKLVFTEGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVMASKKEFETQMEVVGKIKHPNVIPLRAYYYSKDEKLLVFDFMPTGSLSALLHGSRGSGRTPLDWDNRMRIAITAARGLAHLHVSAKLVHGNIKASNILLHPNQDTCVSDYGLNQLFSNSSPPNRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVE 577          

HSP 2 Score: 257.299 bits (656), Expect = 3.073e-74
Identity = 132/203 (65.02%), Postives = 159/203 (78.33%), Query Frame = 3
Query:  249 RVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGG 857
            RV+SE   +KQALL F+  I H +R++WN S SAC+W GV+C++N+S +++LRLPG  L+G I   ++GRL  LRVLSLR+NRLSG+IP+DFSNLT LRSLYLQ NEF+G FP S T+L  L RLD+SSNNFTG IP  VN+LT LTGLFL NN FSG+LPSI S GL DFNVSNNNL GSIP SLS+F   SF GN+ LCGG
Sbjct:   20 RVNSESTAEKQALLTFLQQIPHENRLQWNESDSACNWVGVECNSNQSSIHSLRLPGTGLVGQIPSGSLGRLTELRVLSLRSNRLSGQIPSDFSNLTHLRSLYLQHNEFSGEFPTSFTQLNNLIRLDISSNNFTGSIPFSVNNLTHLTGLFLGNNGFSGNLPSI-SLGLVDFNVSNNNLNGSIPSSLSRFSAESFTGNVDLCGG 221          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: Y1421_ARATH (Putative inactive receptor-like protein kinase At1g64210 OS=Arabidopsis thaliana GN=At1g64210 PE=3 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 5.916e-101
Identity = 212/561 (37.79%), Postives = 298/561 (53.12%), Query Frame = 3
Query:  252 VSSEPVED-KQALLAFISGIRHADRVKWNSSTSAC-DWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPD-SLSKFPESSFAGNIGLCGGXXXXXXXXXXXXXXXXXXXXKTSGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVH-TPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRI-AGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPS----ITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            +SS+ +ED K+ALL F+S   ++ R+ WN S+  C  W GV C+ N   + ++RLP     G I P TI RL+ L+ LSLR N  +G+ P+DF+NL  L  LYLQ N  +GP     + L  L  LDLS+N F G IP  ++ LT L  L                      N++NN+  G IP+  L K  + + + N  L G              P      ++S  S  +L                  LL+    C+      S         T  +G   +  +SS   + T      E     K++FF G  + FDL+DL+ +SAE+LGKG+ GT+Y+V +   +TV VKRLK+V V +REF  +M ++G I HENV  L+A+YYS ++KL VY Y + GSLF +LHG+R   H  PL+WD R++IA   ARGLA +H  +  IHGNIKSSNI L       I + GL ++  +    + + +GY APE+  T + T  SDVYSFGV+LLELLTG++P+  +       E  DL  W++SVV +EW  EVFD E
Sbjct:   17 ISSQTLEDDKKALLHFLSSF-NSSRLHWNQSSDVCHSWTGVTCNENGDRIVSVRLPAVGFNGLIPPFTISRLSSLKFLSLRKNHFTGDFPSDFTNLKSLTHLYLQHNHLSGPLLAIFSELKNLKVLDLSNNGFNGSIPTSLSGLTSLQVL----------------------NLANNSFSGEIPNLHLPKLSQINLSNN-KLIG------------TIPKSLQRFQSSAFSGNNLTERKKQRKTPFGLSQLAFLLILSAACVLCVSGLSFIMITCFGKTRISGKLRKRDSSSPPGNWTSRDDNTEE--GGKIIFFGGRNHLFDLDDLLSSSAEVLGKGAFGTTYKVTMEDMSTVVVKRLKEVVVGRREFEQQMEIIGMIRHENVAELKAYYYSKDDKLAVYSYYNHGSLFEILHGNRGRYHRVPLDWDARLRIATGAARGLAKIHEGK-FIHGNIKSSNIFLDSQCYGCIGDVGLTTIMRSLPQTTCLTSGYHAPEITDTRRSTQFSDVYSFGVVLLELLTGKSPVSQAELVPTGGENMDLASWIRSVVAKEWTGEVFDME 538          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: Y5830_ARATH (Probable inactive receptor kinase At5g58300 OS=Arabidopsis thaliana GN=At5g58300 PE=2 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.064e-91
Identity = 151/269 (56.13%), Postives = 196/269 (72.86%), Query Frame = 3
Query: 1110 TSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKI-MHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSS--QNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            T  +K +   G  E E+   NKLVFF G  Y+FDLEDL+RASAE+LGKGS GT+Y+ VL   TTV VKRLK+VA  KREF  +M ++ ++  H +VVPLRA+YYS +EKL+V DY   G+L +LLHG+R S  TPL+WD R+KI LS A+G+AHLH++      HGNIKSSN++++ + +  IS+FGL  L      P R AGY+APEV++T K T KSDVYSFGVL+LE+LTG++P+Q    ++  DLPRWVQSVVREEW +EVFD E
Sbjct:  322 TEKAKQEFGSGVQEPEK---NKLVFFNGCSYNFDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVAAGKREFEQQMEIISRVGNHPSVVPLRAYYYSKDEKLMVCDYYPAGNLSSLLHGNRGSEKTPLDWDSRVKITLSAAKGIAHLHAAGGPKFSHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGAGYRAPEVMETRKHTHKSDVYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDIE 587          

HSP 2 Score: 189.119 bits (479), Expect = 4.720e-50
Identity = 99/195 (50.77%), Postives = 129/195 (66.15%), Query Frame = 3
Query:  273 DKQALLAFISGIRHADRVKWNSSTSACD-WFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCG 854
            D+QALLAF + + H  R+ WNS+   C  W GV C ++ + V+ LRLPG  L+G I PNT+G+L  LR+LSLR+N LSG +P D  +L  L  +YLQ N F+G  P  V+R   +   DLS N+FTG IP    +L QLTGL LQNNK SG +P++D+  L   N+SNN+L GSIP +L  FP SSF+GN  LCG
Sbjct:   48 DRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGTSVHALRLPGIGLLGPIPPNTLGKLESLRILSLRSNLLSGNLPPDIHSLPSLDYIYLQHNNFSGEVPSFVSRQLNIL--DLSFNSFTGKIPATFQNLKQLTGLSLQNNKLSGPVPNLDTVSLRRLNLSNNHLNGSIPSALGGFPSSSFSGNTLLCG 240          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: Y3868_ARATH (Probable inactive receptor kinase At3g08680 OS=Arabidopsis thaliana GN=At3g08680 PE=1 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 3.551e-88
Identity = 152/279 (54.48%), Postives = 198/279 (70.97%), Query Frame = 3
Query: 1086 AGPEEEAGTSSSK-DDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIM-HENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQ--NMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNT-PPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            A P+ + G S +K ++   G  E E+   NKLVFF+GS Y+FDLEDL+RASAE+LGKGS GT+Y+ +L  GTTV VKRLK+VA  KREF  +M  +G+I  H NV PLRA+Y+S +EKLLVYDY  GG+   LLHG+       L+W+ R++I L  ARG++H+HS+    ++HGNIKS N+LL  +    +S+FG+  L + +T  PSR  GY+APE I+T K T KSDVYSFGVLLLE+LTG+A  + +  EE  DLP+WVQSVVREEW  EVFD E
Sbjct:  296 AVPKAKPGRSDNKAEEFGSGVQEAEK---NKLVFFEGSSYNFDLEDLLRASAEVLGKGSYGTTYKAILEEGTTVVVKRLKEVAAGKREFEQQMEAVGRISPHVNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRAALDWETRLRICLEAARGISHIHSASGAKLLHGNIKSPNVLLTQELHVCVSDFGIAPLMSHHTLIPSRSLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVE 571          

