g.barbadense_cottongen_reftransV1_0092691, g.barbadense_cottongen_reftransV1_0092691 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092691
Unique Nameg.barbadense_cottongen_reftransV1_0092691
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2718
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
At11chromosomeg.barbadense_cottongen_reftransV1_0092691:1..2718 .
At11:63997310..64000435 -
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: LYK5_ARATH (Protein LYK5 OS=Arabidopsis thaliana GN=LYK5 PE=2 SV=1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 355/652 (54.45%), Postives = 457/652 (70.09%), Query Frame = -2
Query:  603 QAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDY--ETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXXXXFRRQRQAHKARPIATASXXXXXPFNLKPFSDSTTYTPNSWSVSISSQ----GVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDV-SSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAE----KNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSL 2525
            +AQQ YVNN QLACE    DN I+ GF+CNG   SC+SY+TF S+PP YNTA SIA LL+  A +I S+NNL    + I  + +VV+P NCS   + +  +YQHNA+Y +  +   ETYFS++NDTYQ L+TCQAM +QN    R L  G  L+VP+RCACPT  Q  AG KYLL+Y+V  GDSIS  AE F +   ++ E NEL+ D+I F FTPVLVPL+ EP+ I    S PPP  V   P +PV    S SS KW++IG+G+G G LLLL +    F   R ++++     + ++ P     F+        T T   WS+ +S+     G++ AIESLT Y+F DL++AT NFS+ NRIKGSV+R +  GD AA+KV+ GDV SSEINLLKK+NH+NIIRLSGFC+ EG +YLV+EY++ GS+SD LHS+  +   +L+WKQRV+IA DVA+AL+YLHNYI PP+IHKNL+S+NILLD NFRAK+ NFG+AR +++ D   LQLTRHV GT+GY+APEY+ENGVIT KLDVFA GV +LELLSG +A             E+L   I  VL G+NVREKLK F+DPSLG EYPL+LA++MAQLAK CVA DL++RPS+  VL TLS I+SSS+DW+PS +  RS SL
Sbjct:   25 KAQQPYVNNHQLACEVRVYDN-ITNGFTCNGPP-SCRSYLTFWSQPP-YNTADSIAKLLNVSAAEIQSINNLPTATTRIPTRELVVIPANCS-CSSSSGGFYQHNATYNLSGNRGDETYFSVANDTYQALSTCQAMMSQNRYGERQLTPGLNLLVPLRCACPTAKQTTAGFKYLLTYLVAMGDSISGIAEMFNSTSAAITEGNELTSDNIFF-FTPVLVPLTTEPTKIVISPSPPPPPVVATPPQTPVDPPGSSSSHKWIYIGIGIGAGLLLLLSILALCFYKRRSKKKS-----LPSSLPEENKLFDSSTKQSIPTTTTTQWSIDLSNSSEAFGLKSAIESLTLYRFNDLQSATSNFSDENRIKGSVYRATINGDDAAVKVIKGDVSSSEINLLKKLNHSNIIRLSGFCIREGTSYLVFEYSENGSISDWLHSSGKK---SLTWKQRVEIARDVAEALDYLHNYITPPHIHKNLESTNILLDSNFRAKIANFGVARILDEGDL-DLQLTRHVEGTQGYLAPEYVENGVITSKLDVFAFGVAVLELLSGREAVTIHKKKEGEEEVEMLCKVINSVLGGENVREKLKEFMDPSLGNEYPLELAYTMAQLAKSCVATDLNSRPSVTQVLTTLSMIVSSSIDWEPSDDLLRSGSL 662          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: LYK4_ARATH (LysM domain receptor-like kinase 4 OS=Arabidopsis thaliana GN=LYK4 PE=1 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.354e-68
Identity = 131/302 (43.38%), Postives = 199/302 (65.89%), Query Frame = -2
Query:  627 AIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLAR-TIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSS 1529
             +ESL  YKF +L++AT +F+ S+ I GS + G   GD A +K + G+ S E+NLL K+NH NIIRLSGFC HEG+ YLVYE+A  GS+S+ +H+ K   S T    Q++QIA D+A  LNYLHN+ +PPY+H++L S+N+ LD+ FRAK+ + G AR T ED       LT+HV GT+GY+APEY+E+G+++ KLDV+A GV++LE+++G++A+  +K   E    A   +++ G  + E L +F++                +L   C+  D   RPSM + +++LSKIL+++ +W+ SS
