g.barbadense_cottongen_reftransV1_0092725, g.barbadense_cottongen_reftransV1_0092725 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092725
Unique Nameg.barbadense_cottongen_reftransV1_0092725
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length4555
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: SWI3D_ARATH (SWI/SNF complex subunit SWI3D OS=Arabidopsis thaliana GN=SWI3D PE=1 SV=3)

HSP 1 Score: 480.715 bits (1236), Expect = 2.020e-146
Identity = 367/798 (45.99%), Postives = 485/798 (60.78%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATT-----RRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXXDQAKTKPMETSKPEDEKEVGGSEEPSE----TKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPD-EKEPTCSRSVANDT-GNRGAQNVKHSEDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESTNFATNEEDKKANLNESSI-----INQSKDHQPSVTRVSNTITSQVLPST-------LEETGGKG-----------------TAKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGE 2389
            MEEKRRD+  + A   S+   PA+      RRR G  KRKAN+L GS+  S+   +    +   +++  S  HNGPLTRARQ       A          ++    +  +  K ++ EE NKA  E EALEAKIEA+FEA+RSRDSN HVVPNHCGWFSW+K H +EE  LPSFFNGK   RT +VY EIRN IM KFH+NP++QIE KDL ++EVGD +A+QEV+EFLDYWGLINFHPFPP D+   ++D D   +  K+SLL +L+ F+V E+ P +V K   +  + PSG  P+    D+LL+ EGP+V+YHCNSCSADCSRKRYHC KQADFDLCT+CFN+ KF S MSSSDFILMEP EA G+  GKWTDQETLLLLEALE++KENWNEIAEHVATKTKAQC+LHFLQMPIED F +  D   D  SK+T   A   D+ +V K+  E  E+K   ++    K  E  +PED  E   S+E S+    ++   +++  ++T K E     +   EA EN AL A+ EAFE VG++ T E+  SFAD+GNPVM LA F   L G ++A AS+++S+KSL      + LA R+C++LEDPPD +K+PT S+S + D  GN         +D S K DQ    S   +   EVSL  ++   P      TD  + T  + +EE +  +  E+S      + + +  +P  T  S      + PS        L+E    G                 +A + SQ P+A ++V+M D++Q +K+ P D    K VGE
Sbjct:    1 MEEKRRDSAGTLAFAGSSGDSPASEPMPAPRRRGGGLKRKANALGGSNFFSSAPSKRMLTREKAMLASFSPVHNGPLTRARQAPSIMPSAADGVKS----EVLNVAVGADGEKPKEEEERNKAIREWEALEAKIEADFEAIRSRDSNVHVVPNHCGWFSWEKIHPLEERSLPSFFNGKLEGRTSEVYREIRNWIMGKFHSNPNIQIELKDLTELEVGDSEAKQEVMEFLDYWGLINFHPFPPTDTGSTASDHD--DLGDKESLLNSLYRFQVDEACPPLVHKPRFTAQATPSGLFPDPMAADELLKQEGPAVEYHCNSCSADCSRKRYHCPKQADFDLCTECFNSGKFSSDMSSSDFILMEPAEAPGVGSGKWTDQETLLLLEALEIFKENWNEIAEHVATKTKAQCMLHFLQMPIEDAFLDQIDYK-DPISKDTTDLAVSKDDNSVLKDAPEEAENKKRVDEDETMK--EVPEPEDGNEEKVSQESSKPGDASEETNEMEAEQKTPKLETAIEERCKDEADENIALKALTEAFEDVGHSSTPEASFSFADLGNPVMGLAAFLVRLAGSDVATASARASIKSLHSNS-GMLLATRHCYILEDPPDNKKDPTKSKSCSADAEGN---------DDNSHKDDQPEEKSKKAE---EVSLNSDDREMPD-----TDTGKETQDSVSEEKQPGSRTENSTTKLDAVQEKRSSKPVTTDNSEKPVDIICPSQDKCSGKELQEPLKDGNKLSSENKDASQSTVSQSAADASQ-PEASRDVEMKDTLQSEKD-PEDVV--KTVGE 767          

HSP 2 Score: 140.969 bits (354), Expect = 2.764e-32
Identity = 86/140 (61.43%), Postives = 98/140 (70.00%), Query Frame = 1
Query: 3088 QEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPAS-SSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSNTVAGSSI-RPGSQDNLSSV 3501
            QEEDQIRQL+ SLIEKQLHK+EAKLS FNE E + MRV+EQL+RSRQRLYHER QIIAARLG+P S SS+A  P    NR+A NFAN   RPPM M  PR     P     P P +   + T+ GSS   PGS DN+SSV
Sbjct:  852 QEEDQIRQLSGSLIEKQLHKLEAKLSIFNEAESLTMRVREQLERSRQRLYHERAQIIAARLGVPPSMSSKASLP---TNRIAANFANVAQRPPMGMAFPR--PPMPRPPGFPVPGSFVAATTMTGSSDPSPGS-DNVSSV 985          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: SWI3C_ARATH (SWI/SNF complex subunit SWI3C OS=Arabidopsis thaliana GN=SWI3C PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.383e-42
Identity = 110/285 (38.60%), Postives = 161/285 (56.49%), Query Frame = 2
Query:  542 AHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVG-DLDARQEVLEFLDYWGLINF------HPFPPGDSAVVSAD--GDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASG-LSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFN 1366
             HV+P H  WF+      +E  ++P FF+GKSP  TP+ Y+E RN+I+ K+  NP   +   D   +  G D++    V  FLD+WG+IN+      HP P  D + V  D  G+ +  +   + +++L  F+    +P+   K      S+PS    +S  LD  +R+     D HCN CS       +  QK+ D  LC DCF++ +F  G S  DF+ ++P +  G   G  WTDQETLLLLEA+ELY ENW +IA+HV +K+KAQCILHFL++P+ED   +
Sbjct:  175 VHVLPMHSDWFAPNTVDRLERQVVPQFFSGKSPNHTPESYMEFRNAIVSKYVENPEKTLTISDCQGLVDGVDIEDFARVFRFLDHWGIINYCATAQSHPGPLRDVSDVREDTNGEVNVPSAALTSIDSLIKFD----KPNCRHKGGEVYSSLPS-LDGDSPDLD--IRIREHLCDSHCNHCSRPLPTVYFQSQKKGDILLCCDCFHHGRFVVGHSCLDFVRVDPMKFYGDQDGDNWTDQETLLLLEAVELYNENWVQIADHVGSKSKAQCILHFLRLPVEDGLLD 452          

HSP 2 Score: 60.4622 bits (145), Expect = 1.352e-7
Identity = 27/69 (39.13%), Postives = 47/69 (68.12%), Query Frame = 1
Query: 3085 DQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSS 3291
            D EE +I++L+ +++  QL +ME KL  F E+E ++M+  EQ++++RQR   ER ++++AR G P   S
Sbjct:  599 DHEEREIQRLSANIVNHQLKRMELKLKQFAEIETLLMKECEQVEKTRQRFSAERARMLSARFGSPGGIS 667          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: SSR2_SCHPO (SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr2 PE=1 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 2.909e-29
Identity = 95/286 (33.22%), Postives = 145/286 (50.70%), Query Frame = 2
Query:  548 VVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSA--VVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEG-------------PSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVF 1360
            +VP++ GWF   K H +E    P FFNGKSP++TP +Y + R+ ++  +   P+  +         VGD+ A   V  FL+ WGLIN+   P    A  +    G    I+    + +     E++   P   P     + S     L E      L  +E              P VD  C +C  +CS+  YH  K   +D+C +C+   +F S  +SSDF+ M+  + +      W++QETLLLLEA+E Y ++WN+IA HV ++TK QC++HFLQ+PIED +
Sbjct:   19 IVPSYAGWFDMSKIHDIERRSNPEFFNGKSPLKTPSIYKDYRDFMINSYRLEPNEYLTVTACRRNLVGDVCAIIRVHAFLEQWGLINYQIDPETRPAFRLPPISGHVQAISNTPIVTQ-----EMLAQHPP--PSTVGGSSSQEFVKLEEKHYSPSLNAMEQTSPKEEDEKSDKVPRVDKVCFTCGVNCSQTWYHNLKNKKYDICPNCYKQGRFSSSFNSSDFLCMDAIDFNHDEEKPWSNQETLLLLEAIETYGDDWNQIALHVGSRTKEQCLIHFLQIPIEDPY 297          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: SWI3B_ARATH (SWI/SNF complex subunit SWI3B OS=Arabidopsis thaliana GN=SWI3B PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.493e-23
Identity = 83/280 (29.64%), Postives = 131/280 (46.79%), Query Frame = 2
Query:  539 NAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDN 1378
            N HV P++  WFSW   +  E   LP FF+ +S  + P  YL +RNSI+K++  +   +I   D+    V D+ + + V +FLD WGLIN++                       S       +E  E+  S    A     S P+  + E+A               +CN C A CS   + C K  D  LC  C+    +  G++SS+F  +E  E    S  +W+D+E LLLLEA+  Y ++W ++A HV  +T+  C+  F+++P  + F    D+
Sbjct:   47 NIHV-PSYSSWFSWTDINDCEVRSLPEFFDSRSSSKNPKFYLYLRNSIIKQYRDDHPRKISFTDVRRTLVSDVVSIRRVFDFLDSWGLINYNS----------------------SASAKPLKWEEKEAGKSAGDAA-----SEPATTVKETA-------------KRNCNGCKAICSIACFACDKY-DLTLCARCYVRSNYRVGINSSEFKRVEISEE---SKPEWSDKEILLLLEAVMHYGDDWKKVASHVIGRTEKDCVSQFVKLPFGEQFVKESDS 281          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: SMRC1_HUMAN (SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3)