HSP 2 Score: 162.155 bits (409), Expect = 3.889e-41
Identity = 94/206 (45.63%), Postives = 125/206 (60.68%), Query Frame = 3
Query:  246 SRVSSEPVE-DKQALLAFISGIRHADRVKWNSSTSAC-DWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGG 857
            SR  S  +E DKQALL F S + H+ ++ WNS+   C  W G+ C  N + V  LRLPG+ L G +   T  +L+ LR++SLR+N L G IP+   +L  +RSLY   N F+G  PP +    RL  LDLS+N+ +G IP  + +LTQLT L LQNN  SG +P++    L   N+S NNL GS+P S+  FP SSF GN  LCG 
Sbjct:   18 SRCLSADIESDKQALLEFASLVPHSRKLNWNSTIPICASWTGITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSNHLQGNIPSVILSLPFIRSLYFHENNFSGTIPPVL--SHRLVNLDLSANSLSGNIPTSLQNLTQLTDLSLQNNSLSGPIPNLPPR-LKYLNLSFNNLNGSVPSSVKSFPASSFQGNSLLCGA 220          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: Y4374_ARATH (Probable inactive receptor kinase At4g23740 OS=Arabidopsis thaliana GN=At4g23740 PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 4.125e-87
Identity = 145/257 (56.42%), Postives = 187/257 (72.76%), Query Frame = 3
Query: 1152 IERM--MNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQN--MIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPP-SRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            + RM  +NN+L FF+G  YSFDLEDL+RASAE+LGKG+ GT+Y+ VL   T+VAVKRLKDVA  KR+F  +M ++G I HENVV L+A+YYS +EKL+VYDY   GS+ +LLHG+R     PL+W+ RMKIA+  A+G+A +H   N  ++HGNIKSSNI L  +    +S+ GL ++ +   PP SR AGY+APEV  T K +  SDVYSFGV+LLELLTG++PI  +  +E   L RWV SVVREEW AEVFD E
Sbjct:  310 VSRMEDVNNRLSFFEGCNYSFDLEDLLRASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIE 566          

HSP 2 Score: 155.992 bits (393), Expect = 5.028e-39
Identity = 86/197 (43.65%), Postives = 121/197 (61.42%), Query Frame = 3
Query:  255 SSEPVEDKQALLAFISGIRHADRVKWNSSTSACD-WFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDS-DGLNDFNVSNN-NLKGSIPDSLSKFPESSFAG 836
            +S+P+EDK+ALL F++ ++    + WN ++  C+ W GV C+ + S +  +RLPG  L G I PNTI RL+ LRVLSLR+N +SGE P DF  L  L  LYLQ N  +GP P   +    LT ++LS+N F G IP  ++ L ++  L L NN  SG +P +     L   ++SNN +L G IPD L +FP SS+ G
Sbjct:   23 NSDPLEDKRALLEFLTIMQPTRSLNWNETSQVCNIWTGVTCNQDGSRIIAVRLPGVGLNGQIPPNTISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSGDIPDLSVLSSLQHIDLSNNYDLAGPIPDWLRRFPFSSYTG 219          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: Y1848_ARATH (Probable inactive receptor kinase At1g48480 OS=Arabidopsis thaliana GN=RKL1 PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 5.815e-86
Identity = 142/247 (57.49%), Postives = 183/247 (74.09%), Query Frame = 3
Query: 1173 KLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSS-QNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTN-TPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            KLVFF  +   FDLEDL+RASAE+LGKG+ GT+Y+ VL   T VAVKRLKDV ++ +EF  K+ ++G + HEN+VPLRA+Y+S +EKLLVYD+M  GSL ALLHG+R +  +PL WD R +IA+  ARGL +LHS   +  HGNIKSSNILL   H+  +S+FGL  L  ++ T P+R  GY+APEV    +V+ K DVYSFGV+LLEL+TG+AP    + EEG DLPRWV+SV R+EW  EVFD+E
Sbjct:  353 KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFKEKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHGNRGAGRSPLNWDVRSRIAIGAARGLDYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSATNPNRATGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWRREVFDSE 599          

HSP 2 Score: 159.844 bits (403), Expect = 2.216e-40
Identity = 96/195 (49.23%), Postives = 122/195 (62.56%), Query Frame = 3
Query:  273 DKQALLAFISGIRHADRVKWN-SSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCG 854
            D+ ALL+  S +      +WN   TS C+W GV+C++NR  V  LRLPG AL G I     G L +LR LSLR N LSG +P D S  + LR LYLQGN F+G  P  +  L+ L RL+L+SN+FTG I  G  +LT+L  LFL+NN+ SGS+P +D   L  FNVSNN+L GSIP +L +F   SF     LCG
Sbjct:   36 DRTALLSLRSAV-GGRTFRWNIKQTSPCNWAGVKCESNR--VTALRLPGVALSGDIPEGIFGNLTQLRTLSLRLNALSGSLPKDLSTSSNLRHLYLQGNRFSGEIPEVLFSLSHLVRLNLASNSFTGEISSGFTNLTKLKTLFLENNQLSGSIPDLDLP-LVQFNVSNNSLNGSIPKNLQRFESDSFL-QTSLCG 225          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: RLK90_ARATH (Probable inactive receptor kinase RLK902 OS=Arabidopsis thaliana GN=RLK902 PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 4.923e-84
Identity = 143/247 (57.89%), Postives = 181/247 (73.28%), Query Frame = 3
Query: 1173 KLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNM-IHGNIKSSNILLRPDHETYISEFGLNSLFN-TNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            KLVFF  +   FDLEDL+RASAE+LGKG+ GT+Y+ VL   T VAVKRLKDV ++ REF  K+ ++G + HEN+VPLRA+YYS +EKLLVYD+M  GSL ALLHG++ +   PL W+ R  IAL  ARGL +LHS   +  HGN+KSSNILL   H+  +S+FGL  L + ++T P+R  GY+APEV    +V+ K+DVYSFGV+LLELLTG+AP    + EEG DL RWV SV REEW  EVFD+E
Sbjct:  347 KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFKEKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEVRSGIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWRNEVFDSE 593          