Sbjct:  337 VVESLKVYKFHELQSATSDFTSSSSIGGSGYIGKINGDGAMIKKIEGNASEEVNLLSKLNHLNIIRLSGFCFHEGDWYLVYEHASNGSLSEWIHTTKSLLSLT----QKLQIALDIATGLNYLHNFADPPYVHRDLNSNNVFLDLEFRAKIGSLGSARSTTED-----FVLTKHVEGTRGYLAPEYLEHGLVSTKLDVYAFGVVLLEIVTGKEASELKKEIDEG--KAIDEILIHGRLLPEGLTSFVE----------------RLVVDCLKKDHLNRPSMDENVMSLSKILAATQNWEESS 611          

HSP 2 Score: 174.481 bits (441), Expect = 1.817e-44
Identity = 98/224 (43.75%), Postives = 142/224 (63.39%), Query Frame = -2
Query: 1869 FTQAQQGYVNNLQLACEDPTKDNNISR-GFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRA-GAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELS-EDDIIFPFTPVLVPL 2531
            F  AQQ YV      C     DN  S  G+SCNG  ++CQ+Y+ FRS P F +T  SI+ L     + +SSLN+ S   +S      V++P+ CSC+G  +DS  Q N +YT++ + ++YF+I+NDT QGL+TCQA+  QN +  ++L  G ++VVPIRCACPT  QI   G KYL+SY V + D+I+  ++ FG +    L+ANE+S E+  +FPFT +L+PL
Sbjct:   19 FATAQQPYVGISTTDCS--VSDNTTSVFGYSCNGLNKTCQAYVIFRSTPSF-STVTSISSLFSVDPSLVSSLNDASPS-TSFPSGQQVIIPLTCSCTG--DDS--QSNITYTIQPN-DSYFAIANDTLQGLSTCQALAKQNNVSSQSLFPGMRIVVPIRCACPTAKQINEDGVKYLMSYTVVFEDTIAIISDRFGVETSKTLKANEMSFENSEVFPFTTILIPL 233          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: LYK3_ARATH (LysM domain receptor-like kinase 3 OS=Arabidopsis thaliana GN=LYK3 PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 8.442e-59
Identity = 120/315 (38.10%), Postives = 192/315 (60.95%), Query Frame = -2
Query:  630 IESLTRYKFEDLKAATGNFSESNRIK----GSVFRGSFQGDAAAMKVMNG----DVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDA-----ANAEKNGGEELLSASIRVVLQG--DNVR-EKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPS 1526
            IE    + +E+++AAT  FS+SN +     GSV+ G  +    A+K M      + ++E+ +L K++H+N++ L G+       ++VYEY  KG +   LH  + + +  LSW  R QIA D A  L Y+H +    Y+H+++K+SNILLD  FRAK+++FGLA+ +E   EG + +T+ VVGT GY+APEY+ +G+ T K D++A GV++ E++SG +A     A   KN     L++ +  VL+   D++    LK F+DP++   YP D  F +A LAK CV  D   RP+M  V+++LS+IL SS++W+ +
Sbjct:  323 IEKPMVFTYEEIRAATDEFSDSNLLGHGNYGSVYFGLLREQEVAVKRMTATKTKEFAAEMKVLCKVHHSNLVELIGYAATVDELFVVYEYVRKGMLKSHLHDPQSKGNTPLSWIMRNQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDEAFRAKISDFGLAKLVEKTGEGEISVTK-VVGTYGYLAPEYLSDGLATSKSDIYAFGVVLFEIISGREAVIRTEAIGTKNPERRPLASIMLAVLKNSPDSMNMSSLKEFVDPNMMDLYPHDCLFKIATLAKQCVDDDPILRPNMKQVVISLSQILLSSIEWEAT 636          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: CERK1_ARATH (Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 4.952e-56
Identity = 121/324 (37.35%), Postives = 185/324 (57.10%), Query Frame = -2
Query:  591 AIESLTRYKFEDLKAATGNFSESNRIK----GSVFRGSFQGDAAAMKVMNGDVS----SEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAA--NAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSS-EFERSTSLTSAR 1529
            +++    +  E+L  AT NF+ S +I     G+V+    +G+ AA+K M+ + S    +E+ +L +++H N++RL G+CV EG+ +LVYEY + G++   LH +  +    L W +RVQIA D A  L Y+H +  P Y+H+++KS+NIL+D  FRAKV +FGL +  E     G   TR  +GT GYMAPE +  G ++ K+DV+A GV++ EL+S + A     E  G    L        +  +  E L+  IDP LG  YP D  + MA+L K C   +   RPSM  ++V LS + SS+ +WD  + + E   SL S R