HSP 1 Score: 111.694 bits (278), Expect = 2.620e-23
Identity = 82/286 (28.67%), Postives = 136/286 (47.55%), Query Frame = 2
Query:  527 SRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNI 1384
            +  +N  ++P++  WF +   H +E   LP FFNGK+  +TP++YL  RN ++  +  NP   + S        GD+ A   V  FL+ WGL+N+   P      +                    HF V+   PS +   +L +P +P+       +L+   + +   VD                     +F L TD ++ +       +S             +G +WT+QETLLLLEALE+YK++WN+++EHV ++T+ +CILHFL++PIED +    D ++
Sbjct:  443 TEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTP--------------HFNVLADTPSGLVPLHLRSPQVPAA----QQMLNFPEKNKEKPVDLQ-------------------NFGLRTDIYSKKTLAKSKGAS-------------AGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASL 678          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: SMRC1_MOUSE (SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 3.678e-23
Identity = 85/298 (28.52%), Postives = 139/298 (46.64%), Query Frame = 2
Query:  527 SRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAA 1420
            +  +N  ++P++  WF +   H +E   LP FFNGK+  +TP++YL  RN ++  +  NP   + S        GD+ A   V  FL+ WGL+N+   P      +                    HF V+   PS +   +L +P +P+       +L+   + +   +D                     +F L TD ++ +       +S             +G +WT+QETLLLLEALE+YK++WN+++EHV ++T+ +CILHFL++PIED +          NS  + GP A
Sbjct:  442 TEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTP--------------HFNVLADTPSGLVPLHLRSPQVPAA----QQMLNFPEKNKEKPIDLQ-------------------NFGLRTDIYSKKTLAKSKGAS-------------AGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLE--------NSDASLGPLA 681          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: RSC8_YEAST (Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC8 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.224e-22
Identity = 89/291 (30.58%), Postives = 136/291 (46.74%), Query Frame = 2
Query:  548 VVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVV--SADGDCDGI-----AKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLD---DLLRLEGPSVD-------YHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGK-WTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQ-CILHFLQMPIEDVFF 1363
            ++P+   WF   K H +E+   P FFN  S  +TP  Y + RN I+  +  +P   +    +      D+ +  ++  FL+ WGLIN+   P    +++  S  G    +       K  L EN+   EV E      P+        P     +  V D   D   L+  S +       Y C++C  +    RYH  +  D +LC+ CF    FG+   SSDFI +   E +G S  K W+DQE LLLLE +E+Y++ W +IA+HV    + + CI  FL +PIED + 
Sbjct:   81 IIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKDTRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRTKPSLIGPSFTGHFQVVLDTPQGLKPFLPENVIKQEV-EGGDGAEPQVK---KEFPVNLTIKKNVYDSAQDFNALQDESRNSRQIHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQSSDFIRL---ENNGNSVKKNWSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIEDNYI 364          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: SMRC2_MOUSE (SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 3.174e-22
Identity = 80/272 (29.41%), Postives = 127/272 (46.69%), Query Frame = 2
Query:  548 VVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFF 1363
            ++P++  WF +   H +E   LP FFNGK+  +TP++YL  RN ++  +  NP   + S        GD+ A   V  FL+ WGLIN+          V A+     +    +      HF V+                 PSG +P        L+ + P              + +       +F L TD +  +   S             +A+  +  +WT+QETLLLLEALE+YK++WN+++EHV ++T+ +CILHFL++PIED + 
Sbjct:  425 IIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQ---------VDAESRPTPMGPPPT-----SHFHVLA--------------DTPSGLVP--------LQPKPPQQSSASQQMLNFPEKGKEKPADMQNFGLRTDMYTKKNVPSK-----------SKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL 649          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: SMRC2_HUMAN (SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.258e-22
Identity = 80/272 (29.41%), Postives = 127/272 (46.69%), Query Frame = 2
Query:  548 VVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFF 1363
            ++P++  WF +   H +E   LP FFNGK+  +TP++YL  RN ++  +  NP   + S        GD+ A   V  FL+ WGLIN+          V A+     +    +      HF V+                 PSG +P        L+ + P              + +       +F L TD +  +   S             +A+  +  +WT+QETLLLLEALE+YK++WN+++EHV ++T+ +CILHFL++PIED + 
Sbjct:  425 IIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQ---------VDAESRPTPMGPPPT-----SHFHVLA--------------DTPSGLVP--------LQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSK-----------SKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL 649          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Match: SWI3A_ARATH (SWI/SNF complex subunit SWI3A OS=Arabidopsis thaliana GN=SWI3A PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.473e-19
Identity = 78/279 (27.96%), Postives = 122/279 (43.73%), Query Frame = 2
Query:  545 HVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSAD------GDCDGI---AKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFL--PESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPI 1348
            + +P    WF W   H +E      FF   S  RTP VY E R+ I+ KF  +   ++    +    VGD++  Q+V  FL+ WGLINF      +  ++S D      G   GI   A  +SL            RP   P   L    + +G    P ++  D    L+ P     C  C   C    Y   K    ++C  CF N  +G   ++ DF L+        +   WT++E LLLLE++  + ++W  I++ V+TK++  CI   +++P 
Sbjct:   13 YTIPAQSSWFLWDDIHEIERREFAEFFTESSITRTPKVYKEYRDFIINKFREDTCRRLTFTSVRKFLVGDVNLLQKVFLFLEKWGLINFSSSLKKNDHLLSVDNAKIEQGTPAGIRVTATPNSL------------RPITAPP--LVEERVETGIKVPPLTSYSDVFSDLKKPDHVLVCAHCGERCDSPFYQHNK-GIVNICEKCFKNGNYGENNTADDFKLI-----GNSAAAVWTEEEILLLLESVLKHGDDWELISQSVSTKSRLDCISKLIELPF 271          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A0D2V5P2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G152400 PE=4 SV=1)

HSP 1 Score: 1284.24 bits (3322), Expect = 0.000e+0
Identity = 741/853 (86.87%), Postives = 770/853 (90.27%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVS--ADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXXDQAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPDEKEPTCSRSVANDTGNRGAQNVKHSEDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESTNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNTITSQVLPSTLEETGGKGTAKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLXXXXXXXXXXXXXXXXTSNSVNENGVTTGFSLFFYKYLVRKWKPH 2668
            MEEKRRDA NSPA P     E A+TRRR GA KRK NSLSGSSSSSTPSKR TREKS+ +      ++ GPLTRARQGAPSGNLALG  SG GGAKLEE  LVK+SVKAEDLEEL  + E               +RSRDSNAHVVPNHCGWFSW K HH+EE ILPSFFNGKSP RTPD Y EIRN I+KKFHANPS QIE KDL D+EVGDLDARQEVLEFLDYWGLINFHPFPP  SAV +   DGD DG+ +KDSLLENLFHF+ IESRP VV K NLS+PS+PSG LPESAV +DL+  EGPSV+YHCNSCSADCSRKRYHCQKQADFDLCTDCFNN  FGSGMSSSDFILMEP +  GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHF+QMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTV K+VSETTESKTTQEDQA+T PMETSKPEDEKEV GSEEPSETKTGTD KGVKETLKPEDMNV KDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCS+SVANDTGNRGAQNVKHS DESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKES+NFATNEEDKKANLNESSIINQSKDHQPSVTRVSN +TSQVLPS+LEETGGK TAKEPSQPPKAVKEVDMS SVQLKKNEPCDAAASKPVGELSEPA+ASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLVSVSQPSERSEPPQPVTSNSVNENGVTTGFSLFFYKYLVRKWKPH
Sbjct:    1 MEEKRRDAVNSPAEP-----ELASTRRRGGALKRKVNSLSGSSSSSTPSKRVTREKSNLISHSPVNHY-GPLTRARQGAPSGNLALGSSSGSGGAKLEETNLVKQSVKAEDLEELKASEELEALEAKIEADFEA-IRSRDSNAHVVPNHCGWFSWTKIHHLEESILPSFFNGKSPNRTPDAYKEIRNWIVKKFHANPSKQIELKDLEDLEVGDLDARQEVLEFLDYWGLINFHPFPPAGSAVPNPNGDGDGDGMTEKDSLLENLFHFDEIESRPQVVTKPNLSSPSLPSGLLPESAVAEDLMNPEGPSVEYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNGTFGSGMSSSDFILMEPADP-GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFVQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVPKDVSETTESKTTQEDQAQTTPMETSKPEDEKEVRGSEEPSETKTGTDAKGVKETLKPEDMNVRKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCSKSVANDTGNRGAQNVKHSGDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESSNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNNLTSQVLPSSLEETGGKETAKEPSQPPKAVKEVDMSGSVQLKKNEPCDAAASKPVGELSEPANASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLVSVSQPSERSEPPQPVTSNSVNENGVTTGFSLFFYKYLVRKWKPH 845          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A0D2VZQ8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G152400 PE=4 SV=1)