HSP 2 Score: 139.428 bits (350), Expect = 2.149e-33
Identity = 91/195 (46.67%), Postives = 112/195 (57.44%), Query Frame = 3
Query:  273 DKQALLAFISGIRHADRVKWN-SSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCG 854
            DK ALL+F S +     + W+   TS C+W GV CD  R  V  LRLPG  L G I     G L +LR LSLR N L+G +P D  + + LR LYLQGN F+G  P  +  L+ L RL+L+ N F+G I  G  +LT+L  L+L+NNK S          L+ FNVSNN L GSIP SL KF   SF G   LCG
Sbjct:   34 DKSALLSFRSAV-GGRTLLWDVKQTSPCNWTGVLCDGGR--VTALRLPGETLSGHIPEGIFGNLTQLRTLSLRLNGLTGSLPLDLGSCSDLRRLYLQGNRFSGEIPEVLFSLSNLVRLNLAENEFSGEISSGFKNLTRLKTLYLENNKLS-GSLLDLDLSLDQFNVSNNLLNGSIPKSLQKFDSDSFVGT-SLCG 223          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: IMK3_ARATH (Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.759e-79
Identity = 200/490 (40.82%), Postives = 282/490 (57.55%), Query Frame = 3
Query:  468 LRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLP-SI-DSDGLNDFNVSNNNLKGSIPDSLS-KFPESSFAGNIGLCGGXXXXXXXXXXXXXXXXXXXXKTSGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKD-VAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDE-EKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIA-----GYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            LRVLSL  N LSG  P    NLTQL+      N   G  P  +++LT+L ++D+S N+ +G IP  + +++ L  L L  NK +G +P SI D + LN FNVS NNL G +P  LS KF  SSF GN  LCG      +   P P+   P P K    S ++L T  II IA G+ ++ +L+L+ ++ CL + K            T   G E   G  ++K +  GG  E       KLV F G + +F  +DL+ A+AE++GK + GT Y+  L  G+ VAVKRL++ +  S++EF  ++ +LG+I H N++ LRA+Y   + EKL+V+DYM  GSL   LH     VH  + W  RM +   +ARGL +LH+  N+IHGN+ SSN+LL  +    IS++GL+ L       S IA     GY+APE+ +  K   K+DVYS GV++LELLTG++   PS    G DLP+WV + V+EEW  EVFD E
Sbjct:  248 LRVLSLDHNSLSGPFPFSLCNLTQLQDFSFSHNRIRGTLPSELSKLTKLRKMDISGNSVSGHIPETLGNISSLIHLDLSQNKLTGEIPISISDLESLNFFNVSYNNLSGPVPTLLSQKFNSSSFVGNSLLCG-----YSVSTPCPTLPSPSPEKERKPSHRNLSTKDIILIASGALLIVMLILVCVLCCLLRKKAN---------ETKAKGGEAGPGAVAAKTE-KGGEAEAGGETGGKLVHFDGPM-AFTADDLLCATAEIMGKSTYGTVYKATLEDGSQVAVKRLREKITKSQKEFENEINVLGRIRHPNLLALRAYYLGPKGEKLVVFDYMSRGSLATFLHARGPDVH--INWPTRMSLIKGMARGLFYLHTHANIIHGNLTSSNVLLDENITAKISDYGLSRLMTAAAGSSVIATAGALGYRAPELSKLKKANTKTDVYSLGVIILELLTGKS---PSEALNGVDLPQWVATAVKEEWTNEVFDLE 716          

HSP 2 Score: 62.7734 bits (151), Expect = 7.165e-9
Identity = 61/217 (28.11%), Postives = 96/217 (44.24%), Query Frame = 3
Query:  330 WNSST-SACD--WFGVQCDANRSFVYTLRLPGAALIGSI-----------------------LPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDG-----------------------------LNDFNVSNNNLKGSIPDSLSKF 815
            WN S  SAC   W G++C   +  V  ++LP  +L G I                       +P ++G +  LR + L  NRL+G IPA       L++L L  N  +   PP++   ++L RL+LS N+ +G IP+ ++  + L  L L +N  SG  P +D+ G                             L DF+ S+N ++G++P  LSK 
Sbjct:   81 WNGSGFSACSGGWAGIKCAQGQ--VIVIQLPWKSLGGRISEKIGQLQALRKLSLHDNNLGGSIPMSLGLIPNLRGVQLFNNRLTGSIPASLGVSHFLQTLDLSNNLLSEIIPPNLADSSKLLRLNLSFNSLSGQIPVSLSRSSSLQFLALDHNNLSG--PILDTWGSKSLNLRVLSLDHNSLSGPFPFSLCNLTQLQDFSFSHNRIRGTLPSELSKL 293          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: Y5516_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g05160 OS=Arabidopsis thaliana GN=At5g05160 PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 3.268e-79
Identity = 143/272 (52.57%), Postives = 191/272 (70.22%), Query Frame = 3
Query: 1107 GTSSSK-DDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKI-MHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPI-QPSITEEG--FDLPRWVQSVVREEWAAEVFDAE 1907
            G +S K  D   G  + E+   NKL FF+   ++FDLEDL++ASAE+LGKGS GT+Y+ VL   T V VKRL++V  SK+EF  +M ++GKI  H N VPL A+YYS +EKLLVY YM  GSLF ++HG+R      ++W+ RMKIA   ++ +++LHS +  +HG+IKSSNILL  D E  +S+  L +LFN  T   R  GY APEVI+T +V+ +SDVYSFGV++LE+LTG+ P+ QP + +E    DLPRWV+SVVREEW AEVFD E
Sbjct:  309 GVNSKKPQDFGSGVQDPEK---NKLFFFERCNHNFDLEDLLKASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGD--RGVDWETRMKIATGTSKAISYLHSLK-FVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVE 574          