Sbjct:  303 SVDKSVEFSLEELAKATDNFNLSFKIGQGGFGAVYYAELRGEKAAIKKMDMEASKQFLAELKVLTRVHHVNLVRLIGYCV-EGSLFLVYEYVENGNLGQHLHGSGREP---LPWTKRVQIALDSARGLEYIHEHTVPVYVHRDIKSANILIDQKFRAKVADFGLTKLTEV----GGSATRGAMGTFGYMAPETVY-GEVSAKVDVYAFGVVLYELISAKGAVVKMTEAVGEFRGLVGVFEESFKETDKEEALRKIIDPRLGDSYPFDSVYKMAELGKACTQENAQLRPSMRYIVVALSTLFSSTGNWDVGNFQNEDLVSLMSGR 617          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: CERK1_ORYSJ (Chitin elicitor receptor kinase 1 OS=Oryza sativa subsp. japonica GN=CERK1 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.051e-50
Identity = 116/319 (36.36%), Postives = 179/319 (56.11%), Query Frame = -2
Query:  633 SQGVRHAIESLTRYKFEDLKAATGNFSESNRIK----GSVFRGSFQGDAAAMKVMNGDVS----SEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDA--ANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSS----LDWDP 1547
            ++G++  +E    + +E++  AT  FS  ++I     GSV+    +G+  A+K M    +    +E+ +L  ++H N++RL G+CV E   +LVYE+ D G++S  L    +     LSW  RVQIA D A  L YLH ++ P Y+H+++KS+NILLD +FRAK+ +FGLA+  E        L+  V GT GYM PE    G ++PK+DV+A GV++ ELLS + A   ++E     + L       L   N  E L   IDPSL  +YP+D A  +A LAK C   +   RP+M  V+V L  + +++    +D+ P
Sbjct:  294 AEGIK--VERSIEFSYEEIFNATQGFSMEHKIGQGGFGSVYYAELRGEKTAIKKMGMQATQEFLAELKVLTHVHHLNLVRLIGYCV-ENCLFLVYEFIDNGNLSQHLQRTGYAP---LSWATRVQIALDSARGLEYLHEHVVPVYVHRDIKSANILLDKDFRAKIADFGLAKLTEVGSM-SQSLSTRVAGTFGYMPPE-ARYGEVSPKVDVYAFGVVLYELLSAKQAIVRSSESVSESKGLVFLFEEALSAPNPTEALDELIDPSLQGDYPVDSALKIASLAKSCTHEEPGMRPTMRSVVVALMALTANTDLRDMDYHP 604          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: Y2197_ARATH (Probable protein kinase At2g41970 OS=Arabidopsis thaliana GN=At2g41970 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.295e-45
Identity = 104/300 (34.67%), Postives = 163/300 (54.33%), Query Frame = -2
Query:  651 FEDLKAATGNFSESNRIK----GSVFRGSFQGDAAAMKVMNG--------DVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNK----FQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSS 1502
             ++L    GNF     I     G VF G F+G+A A+K ++         D +S+++++ ++ H + + L G+C+   N  L+Y++A KGS+ D+LH  K     +    L+W QRV+IAY  A  L +LH  + PP +H++++SSN+LL  +F AK+ +F L     D     L  TR V+GT GY APEY   G IT K DV++ GV++LELL+G    +     G++ L       L  D    K+K  IDP L  ++P      +A +A +CV ++   RP+M  V+  L  +L+S
Sbjct:   63 LDELNRMAGNFGNKALIGEGSYGRVFCGKFKGEAVAIKKLDASSSEEPDSDFTSQLSVVSRLKHDHFVELLGYCLEANNRILIYQFATKGSLHDVLHGRKGVQGAEPGPVLNWNQRVKIAYGAAKGLEFLHEKVQPPIVHRDVRSSNVLLFDDFVAKMADFNLTNASSDT-AARLHSTR-VLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSED----KVKQCIDPKLNNDFPPKAVAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNS 356          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: Y5158_ARATH (Probable receptor-like protein kinase At5g15080 OS=Arabidopsis thaliana GN=At5g15080 PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.885e-44
Identity = 102/308 (33.12%), Postives = 164/308 (53.25%), Query Frame = -2