HSP 1 Score: 1247.65 bits (3227), Expect = 0.000e+0
Identity = 724/836 (86.60%), Postives = 753/836 (90.07%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVS--ADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXXDQAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPDEKEPTCSRSVANDTGNRGAQNVKHSEDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESTNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNTITSQVLPSTLEETGGKGTAKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLXXXXXXXXXXXXXXXXTSNSVNENGVTT 2617
            MEEKRRDA NSPA P     E A+TRRR GA KRK NSLSGSSSSSTPSKR TREKS+ +      ++ GPLTRARQGAPSGNLALG  SG GGAKLEE  LVK+SVKAEDLEEL  + E               +RSRDSNAHVVPNHCGWFSW K HH+EE ILPSFFNGKSP RTPD Y EIRN I+KKFHANPS QIE KDL D+EVGDLDARQEVLEFLDYWGLINFHPFPP  SAV +   DGD DG+ +KDSLLENLFHF+ IESRP VV K NLS+PS+PSG LPESAV +DL+  EGPSV+YHCNSCSADCSRKRYHCQKQADFDLCTDCFNN  FGSGMSSSDFILMEP +  GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHF+QMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTV K+VSETTESKTTQEDQA+T PMETSKPEDEKEV GSEEPSETKTGTD KGVKETLKPEDMNV KDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCS+SVANDTGNRGAQNVKHS DESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKES+NFATNEEDKKANLNESSIINQSKDHQPSVTRVSN +TSQVLPS+LEETGGK TAKEPSQPPKAVKEVDMS SVQLKKNEPCDAAASKPVGELSEPA+ASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLVSVSQPSERSEPPQPVTSNSVNENGVTT
Sbjct:    1 MEEKRRDAVNSPAEP-----ELASTRRRGGALKRKVNSLSGSSSSSTPSKRVTREKSNLISHSPVNHY-GPLTRARQGAPSGNLALGSSSGSGGAKLEETNLVKQSVKAEDLEELKASEELEALEAKIEADFEA-IRSRDSNAHVVPNHCGWFSWTKIHHLEESILPSFFNGKSPNRTPDAYKEIRNWIVKKFHANPSKQIELKDLEDLEVGDLDARQEVLEFLDYWGLINFHPFPPAGSAVPNPNGDGDGDGMTEKDSLLENLFHFDEIESRPQVVTKPNLSSPSLPSGLLPESAVAEDLMNPEGPSVEYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNGTFGSGMSSSDFILMEPADP-GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFVQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVPKDVSETTESKTTQEDQAQTTPMETSKPEDEKEVRGSEEPSETKTGTDAKGVKETLKPEDMNVRKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCSKSVANDTGNRGAQNVKHSGDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESSNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNNLTSQVLPSSLEETGGKETAKEPSQPPKAVKEVDMSGSVQLKKNEPCDAAASKPVGELSEPANASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLVSVSQPSERSEPPQPVTSNSVNENGVTT 828          

HSP 2 Score: 333.954 bits (855), Expect = 1.562e-92
Identity = 186/186 (100.00%), Postives = 186/186 (100.00%), Query Frame = 1
Query: 2953 DKIEEGKSKNHDSTEREDNSSIDKXXXXXXXXXXXXXXXXXXXXDQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSNTVAGSSIRPGSQDNLSSVGTK 3510
            DKIEEGKSKNHDSTEREDNSSIDKLKRAAVTALSAAAVKAKLLADQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSNTVAGSSIRPGSQDNLSSVGTK
Sbjct:  829 DKIEEGKSKNHDSTEREDNSSIDKLKRAAVTALSAAAVKAKLLADQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSNTVAGSSIRPGSQDNLSSVGTK 1014          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A0D2V6W7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G152400 PE=4 SV=1)

HSP 1 Score: 1244.18 bits (3218), Expect = 0.000e+0
Identity = 725/837 (86.62%), Postives = 754/837 (90.08%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVS--ADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXXDQAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPDEKEPTCSRSVANDTGNRGAQNVKHSEDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESTNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNTITSQVLPSTLEETGGKGTAKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLXXXXXXXXXXXXXXXXTSNSVNENGVTTG 2620
            MEEKRRDA NSPA P     E A+TRRR GA KRK NSLSGSSSSSTPSKR TREKS+ +      ++ GPLTRARQGAPSGNLALG  SG GGAKLEE  LVK+SVKAEDLEEL  + E               +RSRDSNAHVVPNHCGWFSW K HH+EE ILPSFFNGKSP RTPD Y EIRN I+KKFHANPS QIE KDL D+EVGDLDARQEVLEFLDYWGLINFHPFPP  SAV +   DGD DG+ +KDSLLENLFHF+ IESRP VV K NLS+PS+PSG LPESAV +DL+  EGPSV+YHCNSCSADCSRKRYHCQKQADFDLCTDCFNN  FGSGMSSSDFILMEP +  GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHF+QMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTV K+VSETTESKTTQEDQA+T PMETSKPEDEKEV GSEEPSETKTGTD KGVKETLKPEDMNV KDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCS+SVANDTGNRGAQNVKHS DESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKES+NFATNEEDKKANLNESSIINQSKDHQPSVTRVSN +TSQVLPS+LEETGGK TAKEPSQPPKAVKEVDMS SVQLKKNEPCDAAASKPVGELSEPA+ASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLVSVSQPSERSEPPQPVTSNSVNENGVTTG
Sbjct:    1 MEEKRRDAVNSPAEP-----ELASTRRRGGALKRKVNSLSGSSSSSTPSKRVTREKSNLISHSPVNHY-GPLTRARQGAPSGNLALGSSSGSGGAKLEETNLVKQSVKAEDLEELKASEELEALEAKIEADFEA-IRSRDSNAHVVPNHCGWFSWTKIHHLEESILPSFFNGKSPNRTPDAYKEIRNWIVKKFHANPSKQIELKDLEDLEVGDLDARQEVLEFLDYWGLINFHPFPPAGSAVPNPNGDGDGDGMTEKDSLLENLFHFDEIESRPQVVTKPNLSSPSLPSGLLPESAVAEDLMNPEGPSVEYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNGTFGSGMSSSDFILMEPADP-GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFVQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVPKDVSETTESKTTQEDQAQTTPMETSKPEDEKEVRGSEEPSETKTGTDAKGVKETLKPEDMNVRKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCSKSVANDTGNRGAQNVKHSGDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESSNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNNLTSQVLPSSLEETGGKETAKEPSQPPKAVKEVDMSGSVQLKKNEPCDAAASKPVGELSEPANASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLVSVSQPSERSEPPQPVTSNSVNENGVTTG 829          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A0D2S3J9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G152400 PE=4 SV=1)