HSP 2 Score: 164.081 bits (414), Expect = 8.507e-42
Identity = 92/208 (44.23%), Postives = 128/208 (61.54%), Query Frame = 3
Query:  252 VSSEPVEDKQALLAFISGIRHADRVKWNSSTSACD-WFGVQCDANR--SFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFP----PSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCG 854
            VS++   D+QALL F + + H  ++ WN + S C  W G+ CD +   S V  +RLPG  L GSI P T+G+L+ L+VLSLR+N L G +P+D  +L  L  LYLQ N F+G       PS+++   +   DLS N+ +G IP G+ +L+Q+T L+LQNN F G + S+D   +   N+S NNL G IP+ L K PE SF GN  LCG
Sbjct:   25 VSADLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDESNPTSRVVAVRLPGVGLYGSIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLPSISKQLVVL--DLSYNSLSGNIPSGLRNLSQITVLYLQNNSFDGPIDSLDLPSVKVVNLSYNNLSGPIPEHLKKSPEYSFIGNSLLCG 230          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Match: Y1680_ARATH (Probable leucine-rich repeat receptor-like protein kinase At1g68400 OS=Arabidopsis thaliana GN=At1g68400 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 5.868e-77
Identity = 139/252 (55.16%), Postives = 177/252 (70.24%), Query Frame = 3
Query: 1173 KLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAV--SKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQ---NMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAP--IQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            K+VFF+G+   F+LEDL+RASAEMLGKG  GT+Y+ VL  G  VAVKRLKD      K+EF  +M +LG++ H N+V L+A+Y++ EEKLLVYDYM  GSLF LLHG+R    TPL+W  R+KIA   ARGLA +H S     + HG+IKS+N+LL       +S+FGL S+F  +   ++  GY+APE+I   K T KSDVYSFGVLLLE+LTG+ P  ++   +    DLPRWVQSVVREEW AEVFD E
Sbjct:  345 KMVFFEGT-RRFELEDLLRASAEMLGKGGFGTAYKAVLEDGNEVAVKRLKDAVTVAGKKEFEQQMEVLGRLRHTNLVSLKAYYFAREEKLLVYDYMPNGSLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLAFIHGSCKTLKLTHGDIKSTNVLLDRSGNARVSDFGL-SIFAPSQTVAKSNGYRAPELIDGRKHTQKSDVYSFGVLLLEILTGKCPNMVETGHSGGAVDLPRWVQSVVREEWTAEVFDLE 594          

HSP 2 Score: 133.65 bits (335), Expect = 2.498e-31
Identity = 93/176 (52.84%), Postives = 116/176 (65.91%), Query Frame = 3
Query:  330 WNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGG 857
            WN++T+ C W GV C+ NR  V  L L    L GSI   ++  L  LRVLSL+ N LSG IP + SNLT L+ L+L  N+F+G FP S+T LTRL RLDLS NNF+G IP  +  LT L  L L++N+FSG +P+I+   L DFNVS NN  G IP+SLS+FPES F  N  LCG 
Sbjct:   51 WNTTTNPCQWTGVSCNRNR--VTRLVLEDINLTGSIS--SLTSLTSLRVLSLKHNNLSGPIP-NLSNLTALKLLFLSNNQFSGNFPTSITSLTRLYRLDLSFNNFSGQIPPDLTDLTHLLTLRLESNRFSGQIPNINLSDLQDFNVSGNNFNGQIPNSLSQFPESVFTQNPSLCGA 221          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: A0A0D2SIU1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G231800 PE=4 SV=1)

HSP 1 Score: 945.266 bits (2442), Expect = 0.000e+0
Identity = 538/554 (97.11%), Postives = 543/554 (98.01%), Query Frame = 3
Query:  246 SRVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGXXXXXXXXXXXXXXXXXXXXKTSGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            SRVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVTRLTRLTRLDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNL GSIPDSLSKFPESSFAGNIGLCGGPL PCNPFPPSPSPTEPIPP TSGQSSKSLPTGAIIAIA+GSAIVALLLLLFLIICLRKWKRKSPRR+KAIPSTTHA PEEEAGTSSSKDDITGGS EIERMMNNKLVFFKG VYSFDLEDLMRASAEMLGKGSTGTSY+VVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALL GSR+SV TPLEWDHR+KIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHE  ISEFGLNSLFNTNTPPSRI GYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE
Sbjct:   19 SRVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVTRLTRLTRLDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLNGSIPDSLSKFPESSFAGNIGLCGGPLPPCNPFPPSPSPTEPIPPTTSGQSSKSLPTGAIIAIALGSAIVALLLLLFLIICLRKWKRKSPRRQKAIPSTTHASPEEEAGTSSSKDDITGGSMEIERMMNNKLVFFKGGVYSFDLEDLMRASAEMLGKGSTGTSYKVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLQGSRNSVRTPLEWDHRIKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHEACISEFGLNSLFNTNTPPSRIGGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 572          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: A0A0B0P0Q7_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_03334 PE=4 SV=1)

HSP 1 Score: 940.258 bits (2429), Expect = 0.000e+0
Identity = 535/553 (96.75%), Postives = 539/553 (97.47%), Query Frame = 3
Query:  249 RVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGXXXXXXXXXXXXXXXXXXXXKTSGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            RVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSI PNTIGRLNRLRVLSLRANRLSGEIPADF NLTQLRSLYLQGNEFTGPFPPSVTRLTRLTRLDLSSNNFTGPIPLGVN+LTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGPLRPCNPFPPSPSPTEPIPP TSGQSSK LPTGAIIAIAVGSAIVALLLLLFLIIC RKWKRKSPRR+KAIPSTTHA P EEAGTSSSKDDITGGSTEIERMMNNKL+FFKG VYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSS  TPLEWD RMKIAL VARGLAHLHSSQNM+HGNIKSSNILLRPDHE  ISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE
Sbjct:   20 RVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSIPPNTIGRLNRLRVLSLRANRLSGEIPADFYNLTQLRSLYLQGNEFTGPFPPSVTRLTRLTRLDLSSNNFTGPIPLGVNNLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGPLRPCNPFPPSPSPTEPIPPTTSGQSSKILPTGAIIAIAVGSAIVALLLLLFLIICYRKWKRKSPRRQKAIPSTTHALPVEEAGTSSSKDDITGGSTEIERMMNNKLMFFKGGVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSARTPLEWDPRMKIALGVARGLAHLHSSQNMVHGNIKSSNILLRPDHEACISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 572          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: A0A061GN08_THECC (Leucine-rich repeat protein kinase family protein OS=Theobroma cacao GN=TCM_037961 PE=4 SV=1)