Query:  660 LTRYKFEDLKAATGNFSESNRIK----GSVFRGSFQ-----------GDAAAMKVMNGD-------VSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKI 1517
            L ++ F DLK +T NF   + +     G VF+G  +           G   A+K +N D         +EIN L  + H N+++L G+C+ +    LVYE+  +GS+ + L    F+ S  L W  R++IA   A  L++LH     P I+++ K+SNILLD ++ AK+++FGLA+  +  DEG   ++  V+GT GY APEY+  G +T K DV++ GV++LE+L+G  + +  +  GE  L    R  L     + +    +DP L   + +  A  + QLA  C++ D   RP M+DV+  L  +
Sbjct:  127 LRKFTFNDLKLSTRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNPDGLQGHKEWLAEINFLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHL----FRRSLPLPWSIRMKIALGAAKGLSFLHEEALKPVIYRDFKTSNILLDADYNAKLSDFGLAK--DAPDEGKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLD---KRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDVVEALKPL 425          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: ALE2_ARATH (Receptor-like serine/threonine-protein kinase ALE2 OS=Arabidopsis thaliana GN=ALE2 PE=1 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.031e-43
Identity = 104/299 (34.78%), Postives = 160/299 (53.51%), Query Frame = -2
Query:  660 SLTRYKFEDLKAATGNFSESNRIK----GSVFRGSFQ-GDAAAMKVMNGD-------VSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKI 1520
            S+  +   +L+ AT  FS    +     G V++GS + G   A+K++  D         +E+ +L +++H N+++L G C+      L+YE    GSV   LH        TL W  R++IA   A  L YLH   NP  IH++ K+SN+LL+ +F  KV++FGLAR   +  EG   ++  V+GT GY+APEY   G +  K DV++ GV++LELL+G    +  +  GEE L    R +L     RE L+  +DP+L   Y  D    +A +A +CV  ++S RP M +V+  L  I
Sbjct:  333 SVKTFTLSELEKATDRFSAKRVLGEGGFGRVYQGSMEDGTEVAVKLLTRDNQNRDREFIAEVEMLSRLHHRNLVKLIGICIEGRTRCLIYELVHNGSVESHLHEG------TLDWDARLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVSDFGLAR---EATEGSQHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRRPVDMSQPSGEENLVTWARPLLAN---REGLEQLVDPALAGTYNFDDMAKVAAIASMCVHQEVSHRPFMGEVVQALKLI 619          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: PBS1_ARATH (Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.587e-43
Identity = 105/311 (33.76%), Postives = 160/311 (51.45%), Query Frame = -2
Query:  615 YKFEDLKAATGNFSESNRIK----GSVFRGSFQ--GDAAAMKVM-------NGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFER 1508
            + F +L AAT NF     +     G V++G     G   A+K +       N +   E+ +L  ++H N++ L G+C       LVYE+   GS+ D LH         L W  R++IA   A  L +LH+  NPP I+++ KSSNILLD  F  K+++FGLA+     D+    ++  V+GT GY APEY   G +T K DV++ GV+ LEL++G  A ++E   GE+ L A  R +    N R K     DP L   +P    +    +A +C+    + RP +ADV+  LS + + +  +DPS +  R
Sbjct:   74 FAFRELAAATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKE-ALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKS--HVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLF---NDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQA--YDPSKDDSR 376          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Match: APK2A_ARATH (Protein kinase 2A, chloroplastic OS=Arabidopsis thaliana GN=APK2A PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.972e-43