HSP 1 Score: 1243.8 bits (3217), Expect = 0.000e+0
Identity = 724/836 (86.60%), Postives = 753/836 (90.07%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVS--ADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXXDQAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPDEKEPTCSRSVANDTGNRGAQNVKHSEDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESTNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNTITSQVLPSTLEETGGKGTAKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLXXXXXXXXXXXXXXXXTSNSVNENGVTT 2617
            MEEKRRDA NSPA P     E A+TRRR GA KRK NSLSGSSSSSTPSKR TREKS+ +      ++ GPLTRARQGAPSGNLALG  SG GGAKLEE  LVK+SVKAEDLEEL  + E               +RSRDSNAHVVPNHCGWFSW K HH+EE ILPSFFNGKSP RTPD Y EIRN I+KKFHANPS QIE KDL D+EVGDLDARQEVLEFLDYWGLINFHPFPP  SAV +   DGD DG+ +KDSLLENLFHF+ IESRP VV K NLS+PS+PSG LPESAV +DL+  EGPSV+YHCNSCSADCSRKRYHCQKQADFDLCTDCFNN  FGSGMSSSDFILMEP +  GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHF+QMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTV K+VSETTESKTTQEDQA+T PMETSKPEDEKEV GSEEPSETKTGTD KGVKETLKPEDMNV KDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCS+SVANDTGNRGAQNVKHS DESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKES+NFATNEEDKKANLNESSIINQSKDHQPSVTRVSN +TSQVLPS+LEETGGK TAKEPSQPPKAVKEVDMS SVQLKKNEPCDAAASKPVGELSEPA+ASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLVSVSQPSERSEPPQPVTSNSVNENGVTT
Sbjct:    1 MEEKRRDAVNSPAEP-----ELASTRRRGGALKRKVNSLSGSSSSSTPSKRVTREKSNLISHSPVNHY-GPLTRARQGAPSGNLALGSSSGSGGAKLEETNLVKQSVKAEDLEELKASEELEALEAKIEADFEA-IRSRDSNAHVVPNHCGWFSWTKIHHLEESILPSFFNGKSPNRTPDAYKEIRNWIVKKFHANPSKQIELKDLEDLEVGDLDARQEVLEFLDYWGLINFHPFPPAGSAVPNPNGDGDGDGMTEKDSLLENLFHFDEIESRPQVVTKPNLSSPSLPSGLLPESAVAEDLMNPEGPSVEYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNGTFGSGMSSSDFILMEPADP-GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFVQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVPKDVSETTESKTTQEDQAQTTPMETSKPEDEKEVRGSEEPSETKTGTDAKGVKETLKPEDMNVRKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCSKSVANDTGNRGAQNVKHSGDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESSNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNNLTSQVLPSSLEETGGKETAKEPSQPPKAVKEVDMSGSVQLKKNEPCDAAASKPVGELSEPANASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLVSVSQPSERSEPPQPVTSNSVNENGVTT 828          

HSP 2 Score: 78.9518 bits (193), Expect = 2.599e-11
Identity = 62/63 (98.41%), Postives = 63/63 (100.00%), Query Frame = 1
Query: 2953 DKIEEGKSKNHDSTEREDNSSIDKXXXXXXXXXXXXXXXXXXXXDQEEDQIRQLTTSLIEKQL 3141
            DKIEEGKSKNHDSTEREDNSSIDKLKRAAVTALSAAAVKAKLLADQEEDQIRQLTTSLIEKQ+
Sbjct:  829 DKIEEGKSKNHDSTEREDNSSIDKLKRAAVTALSAAAVKAKLLADQEEDQIRQLTTSLIEKQV 891          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A0B0MJQ1_GOSAR (SWI/SNF complex subunit SWI3D-like protein OS=Gossypium arboreum GN=F383_19306 PE=4 SV=1)

HSP 1 Score: 1232.24 bits (3187), Expect = 0.000e+0
Identity = 715/838 (85.32%), Postives = 753/838 (89.86%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDG----IAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXXDQAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPDEKEPTCSRSVANDTGNRGAQNVKHSEDESLKGDQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESTNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNTITSQVLPSTLEETGGKGTAKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLXXXXXXXXXXXXXXXXTSNSVNENGVTT 2617
            MEEKRRDA NSPA P     E A+TRRR GA KRK NSLSGSSSSSTPSKR TREKS+ +      ++ GPLTRARQGAPSGNLALG  SG GGAKL+E  LVK+SVKAEDLEEL  + E               +RSRDSNAHVVPNHCGWFSW K HH+EE ILPSFFNGKSP RTP  Y+EIRN I+KKFHANPS QIE KDL D+EVGDLDARQEVLEFLDYWGLINFHPFP   SAV + +GD DG    + +KDSLLE LFHF+ IESRP VV K NLS+PS+PSG LPESAV +DL+  EGPSV+YHCNSCSADCSRKRYHCQKQADFDLCTDCFNN  FGSGMSSSDFILMEP +  GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHF+QMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAK+VSETTESKTTQEDQAKT PMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPE+MNVPKDGLEATENCALTA+REAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPN AAAS+QSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCS+SVANDTGNRGAQNVKHSEDESLKGDQK S+S+HGDENTEVSLREENATSPSPNDLTTDKKES+NFATNEEDKKANLNESSIINQSKDHQPSVTRVSN ITSQVLPSTLEETGGKGTAKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKP PDGESTEPA+AS+DVQ+VSV+QPSER EPPQPV+SNSVNENGV T
Sbjct:    1 MEEKRRDAVNSPAEP-----ELASTRRRGGALKRKVNSLSGSSSSSTPSKRVTREKSNLISHSPVNHY-GPLTRARQGAPSGNLALGSSSGSGGAKLQETNLVKQSVKAEDLEELKASEELEALEAKIEADFEA-IRSRDSNAHVVPNHCGWFSWNKIHHLEESILPSFFNGKSPNRTPAAYMEIRNWIVKKFHANPSKQIELKDLEDLEVGDLDARQEVLEFLDYWGLINFHPFPLAGSAVPNPNGDGDGDGDGMTEKDSLLEKLFHFDEIESRPQVVTKPNLSSPSLPSGLLPESAVAEDLMNPEGPSVEYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNGTFGSGMSSSDFILMEPADP-GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFVQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAKDVSETTESKTTQEDQAKTTPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEEMNVPKDGLEATENCALTALREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNFAAASAQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCSKSVANDTGNRGAQNVKHSEDESLKGDQKISMSNHGDENTEVSLREENATSPSPNDLTTDKKESSNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNNITSQVLPSTLEETGGKGTAKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKPSPDGESTEPAEASNDVQMVSVAQPSERREPPQPVSSNSVNENGVMT 830          

HSP 2 Score: 327.405 bits (838), Expect = 2.347e-90
Identity = 183/186 (98.39%), Postives = 183/186 (98.39%), Query Frame = 1
Query: 2953 DKIEEGKSKNHDSTEREDNSSIDKXXXXXXXXXXXXXXXXXXXXDQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSNTVAGSSIRPGSQDNLSSVGTK 3510
            DKIEEGKSKNHDSTE EDNSSIDKLKRAAVTALSAAAVKAKLLADQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVS  VAGSSIRPGSQDNLSSVGTK
Sbjct:  831 DKIEEGKSKNHDSTETEDNSSIDKLKRAAVTALSAAAVKAKLLADQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSTKVAGSSIRPGSQDNLSSVGTK 1016          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A0D2RKZ3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G242600 PE=4 SV=1)

HSP 1 Score: 1109.36 bits (2868), Expect = 0.000e+0
Identity = 686/850 (80.71%), Postives = 741/850 (87.18%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXX-------DQAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPDE-KEPTCSRSVANDTGNRGAQNVKHSEDESLKG-------DQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESTNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNTITSQVLPSTLEETGGKGT-AKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLXXXXXXXXXXXXXXXXTSNSVNENGVTT 2617
            MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANSLSGSSSSSTPSKRATREKSSNLISHSSINHNGPLTRARQGAPSGNLALGLGSGFGGAKLEERILVKESVKAEDLEELNKASEELEALEAKIEAEFEAVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFN DD NIDTNSKET+ PA + DET+V K+VSE TE+KTT +       DQ +T P++ SKPEDEKE   SEE S+ +TGTD+K   ET KPE+M+  KDG +  ENCA+ A+REAFEAVGYNLTSES LSFADVGNP+MALAGFFA L GP I AAS+Q+SLK+LSG+ PNIQLAARNCF+LEDPPD+ KE T S SV ND GN+ AQNV++SE++SLK        DQKSS S+H D+N E SL EE  TS SPN L+TDKKE    AT++E KKA        NQSKDH+P V R S+ + SQV PS+ EETGGK T A+E SQ  + VKEV+MS+SV L+KNEP DAAAS+PV ELSEP +A +N+ET S SPS +KNEQ+ VK    GE ++P  AS+D+++VS SQPSERSEP QPVTSNSVNENG  T
Sbjct:    1 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANSLSGSSSSSTPSKRATREKSSNLISHSSINHNGPLTRARQGAPSGNLALGLGSGFGGAKLEERILVKESVKAEDLEELNKASEELEALEAKIEAEFEAVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNSDD-NIDTNSKETSAPAVVTDETSVPKDVSEATETKTTSQEDQVPQEDQTQTTPVDASKPEDEKEKRESEEMSKPETGTDIKCAPETSKPEEMDEAKDGQDTKENCAIMALREAFEAVGYNLTSESTLSFADVGNPIMALAGFFARLAGPKIGAASAQASLKALSGSSPNIQLAARNCFLLEDPPDDKKEQTGSESVVNDVGNQDAQNVENSENKSLKEDKSTPVLDQKSSSSNHADQNAETSLPEEKVTSASPNCLSTDKKEPGTSATSKEAKKA--------NQSKDHEPGVMRGSDNLASQVPPSSAEETGGKETSAQESSQRTEVVKEVEMSESVPLEKNEPSDAAASEPVAELSEPTEALKNVETVSGSPSGAKNEQQPVKSSSGGEISQPTKASNDIEMVSDSQPSERSEPQQPVTSNSVNENGTIT 841          