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 425/554 (76.71%), Postives = 473/554 (85.38%), Query Frame = 3
Query:  252 VSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGG--XXXXXXXXXXXXXXXXXXXXKTSGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            V+SEPV+DKQALLAF+S  +HA+R++WNSSTSACDWFGV+CDANRSFVYTLRLPG  L+GSI PNTIGRLN+LRVLSLRANRLSGEIPADFSNLT LR LYLQGNEF+G FPPSVTRLTRL R+DLSSNNFTGPIP  VN+L  LT LFLQNNKFSGSLPSI+SDGL DFNVSNNNL GSIPD+LSKFPESSFAGN+GLCGG           P+PSP+EPIPP TS + SK L TGAIIAIAVGSA++ALLLLLFLI+CLRK +R+ P+++K + + T A P+ EAGTSSSKDDITGGSTE ER   NKLVFF+G VYSFDLEDL+RASAE+LGKGS GTSY+ VL  GTTV VKRLKDVAVSKREF  +M MLGKI HENVVPLRAFYYS +EKLLVYD+M  GSL ALLHGSR S  TPL+WD RM+IALS ARGL HLH S  ++HGNIKSSNILLRPDHE  IS+FGLN LF   TPPSR+AGY+APEV++T KVT KSDVYSFGVLLLELLTG+AP Q S+ EEG DLPRWVQSVVREEW AEVFD E
Sbjct:   20 VNSEPVQDKQALLAFLSETKHANRIQWNSSTSACDWFGVKCDANRSFVYTLRLPGVGLVGSIPPNTIGRLNQLRVLSLRANRLSGEIPADFSNLTLLRGLYLQGNEFSGRFPPSVTRLTRLARVDLSSNNFTGPIPFAVNNLNLLTRLFLQNNKFSGSLPSINSDGLFDFNVSNNNLNGSIPDTLSKFPESSFAGNLGLCGGPLRPCNPFFPSPAPSPSEPIPPTTSRKRSKKLSTGAIIAIAVGSAVIALLLLLFLILCLRKRQRRPPKQQKPVTAPTRAVPQAEAGTSSSKDDITGGSTEGER---NKLVFFEGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVAVSKREFETQMEMLGKIKHENVVPLRAFYYSKDEKLLVYDFMRDGSLSALLHGSRGSGRTPLDWDSRMRIALSAARGLTHLHVSGKVVHGNIKSSNILLRPDHEACISDFGLNPLFGNTTPPSRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE 570          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: A0A0B0PL07_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_10304 PE=4 SV=1)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 412/554 (74.37%), Postives = 467/554 (84.30%), Query Frame = 3
Query:  252 VSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGXX--XXXXXXXXXXXXXXXXXXKTSGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            V+SEPV+DKQALLAF+S  RH++R++WNSSTSACDW GVQCDANRSFVYTLRLP   L+GSI PNTIGRLN+LRVLSLR N L GEIPADFSNLT LRSLYLQ N FTGPFPPS+T LTRL+RLDLSSNNFTGPIP GVN+LTQLTGLFLQNN+FSGSLPSI+SDGLN+FNV+NN+L GSIPD+LSK+P SSFAGN+GLCGGPL         P+PSP+EPI P TSG+ S++L TGAII IAVGSA   LLLLLFLI+CLRK +R+  +++K + + T A P  EAGTSSSKDDITG STE ER   NKLVFF+G VYSFDLEDL+RASAE+LGKGS GTSY+ VL  GTTV VKRLKDVAVSK+EF M+M  LGKI HENVVPLRAFYYS +EKLLV D+M  GSL ALLHGSR S  TPL WD+RM+IALS ARGLAHLH S  ++HGNIK+SN+LLRPD +  IS+FGLN LF   TPPSR+AGY+APEV++T KVT KSDVYSFGVLLLELLTG+AP Q S+ EEG DLPRWVQSVVREEW AEVFD E
Sbjct:   20 VNSEPVQDKQALLAFLSRTRHSNRIQWNSSTSACDWVGVQCDANRSFVYTLRLPAVGLVGSIPPNTIGRLNQLRVLSLRTNGLFGEIPADFSNLTLLRSLYLQDNAFTGPFPPSLTGLTRLSRLDLSSNNFTGPIPFGVNNLTQLTGLFLQNNRFSGSLPSINSDGLNEFNVANNSLNGSIPDTLSKYPSSSFAGNLGLCGGPLPPCNPFFPSPAPSPSEPISPTTSGKKSRNLSTGAIIGIAVGSAFAVLLLLLFLILCLRKRQRQPSKQQKPVAAGTRAVPPAEAGTSSSKDDITGASTEGER---NKLVFFEGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVAVSKKEFEMQMETLGKIRHENVVPLRAFYYSKDEKLLVSDFMRDGSLSALLHGSRGSGRTPLGWDNRMRIALSTARGLAHLHVSGKVVHGNIKASNVLLRPDQDACISDFGLNPLFGNTTPPSRVAGYRAPEVLETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE 570          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: A0A0D2TC00_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G022300 PE=4 SV=1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 412/554 (74.37%), Postives = 470/554 (84.84%), Query Frame = 3
Query:  252 VSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGXXXXXXX--XXXXXXXXXXXXXKTSGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            V+SEPV+DKQALLAF+S  +H++R++WNSSTSAC+W GVQCDANRSFVYTLRLP   L+GSI PNTIGRLN+LRVLSLRAN L GEIPADFSNLT LRSLYLQ N FTGPFPPS+T LTRL+RLDLSSNNFTGPIP GVN+LTQLTGLFLQNN+FSGSLPSI+SDGLN+F+V+NN+L GSIPD+LSK+  SSFAGN+GLCGGPL PCNP    P+PSP+EPI P TSG+ S++L TGAII IAVGSA  ALLLLLFLI+CLRK +R+  +++K + +   A P  EAGTSSSKDDITG STE ER   NKLVFF+G VYSFDLEDL+RASAE+LGKGS GTSY+ VL  GTTV VKRLKDVAVSK+EF M M  LGKI HENVVPLRAFYYS +EKLLV D+M  GSL ALLHGSR S  TPL WD+RM+IALS ARGLAHLH S  ++HGNIK+SN+LLR D +  IS+FGLN LF  +TPPSR+AGY+APEV++T KVT KSDVYSFGVLLLELLTG+AP Q S+ EEG DLPRWVQSVVREEW AEVFD E
Sbjct:   20 VTSEPVQDKQALLAFLSKTKHSNRIQWNSSTSACNWVGVQCDANRSFVYTLRLPAVGLVGSIPPNTIGRLNQLRVLSLRANGLFGEIPADFSNLTLLRSLYLQDNAFTGPFPPSLTGLTRLSRLDLSSNNFTGPIPFGVNNLTQLTGLFLQNNRFSGSLPSINSDGLNEFDVANNSLNGSIPDTLSKYDASSFAGNLGLCGGPLPPCNPFFPSPAPSPSEPISPSTSGKKSRNLSTGAIIGIAVGSAFAALLLLLFLILCLRKRQRQPSKQQKPVAAGARAVPPAEAGTSSSKDDITGASTEGER---NKLVFFEGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVAVSKKEFEMHMETLGKIRHENVVPLRAFYYSKDEKLLVSDFMRDGSLSALLHGSRGSGRTPLGWDNRMRIALSTARGLAHLHVSGKVVHGNIKASNVLLRSDQDACISDFGLNPLFGNSTPPSRVAGYRAPEVLETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE 570          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: A0A0D2N431_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G003200 PE=4 SV=1)