Identity = 109/311 (35.05%), Postives = 163/311 (52.41%), Query Frame = -2
Query:  654 SLTRYKFEDLKAATGNFSESNRIK----GSVFRGSF-QGDAAAMKVMNGDVS-----------------SEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILS 1520
            +L  + F +LK AT NF + N +     G VF+G   Q    A +  +G V                  +E+N L +++H N++ L G+C    N  LVYE+  KGS+ + L     Q    L+W  R+++A   A  L +LH       I+++ K++NILLD +F AK+++FGLA+     D     ++  V+GT GY APEY+  G +T K DV++ GV++LEL+SG  A +   NGG E           GD  + KL   +D  LG +YP   AF+ A LA  C+  D   RP M++VLVTL ++ S
Sbjct:   70 NLKAFTFNELKNATKNFRQDNLLGEGGFGCVFKGWIDQTSLTASRPGSGIVVAVKQLKPEGFQGHKEWLTEVNYLGQLSHPNLVLLVGYCAEGENRLLVYEFMPKGSLENHLFRRGAQP---LTWAIRMKVAVGAAKGLTFLHE-AKSQVIYRDFKAANILLDADFNAKLSDFGLAKAGPTGDN--THVSTKVIGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELISGRRAMD-NSNGGNEYSLVDWATPYLGD--KRKLFRIMDTKLGGQYPQKGAFTAANLALQCLNPDAKLRPKMSEVLVTLEQLES 371          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: A0A0D2TL25_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G248700 PE=4 SV=1)

HSP 1 Score: 1169.07 bits (3023), Expect = 0.000e+0
Identity = 659/670 (98.36%), Postives = 664/670 (99.10%), Query Frame = -2
Query:  591 MAVGRXXXXXXXXXXXXXXXXLGFTQAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXXXXFRRQRQAHKARPIATASXXXXXPFNLKPFSDSTTYTPNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLTSAR 2600
            MAVGRLKPCLKFCLPFLLLFFLGFTQAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPT+NQIRAGAKYLLSYIVTWGDSISS AETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEPSMIKPPQSSPPPASVPQIPTSPVGESDSKSSKKWVFIGVGVGIGSLLLLGLAGFLFCFFRRQRQAHKARPIA ASPPPMPPFNLKPFSDST YTPNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNF ESNRIKGSVFRGSFQGD AA+KVM GDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQ+SFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVL+GDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDL+ARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLTSAR
Sbjct:    1 MAVGRLKPCLKFCLPFLLLFFLGFTQAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTYNQIRAGAKYLLSYIVTWGDSISSIAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEPSMIKPPQSSPPPASVPQIPTSPVGESDSKSSKKWVFIGVGVGIGSLLLLGLAGFLFCFFRRQRQAHKARPIAAASPPPMPPFNLKPFSDSTNYTPNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNFGESNRIKGSVFRGSFQGDDAAVKVMKGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQSSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLEGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLNARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLTSAR 670          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: A0A061F0X1_THECC (LRR receptor-like serine/threonine-protein kinase, putative OS=Theobroma cacao GN=TCM_025705 PE=4 SV=1)

HSP 1 Score: 977.622 bits (2526), Expect = 0.000e+0
Identity = 526/649 (81.05%), Postives = 570/649 (87.83%), Query Frame = -2
Query:  591 GFTQAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXXXXFRRQRQAHKARPIATASXXXXXPFNLKPFSDSTTYTPNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKN-GGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLTSAR 2534