HSP 2 Score: 266.929 bits (681), Expect = 5.180e-70
Identity = 153/188 (81.38%), Postives = 167/188 (88.83%), Query Frame = 1
Query: 2947 FADKIEEGKSKNHDSTEREDNSSIDKXXXXXXXXXXXXXXXXXXXXDQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSNTVAGSSIRPGSQDNLSSVGTK 3510
              D I+EGKS++H STE +D+SSIDK+KRAAVTALSAAAVKAKLLADQEEDQIR+LTTSLIEKQ  KMEAKL FFNEMEG++MRVKEQLDRSRQ+LYHERTQIIAARLGLPASSSRAMPP N ANR+ATN+ANSVARPPM   A RPP+SRPMG M PT SNP+VS TVAGSSIR  SQDNLSSV TK
Sbjct:  840 ITDVIKEGKSESHTSTETKDDSSIDKVKRAAVTALSAAAVKAKLLADQEEDQIRKLTTSLIEKQFSKMEAKLGFFNEMEGLMMRVKEQLDRSRQKLYHERTQIIAARLGLPASSSRAMPPANTANRIATNYANSVARPPMRTTAARPPMSRPMGPMAPTSSNPFVSTTVAGSSIRRASQDNLSSVRTK 1027          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A0B0NXU7_GOSAR (SWI/SNF complex subunit SWI3D-like protein OS=Gossypium arboreum GN=F383_21812 PE=4 SV=1)

HSP 1 Score: 1102.43 bits (2850), Expect = 0.000e+0
Identity = 683/850 (80.35%), Postives = 740/850 (87.06%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXX-------DQAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPDE-KEPTCSRSVANDTGNRGAQNVKHSEDESLKG-------DQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESTNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNTITSQVLPSTLEETGGKGT-AKEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLXXXXXXXXXXXXXXXXTSNSVNENGVTT 2617
            MEEKRRDAGNSPAGPSSAELEPATTRRR GAQKRKANSLSGSSSSSTPSKRATREKSSNLISHSSINHNGPLTRARQGAPSGNLALGLGSGFGGAKLEERILVKESVKAEDLEELNKASEELEALEAKIEAEFEA+RSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSV+IESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFN DD NIDTNSKET+ PA + DET+V K+VSE TE+KTT +       DQ +T P++ SKPEDEKE   SEE S+ KTGTD+K   ET KPE+ +  KDG +  ENCA+ A+REAFEAVGYNLTSES LSFADVGNPVMALAGFFA L GP I AAS+Q+SLK+LSG+ PNIQLAARNCF+LEDPPD+ KE T S SV ND GN+ AQNV++SE++SLK        DQKSS S+H D+N E SL EE  TS SPN L+TDKKE    AT++E KKA        +QSKDH+P V R S+ + SQV  S+ EET GK T A+E SQ  + VKEV+MS+SV L+KNEP DAAAS+PV ELSEPA+AS+N+ET S SPSR+KNEQ+ VK    GE ++P  AS+D+++VS SQPSERSE  QPVTSNSVNENG +T
Sbjct:    1 MEEKRRDAGNSPAGPSSAELEPATTRRRVGAQKRKANSLSGSSSSSTPSKRATREKSSNLISHSSINHNGPLTRARQGAPSGNLALGLGSGFGGAKLEERILVKESVKAEDLEELNKASEELEALEAKIEAEFEALRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVKIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNSDD-NIDTNSKETSAPAVVTDETSVPKDVSEATETKTTSQEDQVPQEDQTQTTPVDASKPEDEKEKRESEEMSKPKTGTDIKCAPETSKPEETDEAKDGEDTKENCAIMALREAFEAVGYNLTSESTLSFADVGNPVMALAGFFARLAGPKIGAASAQTSLKALSGSSPNIQLAARNCFLLEDPPDDKKEQTGSESVVNDAGNQDAQNVENSENKSLKEDKSTPVLDQKSSSSNHADQNAETSLPEEKVTSASPNCLSTDKKEPGTCATSKEAKKA--------SQSKDHEPGVMRGSDNLASQVPASSAEETWGKETSAQESSQRTEVVKEVEMSESVPLEKNEPADAAASEPVAELSEPAEASKNVETVSGSPSRAKNEQQPVKSSSGGELSQPTKASNDIEMVSDSQPSERSELQQPVTSNSVNENGTST 841          

HSP 2 Score: 267.7 bits (683), Expect = 2.701e-70
Identity = 153/186 (82.26%), Postives = 165/186 (88.71%), Query Frame = 1
Query: 2953 DKIEEGKSKNHDSTEREDNSSIDKXXXXXXXXXXXXXXXXXXXXDQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSNTVAGSSIRPGSQDNLSSVGTK 3510
            D I EGKS++H STE +D+SSIDK+KRAAVTALSAAAVKAKLLA QEEDQIRQLTTSLIEKQ  KMEAKL FFNEMEG++MRVKEQLDRSRQ+LYHERTQIIAARLGLPASSSRAMPP N ANR+ATN+ANSVARPPM   A RPP+ RPMG M PT SNP+VS TVAGSSIRP SQDNLSSV TK
Sbjct:  842 DVITEGKSESHTSTETKDDSSIDKVKRAAVTALSAAAVKAKLLAGQEEDQIRQLTTSLIEKQFSKMEAKLGFFNEMEGLMMRVKEQLDRSRQKLYHERTQIIAARLGLPASSSRAMPPANTANRIATNYANSVARPPMRTTAARPPMQRPMGPMAPTSSNPFVSTTVAGSSIRPASQDNLSSVRTK 1027          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A061E077_THECC (Chromatin remodeling complex subunit, putative isoform 1 OS=Theobroma cacao GN=TCM_006905 PE=4 SV=1)

HSP 1 Score: 1030.39 bits (2663), Expect = 0.000e+0
Identity = 633/843 (75.09%), Postives = 716/843 (84.93%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXX-XXDQAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPDEKEPTCSRSVANDTGNRGAQNVKHSEDESLKG-------DQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKESTNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNTITSQVLPSTLEETGGKGTA-KEPSQPPKAVKEVDMSDSVQLKKNEPCDAAASKPVGELSEPADASENLETASCSPSRSKNEQKTVKPIPDGESTEPADASDDVQLXXXXXXXXXXXXXXXXTSNSVNENGVTT 2617
            MEEKRRDAGNSPAGPSSAE EPA+TRRRAGAQKRKANSLSGSSSSSTPSKR TREKS+ +      ++ GPLTRARQGAPSGNLALG GSG  G KLEE  LVK+SV+AEDLEELNKASEE EALEAKIEAEFEAVRSRDSNAHVVPNHCGWFSW K H++EEC+LPSFFNGKSP+RTPDVY+EIRN IMKKFHANPS+QIE KDL D+EVGD+DARQEVLEFLDYWGLINFHPF P DSAV ++D D  G+AK DSLLE LF FE IESRP VVP+ NLSTPS+PSGFLPESA+ +DL+R EGP+V+YHCNSCSADCSRKRYHCQKQADFDLC+DCF+N KFGSGMSSSDFILMEP EA GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHF+QMPIEDVF+NC DNNI+ NSKE+ GPAAM+DET+V+K+VSE TESKTT +EDQA+T  METSKPEDEKEV  S E S+ +TGTDV+   ET KPE+ N  K G +  ENCAL A+REAFEAVGY LTSES LSFADVGNPVMALAGFFA LVGP IAAAS+QSSLKSLSG+ P+IQLAARNCF+LEDPPD+KEP  S SV N   NR AQNV++ E++  K        DQ++SLS+HGD+NTEVS+ E+  TS SPN+L+TDKKE     TNEEDKKANLNESS+I+QSKDHQPS+ + S+ + SQV  S++EETGGK T+ +EPSQP +AVKEVDM+DSV L+KNEPCDAA SKPVGELSEPA+A +N+ET   SPSR KNEQ  VK    GE T+P + S+DV++VS SQP ER EP Q VTSN++NENG TT
Sbjct:    1 MEEKRRDAGNSPAGPSSAEPEPASTRRRAGAQKRKANSLSGSSSSSTPSKRITREKSNLISHPLINHN-GPLTRARQGAPSGNLALGFGSGSVGGKLEETSLVKDSVRAEDLEELNKASEEWEALEAKIEAEFEAVRSRDSNAHVVPNHCGWFSWTKVHNLEECVLPSFFNGKSPIRTPDVYMEIRNWIMKKFHANPSMQIELKDLSDLEVGDMDARQEVLEFLDYWGLINFHPFIPVDSAVPTSDSD--GMAKMDSLLEKLFRFEAIESRPPVVPRPNLSTPSVPSGFLPESAIAEDLVRPEGPAVEYHCNSCSADCSRKRYHCQKQADFDLCSDCFSNGKFGSGMSSSDFILMEPAEAPGLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFVQMPIEDVFYNC-DNNIENNSKESTGPAAMSDETSVSKDVSEKTESKTTPREDQAQTTSMETSKPEDEKEVRVSVETSKPETGTDVEVDPETSKPEETNEAKGGQDTNENCALIALREAFEAVGYILTSESSLSFADVGNPVMALAGFFARLVGPKIAAASAQSSLKSLSGSSPSIQLAARNCFLLEDPPDDKEPNGSESVVNGMANRDAQNVENLEEKGPKEDKSSPVLDQQNSLSNHGDQNTEVSVPEDKVTSASPNELSTDKKEPDTLTTNEEDKKANLNESSVIDQSKDHQPSLMKESDNLASQVSLSSVEETGGKETSVEEPSQPTEAVKEVDMTDSVPLEKNEPCDAAVSKPVGELSEPAEALQNVETVPGSPSRGKNEQPPVKSTSVGEPTQPTEVSNDVEMVSDSQPLERIEPHQSVTSNNLNENGATT 839          