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 385/552 (69.75%), Postives = 442/552 (80.07%), Query Frame = 3
Query:  252 VSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGXXXXXXXXXXXXXXXXXXXXKTSGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            V+SEPV+DKQALL F+S ++H +RV+WNSSTSACDW GV+CDA RSFV+TLRLPG  L+GSI P TIG LNRLRVLSLRANRLSG +PADFSNLT LR LYLQ N+FTG FP S+TRLTRL RLDLSSNNFTGPIP+GVN+L  LTGLFLQNN FSGSLP+I+SDGL+DF+VSNNNL GSIP +LSKFP SSFAGNIGLCGGPLR C                 + + S  L TGAI+AI VGS +VALL LL LI+ L K +R+  R+ K +   T A P  EAGTSSSKDD+TGGS E E+   NKLVFF+  VYSFDLEDL+RASAE+LGKGS GTSY+ VL  GT V VKRLKDVA SKREF M+M  LGKI HE VVPLRAFYYS +EKLLVY++M  GSL ALLHGSR S HTPL+WD+R+KIALS A+GL++LH SQ + HGNIKSSNILL P+ E  IS++GLN LF   TPPSR+ GY+APEV++T  VT KSDVYSFGVLLLE+LTG++P Q S+ EEG DLPRWVQSVVREEW AEVFDAE
Sbjct:   20 VNSEPVQDKQALLTFLSMVKHENRVQWNSSTSACDWVGVECDATRSFVFTLRLPGVGLVGSIPPKTIGLLNRLRVLSLRANRLSGTVPADFSNLTLLRGLYLQENQFTGSFPSSLTRLTRLVRLDLSSNNFTGPIPVGVNNLAHLTGLFLQNNTFSGSLPAINSDGLDDFDVSNNNLTGSIPYTLSKFPASSFAGNIGLCGGPLRAC---------------NPTYRKSSGLSTGAIVAIVVGSVLVALLFLLCLILFLCKQQRRPDRKEKPVTEETRAAPPAEAGTSSSKDDVTGGSIEREK---NKLVFFESGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTAVVVKRLKDVAASKREFEMQMEKLGKIKHEKVVPLRAFYYSKDEKLLVYEFMPNGSLSALLHGSRGSGHTPLDWDNRIKIALSTAKGLSYLHLSQ-VAHGNIKSSNILLGPNREACISDYGLNPLFGNTTPPSRVTGYRAPEVLETRNVTFKSDVYSFGVLLLEVLTGKSPSQASLGEEGIDLPRWVQSVVREEWTAEVFDAE 552          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: M5VWH1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa002548mg PE=4 SV=1)

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 382/554 (68.95%), Postives = 447/554 (80.69%), Query Frame = 3
Query:  249 RVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGXXXXXXXXXXXXXXXXXXXXKTS-GQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            RV+SEP +DKQALLAF+S   H +RV+WNSS SAC W G+ CDAN+S+V  LRLPG  L+G + PNT+GRL++LRVLSLR+NRL+G IP+DFSNLT LRSLYLQGN+F+G FPP +TRL RLTRLDLSSNNFTGPIP  V +LT LTGLFL+NN+FSGSLPSI +  L  FNVSNN L GSIP SLSKFP+S+F GN+ LCG PL  CNPF P+P+P+   PP     + SK L T AI+AIAVGSA+   LLLL L++C+RK +R+   +    P  T +    EAGTSSSKDDITGGSTE ER   NKLVFF G VYSFDLEDL+RASAE+LGKGS GTSY+ VL  GTTV VKRLKDV V+KREF M+M +LGKI H+NVVPLRAFY+S +EKLLVYDYM  GSL ALLHGSR S  TPL+WD+RMKIALS ARG+AHLH S  ++HGNIKSSNILLRP+H+  +S+FGLN LF T+TPP+R+AGY+APEV++T KVT KSDVYSFGVLLLELLTG+AP Q S+ EEG DLPRWVQSVVREEW AEVFD E
Sbjct:   28 RVNSEPTQDKQALLAFLSQTPHENRVQWNSSVSACTWVGITCDANQSYVSALRLPGVGLVGPVPPNTLGRLSQLRVLSLRSNRLNGPIPSDFSNLTLLRSLYLQGNQFSGEFPPGLTRLVRLTRLDLSSNNFTGPIPFTVTNLTHLTGLFLENNEFSGSLPSISAGNLRSFNVSNNKLNGSIPASLSKFPDSAFTGNLNLCGKPLTACNPFFPAPAPSPSTPPVIPVHKKSKKLSTAAIVAIAVGSALALFLLLLVLLLCIRKRRRQQQAKPPKPPVATRSVAVAEAGTSSSKDDITGGSTEAER---NKLVFFDGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVVVTKREFEMQMEVLGKIKHDNVVPLRAFYFSKDEKLLVYDYMAAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHVSGKVVHGNIKSSNILLRPEHDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE 578          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: D6N3G3_MALDO (Protein kinase OS=Malus domestica PE=4 SV=1)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 378/554 (68.23%), Postives = 446/554 (80.51%), Query Frame = 3
Query:  249 RVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGXXXXXXXXXXXXXXXXXXXXKTS-GQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            RV+SEP++DKQALLAF+S   HA+RV+WN+S SAC W G++CD N+S+VY+LRLPG  L+G + PNT+GRL +LRVLSLR+NRLSG IPADFSNLT LRSLYLQGN+ +G FP  +T+L RL RL LSSNNFTGPIP  V++LT LT L+L+NN FSG LP+I +  L +FNVSNN L GSIP SLSKFP S+F+GN+ LCGGPL+ CNPF P+P+P+   PP     + SK L T AI+AIAVGSA+   LLLL L +CLRK +R+ P +    P  T +  E EAGTSSSKDDITGGSTE ER   NKLVFF G VYSFDLEDL+RASAE+LGKGS GTSY+ VL  GTTV VKRLKDV V+KREF M M +LGKI H+NVVPLRAFY+S +EKLLV DYM  GSL ALLHGSR S  TPL+WD+RMKIALS ARG+AHLH S  ++HGNIKSSNILLRPD++  +S+FGLN LF T+TPP+R+AGY+APEV++T KVT KSDVYSFGVLLLELLTG+AP Q S+ EEG DLPRWVQSVVREEW AEVFD E
Sbjct:   25 RVNSEPIQDKQALLAFLSQTPHANRVQWNASVSACTWVGIKCDDNQSYVYSLRLPGVGLVGPVPPNTLGRLTQLRVLSLRSNRLSGPIPADFSNLTLLRSLYLQGNQLSGEFPTGLTQLERLNRLVLSSNNFTGPIPFAVSNLTHLTVLYLENNGFSGKLPNIQAPNLTNFNVSNNQLNGSIPQSLSKFPASAFSGNLDLCGGPLKACNPFFPAPAPSPESPPIIPVHKKSKKLSTAAIVAIAVGSALALFLLLLVLFLCLRKRRRQQPAKAPKPPVATRS-VETEAGTSSSKDDITGGSTEAER---NKLVFFNGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVVVTKREFEMTMEVLGKIKHDNVVPLRAFYFSKDEKLLVSDYMSAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHVSGKVVHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE 574          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: A0A0D2R590_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G278900 PE=4 SV=1)