            GF QAQQ YV+N QLACEDPTKDNNI+RG+ CNGEQRSCQSYITFRSEPPFYNTAVSIAYLL A+A QISSLN LSADVS IT KSMVVVPVNCSC    N SYYQHNASYT+KFD ETYFSISNDTYQGLTTCQAM+AQNPI++R L+VGN+L VP+RCACPT  Q + G KYLLSY+VTWGDSIS+ AETFG DEKS+L+ANEL+E D+IFPFTP+LVPLS+EP+ I+ PQ+SPP    PQIPT PV ES  KSSKKWVFIGVG+G G LLLLGLAGFLFCF RRQ +   + P    S            SDS  YT NSWS SISSQGVR+AIESLT Y+FEDL AA GNFSESNRIKGSV++GSFQGDAAA+KV+ GDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYE+ADKGSVSD LHSNKFQTSFTLSWKQRVQIAYD+ADALNYLHNYINPPY+HKNLK+SNILLDVNFRAK+ NFGLART EDNDEGGLQLTRHVVGT+GYMAPEYIENGVITPKLDVFALGVIILELLSG  AANAEKN GGEELL+ASI  VL+GDNVREKLKNFIDPSL PEYPLDLAFSMAQLAK CVAHDL+ARPSM++VLVTLSKILSSSLDWDPS EF+RSTSL SAR
Sbjct:   24 GFAQAQQSYVDNQQLACEDPTKDNNITRGYLCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLGAEAMQISSLNKLSADVSPITAKSMVVVPVNCSCFSGGNGSYYQHNASYTIKFDGETYFSISNDTYQGLTTCQAMEAQNPINFRELKVGNELTVPLRCACPTVRQTQGGVKYLLSYLVTWGDSISAIAETFGVDEKSLLDANELTEQDLIFPFTPLLVPLSKEPTKIELPQASPPSVPSPQIPTDPVEES--KSSKKWVFIGVGIGAGFLLLLGLAGFLFCFCRRQARPIASPPPKPPSQVKPS-------SDSANYTGNSWS-SISSQGVRYAIESLTLYRFEDLGAAAGNFSESNRIKGSVYQGSFQGDAAAVKVIKGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEFADKGSVSDWLHSNKFQTSFTLSWKQRVQIAYDIADALNYLHNYINPPYVHKNLKTSNILLDVNFRAKIANFGLARTFEDNDEGGLQLTRHVVGTQGYMAPEYIENGVITPKLDVFALGVIILELLSGRQAANAEKNSGGEELLAASIEGVLEGDNVREKLKNFIDPSLRPEYPLDLAFSMAQLAKNCVAHDLNARPSMSEVLVTLSKILSSSLDWDPSDEFQRSTSLGSAR 662          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: A0A061F748_THECC (LRR receptor-like serine/threonine-protein kinase, putative OS=Theobroma cacao GN=TCM_025707 PE=4 SV=1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 433/651 (66.51%), Postives = 520/651 (79.88%), Query Frame = -2
Query:  591 GFTQAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSL--NNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXXXXFRRQRQAHKARPIATASXXXXXPFNLKPFSDSTTYTPNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKN-GGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLTSAR 2534
            G TQ QQ Y+NN QL C D +KDNNI+RGF CNG ++SCQSY+TFR+EPP YN+AV+IAYLL AQ   ISSL  NNLS+DVS+I   S+V  P+NCSC+G    SYYQHN +YT+K D ETYF+++NDTYQGLTTCQAMKAQN I   +L+VG+KL VP+RCACPT +Q  AGAKYLL+YI  W DSISS AETFG D++SVL+AN+L ED +I+PFTPVLVPL+ EP+MI PPQ+SP P    QI  +P  +S  KSS KWVF+G+G+  G L L  L+G LFCF++    + KA P A+A P P      KP SDS  Y+  SW VSI   G  + +ESLT Y F+DL+AATGNFSESN IKGS++RG FQGD AA+KV+ GDVS E+NLLKKINH NI+RLSGFCVH GNTYLVYE+ +KGS+ D L ++K+QTSF+LSWKQRVQIAY+VADALNYLHNYINPP IH+NLK+S+ILLD NFRAKV NFGLAR++E  +EG LQLT HVVGT+GYMAPE+ ENGVITPKLDVFA GV++LELLSG  A  AEKN GGEELLSASI+ VL+G NV EKL+NFIDP+L  EYPLDLAFSMAQLA+ CVA+DL+ARPSMA+VL+T++KI SSSL W PS EF+   SL+SA+