HSP 2 Score: 267.7 bits (683), Expect = 2.711e-70
Identity = 154/186 (82.80%), Postives = 166/186 (89.25%), Query Frame = 1
Query: 2953 DKIEEGKSKNHDSTEREDNSSIDKXXXXXXXXXXXXXXXXXXXXDQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSNTVAGSSIRPGSQDNLSSVGTK 3510
            D+I+EGK+KNHD+ E   + SIDKLKRAAVTALSAAAVKAKLLADQEEDQIRQLTTSLIEKQLHKME KL+ FNEMEGV+MRVKEQLDRSRQRLYHER QIIAARLGLPASSSRAMPP N ANR+A NFANSVARPPMSM APRPP+SRP+G M PTP N +VS TVAGSSIRP S DNLSSV +K
Sbjct:  840 DEIKEGKNKNHDAAETIGDLSIDKLKRAAVTALSAAAVKAKLLADQEEDQIRQLTTSLIEKQLHKMETKLASFNEMEGVIMRVKEQLDRSRQRLYHERAQIIAARLGLPASSSRAMPPTNTANRIAANFANSVARPPMSMTAPRPPMSRPIGPMAPTPPNLFVSTTVAGSSIRPASSDNLSSVESK 1025          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A0D2TQ48_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G152400 PE=4 SV=1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 503/610 (82.46%), Postives = 528/610 (86.56%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAELEPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQXXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVS--ADGDCDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXXDQAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPPDEKEPTCSRSVAN 1939
            MEEKRRDA NSPA P     E A+TRRR GA KRK NSLSGSSSSSTPSKR TREKS+ +      ++ GPLTRARQGAPSGNLALG  SG GGAKLEE  LVK+SVKAEDLEEL  + E               +RSRDSNAHVVPNHCGWFSW K HH+EE ILPSFFNGKSP RTPD Y EIRN I+KKFHANPS QIE KDL D+EVGDLDARQEVLEFLDYWGLINFHPFPP  SAV +   DGD DG+ +KDSLLENLFHF+ IESRP VV K NLS+PS+PSG LPESAV +DL+  EGPSV+YHCNSCSADCSRKRYHCQKQADFDLCTDCFNN  FGSGMSSSDFILMEP +  GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHF+QMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTV K+VSETTESKTTQEDQA+T PMETSKPEDEKEV GSEEPSETKTGTD KGVKETLKPEDMNV KDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCS+   N
Sbjct:    1 MEEKRRDAVNSPAEP-----ELASTRRRGGALKRKVNSLSGSSSSSTPSKRVTREKSNLISHSPVNHY-GPLTRARQGAPSGNLALGSSSGSGGAKLEETNLVKQSVKAEDLEELKASEELEALEAKIEADFEA-IRSRDSNAHVVPNHCGWFSWTKIHHLEESILPSFFNGKSPNRTPDAYKEIRNWIVKKFHANPSKQIELKDLEDLEVGDLDARQEVLEFLDYWGLINFHPFPPAGSAVPNPNGDGDGDGMTEKDSLLENLFHFDEIESRPQVVTKPNLSSPSLPSGLLPESAVAEDLMNPEGPSVEYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNGTFGSGMSSSDFILMEPADP-GLSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFVQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVPKDVSETTESKTTQEDQAQTTPMETSKPEDEKEVRGSEEPSETKTGTDAKGVKETLKPEDMNVRKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIAAASSQSSLKSLSGTCPNIQLAARNCFVLEDPPDEKEPTCSKRYVN 602          
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Match: A0A067E5G1_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g001648mg PE=4 SV=1)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 442/802 (55.11%), Postives = 558/802 (69.58%), Query Frame = 2
Query:  116 MEEKRRDAGNSPAGPSSAEL-------EPATTRRRAGAQKRKANXXXXXXXXXXXXKRATREKXXXXXXXXXXXXXGPLTRARQ--XXXXXXXXXXXXXXXXXXKLEERILVKESVKAEDXXXXXXXXXXXXXXXXXXXXXXXXVRSRDSNAHVVPNHCGWFSWKKAHHVEECILPSFFNGKSPVRTPDVYLEIRNSIMKKFHANPSVQIESKDLPDIEVGDLDARQEVLEFLDYWGLINFHPFPPGDSAVVSADGD------CDGIAKKDSLLENLFHFEVIESRPSVVPKANLSTPSMPSGFLPESAVLDDLLRLEGPSVDYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNRKFGSGMSSSDFILMEPGEASGLSGGKWTDQXXXXXXXXXXXYKENWNEIAEHVATKTKAQCILHFLQMPIEDVFFNCDDNNIDTNSKETAGPAAMNDETTVAXXXXXXXXXXXXXXD-QAKTKPMETSKPEDEKEVGGSEEPSETKTGTDVKGVKETLKPEDMNVPKDGLEATENCALTAIREAFEAVGYNLTSESKLSFADVGNPVMALAGFFAHLVGPNIXXXXXXXXXXXXXGTCPNIQLAARNCFVLEDPP-DEKEPTCSRSVANDTGNRGAQNVKHSEDESLKG-------DQKSSLSHHGDENTEVSLREENATSPSPNDLTTDKKES----TNFATNEEDKKANLNESSIINQSKDHQPSVTRVSNTITSQVLPSTLEETGGKGTAKEPSQPPKAVKEVD-MSDSVQLKKNEPCDAAASKPVGELSEPADASENLETAS 2434
            MEEKRR+AG  PA  SSA         EPA++RRRAGA KRKA++LS +++SSTPSKR TREK+    +    ++ GPLTRARQ     +   A G   G  G KLE     ++    E +EELNKASEE  ALEAKIEA+FEA+RSRDSN HVVP HCGWFSW K H +EE  LP+FFNGKS  RTPD+Y+EIRN IMKKFH+NP  QIE KDL ++EVG LDARQEV+EFLDYWGLINFHPFP  +S+V ++DGD       D  AKK SLLE L+ FE I++ P V P  +++ P++PSG  PESA+ ++L +LEGP+V+YHCNSCSADCSRKRYHCQKQADFDLCTDCFNN KFGS MSSSDFILM PGEA+G+SGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHF+QMPIED+F +CDD ++D N KET   A  N +T+ +K+V+E +ESKT   + Q +T PMETSKPED  E+   E+ S+ K  +DVK  ++ LK ED +  K G E  EN AL A+REAFEAVGY  T E+  SFA+VGNPVMALA F   L GP++  AS++SSLKS+SG  P +QLAA++CF+LEDPP D+KE   S S+  +  +R  Q  +  ED ++K        D++   + HGD+  E S+ EE   + S N+  ++K        N  T E+D+  +LNE S     KD+QPS+   SN + S+VL S+ +E+ G+G++ EP+ P    K+   +SDS+   KNEP     S  V E S P+  + +++  S
Sbjct:    1 MEEKRREAGAQPAATSSAAAGAESAASEPASSRRRAGAHKRKASALSATNASSTPSKRMTREKNLVAHTPIYNHN-GPLTRARQGPTTLAAAAAFGGAPGSAGGKLE---AARDDSTFEAIEELNKASEEWAALEAKIEADFEAIRSRDSNVHVVPTHCGWFSWTKIHPLEEQALPAFFNGKSQDRTPDIYMEIRNWIMKKFHSNPITQIELKDLSELEVGSLDARQEVMEFLDYWGLINFHPFPHVESSVANSDGDRMTDADSDAAAKKGSLLEKLYRFEEIKAGPPVAPMPSITFPAVPSGLFPESAIAEELAKLEGPAVEYHCNSCSADCSRKRYHCQKQADFDLCTDCFNNGKFGSDMSSSDFILMVPGEAAGVSGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFVQMPIEDMFLDCDD-DVDGNLKETTDDAPTNGDTSASKDVAEASESKTGAVEGQTQTSPMETSKPEDASELKICEDTSKPKDESDVKVDEQMLKSEDTSEGKVGQETGENIALKALREAFEAVGYVPTHETPQSFAEVGNPVMALAAFLTLLGGPDLTTASARSSLKSISGNSPAMQLAAKHCFILEDPPGDKKEVAHSESIVAEMADRDIQKDETLEDINVKECNSASVLDERDLSNDHGDKKIEDSVPEEKRHAASLNEKPSEKLNGATGPANQDTPEKDEPGDLNELSNPKSPKDNQPSIVEESNDLPSKVLQSSQKES-GEGSSGEPAPPVDVEKDNSLLSDSLPSGKNEPDQRVLSNSVAEPSPPSKLTNDVDMVS 796          