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 369/554 (66.61%), Postives = 432/554 (77.98%), Query Frame = 3
Query:  246 SRVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGXXXXXXXXXXXXXXXXXXXXKTSGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXXXAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHETYISEFGLNSLFNTNTPPSRIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            SRV+SEPV+DKQALLAF+S  +H +R++WNSSTSACDW GV+CDANRSFV++LRLPG  L+GSI  NTIGRLN+LRVLSLRANRLSGEIP DFSNLT LR+LYLQ N FTG FP SVTRL RLTRLDLSSN F GPIP  VN+++ LTGLFLQNNKFSGSLPSI++DGL++FNVSNN+L GSIP SLSKFP+SSFAGN  LC G                PIPP+T G+ SK+L  GAII IAVGS I+ALLLLLFLI+      ++  +  K + + T + P  EAGTS       GG+TE ER   NKLVFF+G +YSFDLEDL+RASAE+LGKG+ GTSY+ VL  GT V VKRLKDVA ++R F + M  LGK+ HEN+VPLRAFYYSD+EKLLV D+M  GSL ALLHGSR S  TP  WD R KIAL+ ARGLAHLH +  ++HGNIKSSNILLRPDHE  +S+FGLN +F+     SR +GY+APEV++T  VT KSDVYSFGV+LLELLTG++P Q S+ EEG DLPRWVQSVVREEW AEVFD E
Sbjct:   18 SRVNSEPVQDKQALLAFLSKTKHPNRIQWNSSTSACDWVGVECDANRSFVFSLRLPGVGLVGSIPSNTIGRLNQLRVLSLRANRLSGEIPEDFSNLTLLRNLYLQDNAFTGEFPISVTRLARLTRLDLSSNKFAGPIPFAVNNMSHLTGLFLQNNKFSGSLPSINADGLDEFNVSNNSLNGSIPGSLSKFPKSSFAGNPALC-GGPLRPCNPFFPSPEPSPIPPETPGEKSKNLSVGAIIGIAVGSTIIALLLLLFLIL---CLFKRRRQPPKPVTAPTGSVPPAEAGTS-------GGTTERER---NKLVFFEGGIYSFDLEDLLRASAEVLGKGTVGTSYKAVLEEGTMVVVKRLKDVAANERVFEIHMETLGKMKHENLVPLRAFYYSDDEKLLVLDFMEEGSLSALLHGSRVSGRTPPNWDSRRKIALTAARGLAHLHVTGKVVHGNIKSSNILLRPDHEACMSDFGLNPIFSNTASSSRFSGYRAPEVVETRNVTFKSDVYSFGVVLLELLTGKSPNQTSMGEEGIDLPRWVQSVVREEWTAEVFDVE 557          
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Match: K4BK30_SOLLC (Uncharacterized protein OS=Solanum lycopersicum GN=Solyc03g111670.2 PE=4 SV=1)

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 367/561 (65.42%), Postives = 437/561 (77.90%), Query Frame = 3
Query:  249 RVSSEPVEDKQALLAFISGIRHADRVKWNSSTSACDWFGVQCDANRSFVYTLRLPGAALIGSILPNTIGRLNRLRVLSLRANRLSGEIPADFSNLTQLRSLYLQGNEFTGPFPPSVXXXXXXXXXDLSSNNFTGPIPLGVNSLTQLTGLFLQNNKFSGSLPSIDSDGLNDFNVSNNNLKGSIPDSLSKFPESSFAGNIGLCGGXXXXXXXXXXXXXXXXXXXXKT--SGQSSKSLPTXXXXXXXXXXXXXXXXXXXXXXXCLXXXXXXXXXXX----XAIPSTTHAGPEEEAGTSSSKDDITGGSTEIERMMNNKLVFFKGSVYSFDLEDLMRASAEMLGKGSTGTSYRVVLAVGTTVAVKRLKDVAVSKREFVMKMGMLGKIMHENVVPLRAFYYSDEEKLLVYDYMHGGSLFALLHGSRSSVHTPLEWDHRMKIALSVARGLAHLHSSQNMIHGNIKSSNILLRPDHE-TYISEFGLNSLFNTNTPPS-RIAGYQAPEVIQTHKVTVKSDVYSFGVLLLELLTGRAPIQPSITEEGFDLPRWVQSVVREEWAAEVFDAE 1907
            RV SEP +DKQALLAF+S IRHA+RV+WNSS SAC WFGV+CD N +FVY+LRLP   L+G I  N++GRL++LRVLSL ANRLSG IP+DFSNL  LRSLYLQ NEF+G FP S+  LTRL RLDLSSNNFTG IP  +N+LT LTGL LQNN F+G+LPSI+  GL DF+VSNN L GSIP +LSKFP SSFAGNI LCGGPL PC PF PSPSP+    PKT  S + SK L T AI+ IAVGSAI  LLLLL L  CL++ K+   + +     + P+    G   EAGTSSSKDDITGGS E ER   NKLVFF+G  YSFDLEDL+RASAE+LGKGS GTSY+ VL  GTTV VKRLKDV V +++F  ++ ++GK+ HENV+PLRAFYYS +EKLLV DYM  GSL ALLHGSR S  TPL+WD RM+I L  ARG+A+LH S  ++HGNIK+SN+LL+ D++   +S++GLN LF+T+ P + R+AGY+APEV++T KVT KSDVYSFGVL+LELLTG+AP Q S+ EEG DLPRWVQSVVREEW AEVFD E
Sbjct:   23 RVFSEPTQDKQALLAFLSQIRHANRVQWNSSASACTWFGVECDPNNTFVYSLRLPAVGLVGKIPSNSLGRLSQLRVLSLHANRLSGSIPSDFSNLKLLRSLYLQKNEFSGEFPESIPGLTRLNRLDLSSNNFTGTIPFSINNLTHLTGLLLQNNSFTGTLPSINPSGLVDFSVSNNQLNGSIPTALSKFPASSFAGNIDLCGGPLPPCTPFFPSPSPSPETEPKTPPSIKKSKKLSTAAIVGIAVGSAIGVLLLLLLLFFCLKRRKKDPSKTQKPPVASRPAGAVTGAAAEAGTSSSKDDITGGSGEGER---NKLVFFEGGGYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVVVPRKDFEQQLEVMGKMKHENVLPLRAFYYSKDEKLLVSDYMPAGSLSALLHGSRGSGRTPLDWDSRMRIVLGAARGIAYLHISGKVVHGNIKASNVLLKQDNQDACVSDYGLNPLFSTSAPVNHRVAGYRAPEVLETRKVTYKSDVYSFGVLMLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE 580          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
Y2267_ARATH1.474e-11866.79Probable inactive receptor kinase At2g26730 OS=Ara... [more]
Y1421_ARATH5.916e-10137.79Putative inactive receptor-like protein kinase At1... [more]
Y5830_ARATH1.064e-9156.13Probable inactive receptor kinase At5g58300 OS=Ara... [more]
Y3868_ARATH3.551e-8854.48Probable inactive receptor kinase At3g08680 OS=Ara... [more]
Y4374_ARATH4.125e-8756.42Probable inactive receptor kinase At4g23740 OS=Ara... [more]
Y1848_ARATH5.815e-8657.49Probable inactive receptor kinase At1g48480 OS=Ara... [more]
RLK90_ARATH4.923e-8457.89Probable inactive receptor kinase RLK902 OS=Arabid... [more]
IMK3_ARATH1.759e-7940.82Probable leucine-rich repeat receptor-like protein... [more]
Y5516_ARATH3.268e-7952.57Probable leucine-rich repeat receptor-like protein... [more]
Y1680_ARATH5.868e-7755.16Probable leucine-rich repeat receptor-like protein... [more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092927 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2SIU1_GOSRA0.000e+097.11Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0P0Q7_GOSAR0.000e+096.75Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A061GN08_THECC0.000e+076.71Leucine-rich repeat protein kinase family protein ... [more]
A0A0B0PL07_GOSAR0.000e+074.37Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2TC00_GOSRA0.000e+074.37Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2N431_GOSRA0.000e+069.75Uncharacterized protein OS=Gossypium raimondii GN=... [more]
M5VWH1_PRUPE0.000e+068.95Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
D6N3G3_MALDO0.000e+068.23Protein kinase OS=Malus domestica PE=4 SV=1[more]
A0A0D2R590_GOSRA0.000e+066.61Uncharacterized protein OS=Gossypium raimondii GN=... [more]
K4BK30_SOLLC0.000e+065.42Uncharacterized protein OS=Solanum lycopersicum GN... [more]