Sbjct:   27 GSTQGQQAYLNNDQLECGDKSKDNNITRGFLCNGVKQSCQSYLTFRAEPP-YNSAVTIAYLLGAQPDLISSLRINNLSSDVSAIPANSLVFFPLNCSCAG----SYYQHNVTYTIKEDTETYFTMANDTYQGLTTCQAMKAQNSIGIMDLKVGDKLQVPLRCACPTLDQTYAGAKYLLTYIAGWEDSISSIAETFGVDDQSVLDANKLIED-MIYPFTPVLVPLAREPTMIVPPQASPSPPPPSQITITPTRKS--KSSHKWVFVGIGIAAGLLFLFSLSGLLFCFYKHP--SLKAEPEASAPPEP------KPLSDSIDYSDKSWFVSI--HGGTYEVESLTPYTFKDLEAATGNFSESNIIKGSIYRGQFQGDDAAVKVIKGDVSVEMNLLKKINHNNIVRLSGFCVHAGNTYLVYEHVEKGSLDDWLQTSKYQTSFSLSWKQRVQIAYNVADALNYLHNYINPPCIHRNLKTSSILLDGNFRAKVANFGLARSVE--NEGDLQLTTHVVGTQGYMAPEHFENGVITPKLDVFAFGVVLLELLSGRKA--AEKNAGGEELLSASIKGVLEGVNVAEKLQNFIDPTLRHEYPLDLAFSMAQLARNCVAYDLNARPSMAEVLITVTKICSSSLHWCPSDEFQ---SLSSAK 652          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: F6I6Y0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_18s0122g00230 PE=4 SV=1)

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 390/648 (60.19%), Postives = 486/648 (75.00%), Query Frame = -2
Query:  591 QAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADE-KSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXXXXFRRQRQAHKARPIATASXXXXXPFNLKPFSDSTTYTPNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTI--EDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLTSAR 2525
            QAQQ YVNN QL C++   + N   GF CNG  RSC SY+TFRS PP Y++  SIAYLL+++  QI+++N +S DV +I+  ++++VPVNCSCSG     +YQHN +YT+K   ETYFS++N+TYQGLTTCQA+KAQNP DYRNL VG  L VP+ CACPT NQ  AG  YLLSY+VTWGD+I S A+ FG D+ +S+ +AN LS   +I+PFTP+LVPL   PS I+   SSPP  S         G S+S  SKKWVFIG G+G   L+LL  +G +FCFFRR+RQ+ + +P+           +L   +  +    N  S+SIS +G+R  +ESLT YK+E+L+ A G F E+NRIKGSV+R SF+GD AA+K+M GDVS EIN+LK+INH+ +IRLSGFC+H GNTYLVYEYA+ G++ D LH +  +T  TL WKQRVQIAYD ADALNYLHN+I+PP IHKNLK SNILLD N R KVTNFGLAR +  E+ D GGLQLTRHVVGT+GYMAPEY+ENGV+TPKLD+FA GV+ILELL+G++AA ++K  G ELLS SI  VLQGDNVR+KL+ FIDP L  EYP DLAFSMAQLAK CVAHDL+ARP+M+D+ V LSKILSSSLDWDPS +F+ S SL+  R
Sbjct:   65 QAQQSYVNNHQLDCDNNFNETN---GFQCNGP-RSCHSYLTFRSAPPSYDSPPSIAYLLNSEPAQIATINEVS-DVDTISKDTVLIVPVNCSCSG----DFYQHNTTYTLKSASETYFSLANNTYQGLTTCQALKAQNPYDYRNLSVGLHLQVPLMCACPTANQTAAGFNYLLSYLVTWGDTIDSIAKIFGVDDVQSIYDANRLSSTSVIYPFTPILVPLKNPPSKIQTTVSSPPAPSPETPMVPSGGGSNS--SKKWVFIGAGIGAALLVLLISSGMMFCFFRRRRQSGQDKPV----------LDLGEATKLSKSLENKTSMSISLEGIRIEMESLTVYKYEELQKAAGYFGEANRIKGSVYRASFKGDDAAIKMMKGDVSEEINILKQINHSKVIRLSGFCIHAGNTYLVYEYAENGALRDWLHGDG-ETCSTLGWKQRVQIAYDAADALNYLHNFISPPCIHKNLKISNILLDGNMRGKVTNFGLARRLGNEEGDGGGLQLTRHVVGTQGYMAPEYVENGVVTPKLDIFAFGVVILELLTGKEAAPSQKKEGGELLSVSINEVLQGDNVRDKLRGFIDPCLAHEYPFDLAFSMAQLAKSCVAHDLNARPTMSDIFVILSKILSSSLDWDPSDDFQASGSLSHGR 690          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: A0A067KWV5_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_08006 PE=4 SV=1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 398/649 (61.33%), Postives = 487/649 (75.04%), Query Frame = -2
Query:  591 QAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDA--QATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXX-PVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXX-XXFRRQRQAHKARPIATASXXXXXPFNLKPFSDSTTYTPNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLTSAR 2525