HSP 2 Score: 202.601 bits (514), Expect = 1.391e-49
Identity = 128/186 (68.82%), Postives = 144/186 (77.42%), Query Frame = 1
Query: 2953 DKIEEGKSKNHDSTEREDNSSIDKXXXXXXXXXXXXXXXXXXXXDQEEDQIRQLTTSLIEKQLHKMEAKLSFFNEMEGVVMRVKEQLDRSRQRLYHERTQIIAARLGLPASSSRAMPPPNAANRVATNFANSVARPPMSMKAPRPPLSRPMGSMTPTPSNPYVSNTVAGSSIRPGSQDNLSSVGTK 3510
            D+  +G+ + HDS E +++  IDKLK AAVTALSAAAVKAKLLA QEEDQIRQL TSLIEKQL K+EAKL+FFNEM+ V MRV+EQL+RSRQRLY ER  II ARLG     SR M P   ANR    FANSVARPPMSM +PRPP+SRPM   + TPSNP+ S T AGSSIRP SQDNLSSVG K
Sbjct:  857 DQNRDGQDEKHDSKETKNDQYIDKLKHAAVTALSAAAVKAKLLACQEEDQIRQLATSLIEKQLQKLEAKLAFFNEMDNVTMRVREQLERSRQRLYQERALIIQARLG----PSRVMQPSVPANRNPMTFANSVARPPMSMTSPRPPISRPMVPQSSTPSNPFGSTTTAGSSIRPSSQDNLSSVGMK 1038          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 24
Match NameE-valueIdentityDescription
SWI3D_ARATH2.020e-14645.99SWI/SNF complex subunit SWI3D OS=Arabidopsis thali... [more]
SWI3C_ARATH1.383e-4238.60SWI/SNF complex subunit SWI3C OS=Arabidopsis thali... [more]
SSR2_SCHPO2.909e-2933.22SWI/SNF and RSC complexes subunit ssr2 OS=Schizosa... [more]
SWI3B_ARATH1.493e-2329.64SWI/SNF complex subunit SWI3B OS=Arabidopsis thali... [more]
SMRC1_HUMAN2.620e-2328.67SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN... [more]
SMRC1_MOUSE3.678e-2328.52SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN... [more]
RSC8_YEAST1.224e-2230.58Chromatin structure-remodeling complex protein RSC... [more]
SMRC2_MOUSE3.174e-2229.41SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN... [more]
SMRC2_HUMAN3.258e-2229.41SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN... [more]
SWI3A_ARATH1.473e-1927.96SWI/SNF complex subunit SWI3A OS=Arabidopsis thali... [more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092725 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2V5P2_GOSRA0.000e+086.87Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2VZQ8_GOSRA1.562e-9286.60Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2V6W7_GOSRA0.000e+086.62Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2S3J9_GOSRA2.599e-1186.60Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MJQ1_GOSAR2.347e-9085.32SWI/SNF complex subunit SWI3D-like protein OS=Goss... [more]
A0A0D2RKZ3_GOSRA5.180e-7080.71Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0NXU7_GOSAR2.701e-7080.35SWI/SNF complex subunit SWI3D-like protein OS=Goss... [more]
A0A061E077_THECC2.711e-7075.09Chromatin remodeling complex subunit, putative iso... [more]
A0A0D2TQ48_GOSRA0.000e+082.46Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A067E5G1_CITSI1.391e-4955.11Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 108..135
NoneNo IPR availablePANTHERPTHR12802:SF39SWI/SNF COMPLEX SUBUNIT SWI3Dcoord: 826..832
coord: 120..237
NoneNo IPR availablePANTHERPTHR12802SWI/SNF COMPLEX-RELATEDcoord: 534..691
coord: 120..237
NoneNo IPR availablePANTHERPTHR12802:SF39SWI/SNF COMPLEX SUBUNIT SWI3Dcoord: 259..432
NoneNo IPR availablePANTHERPTHR12802:SF39SWI/SNF COMPLEX SUBUNIT SWI3Dcoord: 534..691
NoneNo IPR availablePANTHERPTHR12802SWI/SNF COMPLEX-RELATEDcoord: 259..432
NoneNo IPR availablePANTHERPTHR12802SWI/SNF COMPLEX-RELATEDcoord: 826..832
NoneNo IPR availableSUPERFAMILY57850RING/U-boxcoord: 307..359
IPR000433Zinc finger, ZZ-typeSMARTSM00291zz_5coord: 305..349
e-value: 2.9E-8
score: 43.5
IPR000433Zinc finger, ZZ-typePFAMPF00569ZZcoord: 308..343
e-value: 1.6E-8
score: 34.1
IPR000433Zinc finger, ZZ-typePROSITEPS01357ZF_ZZ_1coord: 311..337
IPR000433Zinc finger, ZZ-typePROSITEPS50135ZF_ZZ_2coord: 305..351
score: 8.978
IPR001005SANT/Myb domainSMARTSM00717santcoord: 364..412
e-value: 1.5E-12
score: 57.7
IPR001005SANT/Myb domainPFAMPF00249Myb_DNA-bindingcoord: 366..409
e-value: 1.2E-11
score: 44.5
IPR011991Winged helix-turn-helix DNA-binding domainGENE3D1.10.10.10coord: 145..236
e-value: 1.2E-16
score: 59.8
IPR007526SWIRM domainPFAMPF04433SWIRMcoord: 147..232
e-value: 2.6E-18
score: 66.0
IPR007526SWIRM domainPROSITEPS50934SWIRMcoord: 144..241
score: 19.408
IPR009057Homeodomain-likeGENE3D1.10.10.60coord: 362..406
e-value: 2.3E-8
score: 33.2
IPR009057Homeodomain-likeSUPERFAMILY46689Homeodomain-likecoord: 363..416
IPR009057Homeodomain-likeSUPERFAMILY46689Homeodomain-likecoord: 151..233
IPR017884SANT domainPROSITEPS51293SANTcoord: 363..414
score: 22.659