Pages

back to top
Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092927 ID=g.barbadense_cottongen_reftransV1_0092927|Name=g.barbadense_cottongen_reftransV1_0092927|organism=Gossypium barbadense|type=contig|length=1907bp
GACTACAATGCAGCTATAAGGTCCTGGCTGTCTTCAAAGTTAAAACAGTT
CCCTTCCACCTTACGTTCCTCTTTCTTTCATGGGTTCTCACCGGAAAATC
GTTTCCGGTTCCGACTAGCCGCCGGAGGAAACTACGGCAACTTAAAAGAA
AACCATTTCTTTCCTCATTGTTTTACTACTAAAATCCCATAATGCCGGTC
GTGAATTTTGTCTGTGTTTTTTTAGTTTCAGTTGTGATGTTGAATTCGAG
AGTAAGCTCAGAACCGGTTGAAGACAAGCAAGCTCTACTTGCTTTCATTT
CGGGAATTAGACATGCCGACCGGGTTAAATGGAATTCATCGACCTCAGCC
TGTGATTGGTTCGGTGTTCAATGCGATGCCAACCGGTCTTTCGTCTACAC
TTTACGGCTCCCCGGTGCGGCCCTCATCGGTTCGATTCTGCCCAATACAA
TCGGTCGGTTGAACCGACTTCGAGTTTTAAGTCTACGAGCAAACCGTTTG
TCCGGTGAGATCCCTGCCGATTTCTCCAATTTGACTCAGCTCCGTAGCCT
TTATTTGCAAGGTAACGAGTTCACCGGTCCGTTCCCACCTAGTGTGACTC
GTTTAACTCGTTTGACTCGCCTTGATCTTTCTTCTAATAATTTCACCGGT
CCAATTCCTTTGGGTGTCAACAGTTTGACTCAGTTGACCGGACTCTTCTT
GCAAAATAACAAGTTTTCCGGTTCTCTCCCGAGCATCGACTCGGACGGTT
TAAACGATTTCAATGTGTCTAACAACAACCTTAAAGGTTCAATCCCCGAT
TCGTTATCTAAATTCCCCGAATCTTCATTCGCCGGAAACATTGGGCTTTG
CGGCGGTCCACTTCGGCCATGTAACCCATTTCCTCCATCTCCATCTCCGA
CTGAGCCCATTCCGCCCAAAACTTCCGGTCAAAGCTCGAAAAGCCTTCCC
ACCGGCGCCATCATTGCCATTGCCGTGGGGTCAGCAATTGTTGCGTTACT
GTTATTACTATTCCTCATTATCTGCCTCCGCAAATGGAAACGGAAGTCAC
CAAGGCGGCGGAAGGCAATACCATCGACGACACATGCAGGTCCGGAGGAG
GAGGCGGGGACTTCCTCGTCGAAAGATGATATAACCGGAGGCTCAACGGA
AATCGAAAGGATGATGAATAATAAGCTCGTGTTCTTCAAAGGTAGCGTTT
ACAGTTTCGATTTGGAGGATTTGATGAGGGCGTCGGCTGAAATGTTGGGA
AAAGGCAGCACCGGAACGTCGTACAGGGTGGTTTTAGCGGTGGGGACGAC
GGTGGCAGTTAAACGGTTGAAAGACGTGGCGGTTAGTAAACGAGAGTTCG
TAATGAAGATGGGAATGTTGGGTAAAATCATGCATGAAAACGTGGTTCCT
TTGAGAGCGTTTTATTATTCCGACGAGGAGAAATTGCTGGTTTATGATTA
CATGCATGGTGGAAGCTTGTTTGCGCTGCTTCACGGTAGCAGAAGTTCGG
TTCATACACCGTTAGAATGGGACCATCGGATGAAAATAGCCCTAAGCGTG
GCTAGAGGCCTCGCGCACCTCCACAGTTCACAAAACATGATCCACGGCAA
CATTAAATCTTCCAACATCCTTCTCCGACCAGACCACGAAACCTACATCT
CAGAGTTCGGTCTTAACTCTCTTTTCAACACCAACACTCCACCTAGTCGC
ATCGCGGGTTACCAAGCACCTGAAGTAATTCAAACCCATAAAGTTACGGT
GAAGTCAGACGTTTATAGTTTCGGGGTGTTATTATTGGAATTATTAACCG
GTAGGGCACCAATCCAACCATCAATAACTGAAGAAGGGTTCGATCTTCCG
CGTTGGGTCCAATCCGTGGTTCGGGAGGAATGGGCGGCCGAGGTGTTTGA
CGCAGAG
back to top