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092725 ID=g.barbadense_cottongen_reftransV1_0092725|Name=g.barbadense_cottongen_reftransV1_0092725|organism=Gossypium barbadense|type=contig|length=4555bp
AATCAATTACCTTAGCCTGGCGATAGCAAAATCACAGCAACAAATTTCAC
ACTGACAGACTCAAAGTTCATTTTTTTTTTTGCCTTCTGGAAAACCAATC
TCCTGACCCGTGGTGATGGAGGAGAAACGCCGGGACGCGGGGAACTCACC
GGCTGGACCGAGCTCAGCCGAGCTGGAGCCGGCAACAACTCGCCGTCGAG
CTGGAGCACAAAAGAGGAAAGCTAATTCTCTTTCCGGGTCCAGCTCATCA
TCGACGCCGTCGAAACGGGCTACACGGGAGAAGTCATCTAACTTGATCTC
CCACTCTTCGATCAACCATAACGGTCCTTTAACTAGGGCTCGCCAAGGAG
CGCCTAGTGGAAACCTAGCCTTGGGTTTGGGCTCGGGATTCGGTGGCGCG
AAGCTTGAGGAGAGGATTTTGGTTAAAGAGAGTGTGAAGGCTGAAGATTT
GGAGGAATTGAATAAGGCAAGTGAAGAGTTGGAGGCTTTGGAAGCTAAGA
TTGAAGCTGAGTTTGAAGCTGTTAGGTCTCGTGACAGTAATGCGCACGTG
GTTCCTAATCATTGCGGATGGTTTTCATGGAAAAAAGCTCACCATGTGGA
GGAATGTATATTACCTTCATTCTTTAATGGGAAATCCCCAGTGCGTACCC
CTGATGTGTACTTGGAGATACGTAATAGCATTATGAAGAAATTTCATGCA
AATCCGAGTGTACAAATTGAGTCTAAAGATCTGCCAGATATTGAAGTTGG
CGACTTGGATGCAAGGCAGGAAGTACTGGAGTTCTTGGACTACTGGGGTT
TGATTAACTTTCATCCATTCCCTCCAGGTGATTCTGCCGTGGTCAGCGCT
GATGGTGATTGTGACGGGATAGCGAAAAAGGATTCTTTGCTTGAAAATTT
GTTTCATTTTGAGGTGATTGAATCGCGCCCATCAGTTGTTCCCAAAGCTA
ACCTTTCAACTCCATCCATGCCATCTGGGTTTCTTCCTGAATCTGCAGTT
CTTGATGATTTGTTGAGACTTGAGGGACCATCTGTTGATTACCATTGCAA
CTCTTGTTCAGCTGATTGCTCTCGGAAGCGCTACCATTGCCAGAAGCAGG
CAGATTTTGACTTATGTACTGATTGCTTTAACAACCGGAAGTTTGGCTCT
GGCATGTCTTCTTCTGATTTTATTCTCATGGAGCCTGGTGAGGCCTCTGG
CCTTAGCGGCGGGAAGTGGACAGATCAGGAAACTCTCCTTCTTCTCGAGG
CACTAGAACTTTATAAAGAAAACTGGAATGAGATTGCAGAGCATGTTGCG
ACAAAAACCAAAGCTCAATGCATACTGCACTTTCTTCAAATGCCAATTGA
GGATGTATTTTTTAATTGTGATGATAATAACATAGACACGAATTCAAAAG
AAACTGCTGGCCCAGCTGCCATGAATGATGAAACAACTGTCGCTAAAGAA
GTCTCGGAAACAACAGAGAGTAAGACTACTCAAGAAGATCAGGCCAAGAC
TAAGCCGATGGAAACTTCAAAACCTGAAGATGAAAAAGAAGTCGGGGGTA
GTGAGGAACCATCAGAAACCAAAACTGGAACTGATGTAAAAGGTGTTAAA
GAAACATTAAAGCCAGAAGATATGAATGTACCAAAAGATGGACTAGAAGC
AACTGAAAATTGTGCCCTTACAGCAATAAGGGAGGCATTTGAAGCTGTCG
GTTATAATTTAACATCCGAAAGCAAACTTTCATTTGCTGATGTAGGAAAT
CCTGTCATGGCATTGGCAGGATTCTTTGCACATCTGGTTGGACCCAACAT
TGCTGCTGCTTCATCCCAGAGTTCACTTAAATCATTATCTGGTACTTGTC
CGAACATTCAACTGGCTGCCAGGAACTGCTTTGTTTTGGAAGATCCACCA
GATGAGAAGGAACCAACATGTTCTAGGAGTGTTGCCAATGATACGGGTAA
TCGGGGTGCTCAGAATGTGAAACACTCGGAAGACGAAAGCCTCAAGGGGG
ATCAGAAAAGTTCATTGAGCCACCATGGTGACGAAAACACTGAAGTCTCT
CTTCGTGAAGAGAATGCGACATCGCCTTCACCCAATGACCTAACCACGGA
TAAAAAAGAGTCAACCAATTTTGCCACTAATGAGGAAGATAAAAAAGCTA
ATTTGAATGAATCCAGCATTATTAATCAATCAAAGGATCATCAACCAAGT
GTAACAAGGGTATCAAATACCATAACATCCCAGGTTCTACCAAGTACTCT
AGAGGAGACAGGTGGGAAGGGAACAGCTAAAGAACCTTCTCAGCCTCCAA
AAGCAGTGAAGGAAGTAGATATGTCTGATTCTGTTCAACTGAAAAAGAAT
GAGCCTTGTGATGCCGCTGCATCAAAGCCAGTGGGAGAGCTATCTGAACC
AGCAGATGCATCAGAAAATCTAGAGACAGCTTCCTGCTCTCCATCCAGAT
CAAAGAATGAGCAAAAAACTGTTAAACCAATCCCTGATGGGGAATCTACG
GAGCCTGCAGATGCATCAGATGATGTTCAACTGGTGTCTGTTTCACAACC
ATCTGAAAGGAGTGAACCTCCACAGCCAGTCACATCGAATTCAGTAAATG
AAAATGGAGTAACGACAGGTTTCTCTCTTTTCTTCTATAAATATCTTGTT
AGAAAGTGGAAGCCGCATTAACAGAATCTAACTCTACTGCAAAATGCTTA
GCAATATCTTATGGGAATATGTAGGGATAGATAGCGTCTGATTTAAAATA
TACAAAGAAGGCTAAAAGGAACAGTTGGTTCTATAAGGTTGAGCGTTTGC
TATCTTTATTGGTTTTACATAGAGCAGCTAGGAAAATTGAAACTTGATAC
ATAATGTTGTTTCTACTAGGTTCTGTAGAGGTATGTATTCCAAGAACCAC
CTGCTGGCAAAATGCATAGATCAATTTTGGGTGTATCTTATTGTTCTTTG
CAGACAAGATCGAAGAAGGTAAAAGCAAGAACCATGACTCTACAGAGAGA
GAAGATAATAGTAGCATTGATAAATTAAAGAGAGCTGCAGTTACAGCACT
CTCAGCAGCAGCAGTGAAGGCAAAACTTCTAGCAGACCAGGAAGAGGACC
AAATCCGACAACTTACCACATCATTAATAGAAAAGCAGTTACATAAGATG
GAAGCCAAATTATCTTTCTTCAATGAGATGGAGGGAGTCGTAATGAGGGT
GAAGGAGCAATTGGACAGGTCAAGGCAAAGGCTTTACCATGAGCGAACGC
AGATAATTGCTGCTCGACTGGGCTTACCAGCTTCCTCCTCTAGAGCAATG
CCACCACCAAATGCTGCAAATAGAGTTGCAACAAACTTTGCAAACTCGGT
TGCAAGGCCTCCAATGAGCATGAAAGCCCCAAGACCACCATTGTCGAGAC
CCATGGGTTCTATGACCCCTACCCCTTCCAACCCATATGTATCCAATACA
GTTGCAGGGAGTTCAATTCGACCTGGTAGCCAAGACAATCTTTCCTCCGT
TGGAACCAAGTAGTCTCTATTCATATTACTTGTGAATAGAATTTTTCAAT
CCATTCTTATACAAGGGTCATCCATCTTGAGATGCATCTGGTTAGTACCC
CCTTTTTTTATTGTTGCAGTTTCTGTTCTTAACGCTGCCAGTCATCTTGG
GTGCATTTAAGAACTTGAGAATATACTCAAGCTGAACTCATGGCATATTC
ATATCTGATGTTTTCTGCTAATTCCAGCCACACCACTGATTTATCTCCGG
ATACTGCGGCCTATATTACATAATTGACTGGCATCACATCATCATAGGAG
GAAGGAGTAGATGGTTATTGTTCTCCCTTCAATCCTAATCTAGTCAACAA
CAGTCTATAGCCTTTGTCTAACTTGGAATTTTCTTGAATGCTTTTGGGTT
TTTGTAAGTCTAGTTTGTAGTTGATATTTTGAGACCTCAAATGATGAATT
TAGGTACTGCAAAGTTAAACATCCGTAACCATACCAAATTCTTAGGTCAT
CTTTAAGGTCAGATATAACCAATGTATTCTATATTTATGGATGAACAGAT
GTGTTTTTGTTGTTACAAAATGGCGTAAATCTCTTGGTTTGAAGCTCCCT
TTTCTCACCTGTAATGGCTTCCTTTAGTGTCATATATCCGACTACCCAAA
TTGCATTATATGCCTCTCGAGAACACCACACAGCACAGGCAGGAAAGTTA
GATCAGCTGAAATCAGGCTGCAAAATAACTTCTAAAAATGGGTTAACTTT
TAAATATTATAACAATTAAGTCCCTTAAGTCTGACACGTTTCAAACCTAA
CGAAAGCAACAGGGGGCCAACATTATTGGTGGAATAAACAATCACTCCTA
ATCCATACAAGAAGAAGAAGAAAAAACTAGCAAGATAATCATCTTAATAA
TGAATTACAGTCACATTATACTCAACAATGGCGTCGCCAGTCTTGAAATT
TACGGTATAAGTCTTGAGTTGTGCATACCCTTTCGCCATCCTGAACTTCC
CTTTCCCTCCGACCACCGCAAGCTCACGCTCCGATTCGGTAATTGGATTC
CTCGA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR000433Znf_ZZ
IPR001005SANT/Myb
IPR011991WHTH_DNA-bd_dom
IPR007526SWIRM
IPR009057Homeobox-like_sf
IPR017884SANT_dom
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0003677DNA binding