            +AQQ YVNN QLAC +     N ++G+ CNG + SCQSY+TFRS  P+Y T VSIAYLL A   AT I+SLNN S+DV+SI P + V+VPVNCSC       YYQHNASYT+K   ETYFSI+NDTYQGL+TCQAM AQNP   RNL V   L VP+RCACPT  Q   G KYLLSY+VTWG+SISS AE+FG D+++VL+AN LS   IIFPFTP+LVPL+ EP+ IK   +  P A  PQIPT   VG S+S S+ KW+++GVG+G+  L++ G+ GFLF    R+ +   KA+P+ + S      +     SD +   P+S S S+SSQG++ AIESLT YKF DL+ AT  FS+ NRIKGSV++GSF GD AA+KVM GDVSSEIN+LKKINH+NIIRLSGFCVH GNTYLVYE  + G++SD L         TL+WKQRVQ+AYDVADALNYLH+Y +PPYI KNLK+SNILLD + RAK+ NFG+AR +E+  +GGL LTRHVVGT+GYMAPEY+ENGV+TPKLD+FA GV+IL LLSG++AA+      +E+LSASI VVL+G+NVR+K   F+DPSLG  YPLDLAFS+A LAK CVA+D++ARPSM  V V LSKILSSSLDWDPS E   S S+TS R
Sbjct:   24 EAQQTYVNNKQLACYNTAF--NFTKGYVCNGVKSSCQSYLTFRSASPYYTTPVSIAYLLGAPDSATLIASLNNFSSDVASIPPNTQVIVPVNCSCYA---GQYYQHNASYTIKSHSETYFSIANDTYQGLSTCQAMMAQNPYGDRNLSVDMHLEVPLRCACPTSKQTALGFKYLLSYMVTWGNSISSIAESFGVDQQAVLDANNLSSTSIIFPFTPILVPLTAEPTNIKLQATPSPAAPSPQIPTVPVVGGSNSSSNTKWIYVGVGLGVALLIVCGVFGFLFWYRNRKHKSGDKAKPVTSVSSSEPNDYKTVVQSDYSA-LPDSKSWSLSSQGIQSAIESLTVYKFHDLQMATAYFSQDNRIKGSVYKGSFNGDDAAVKVMKGDVSSEINILKKINHSNIIRLSGFCVHSGNTYLVYELVENGALSDCLS--------TLTWKQRVQVAYDVADALNYLHSYADPPYILKNLKASNILLDGSLRAKIANFGMARMLENEGQGGLHLTRHVVGTQGYMAPEYVENGVVTPKLDIFAFGVVILILLSGKEAAS-----DKEMLSASIDVVLEGENVRDKFNRFMDPSLGNHYPLDLAFSLAHLAKSCVAYDINARPSMPQVFVALSKILSSSLDWDPSLE-TSSRSMTSGR 652          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: B9H5Z0_POPTR (Kinase family protein OS=Populus trichocarpa GN=POPTR_0005s28080g PE=4 SV=2)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 391/657 (59.51%), Postives = 481/657 (73.21%), Query Frame = -2
Query:  591 GFTQAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDA--QATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPL-SEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXXXXFRRQRQAHKARPIATASXXX----XXPFNLKPFSDSTTYTPNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANA--EKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLTSAR 2534
               Q QQ YV N QL C +    N  ++GF CNG Q SCQSY+TFRS PP YN+ V IAYLL     AT+I+S+NNLS+D ++I   + VVVPVNCSC       YYQHN++Y +K   ETYFS++N+TYQGLTTCQ++ +QNP   RNL +G  L +P+RCACPT NQ  +G  +LL+Y+VTWGDSISS A+ FG D++ VL+AN+LS  +IIFPFTP+LVPL +E   + +P  + PP A  PQ P   VG S   S  K +++GVG+G   L+LL  A     + R+ R+  K  P++T+ P         F + P S++      SWS  +SS   R+AIESLT YK+EDL+ ATG F+++N IKGSV+RGSF+GD AA+KV+ GDVSSEIN+LK INH+N+IRLSGFC+HEGNTYLVYEYAD GS++D LHSN       L+WKQRV+IAYDVADALNYLHNY NP YIHKNLK+SNILLD N RAKV NFGLART+E+  +GGLQLTRHVVGT+GY+APEYIENGVITPKLDVFA GV++LELLSG++AA    +K  G++LLS  I  VL+GDNVREKL  F+DP L  EYPLDLAFSMAQLAK CV HDL+ RPSM  V + LSKILSSSLDWDPS E  RS S+ S R
Sbjct:   17 ALVQGQQTYVANHQLDCYN-NAFNETTKGFLCNGVQSSCQSYLTFRSMPP-YNSPVLIAYLLGVPQSATRIASINNLSSDTATIPTNTQVVVPVNCSCYAR---QYYQHNSTYQLKDKSETYFSVANNTYQGLTTCQSLMSQNPYGDRNLSLGLTLQIPLRCACPTSNQNASGINHLLTYMVTWGDSISSIAQLFGVDKQRVLDANKLSSSNIIFPFTPILVPLPTEPTKIEQPSAAPPPAAPSPQTPNVSVGGS---SDHKALYVGVGIGAAFLILLFAAFGFLFWHRKSRKQQK--PVSTSEPETLPSVSTDFTVLPVSNN-----KSWS--LSSHDARYAIESLTVYKYEDLQVATGYFAQANLIKGSVYRGSFKGDTAAVKVVKGDVSSEINILKMINHSNVIRLSGFCLHEGNTYLVYEYADNGSLTDWLHSNNIYR--ILAWKQRVRIAYDVADALNYLHNYTNPSYIHKNLKTSNILLDANLRAKVANFGLARTLENGQDGGLQLTRHVVGTQGYLAPEYIENGVITPKLDVFAFGVVMLELLSGKEAAATAIDKIAGDDLLSVMIMRVLEGDNVREKLSAFLDPCLRDEYPLDLAFSMAQLAKSCVEHDLNTRPSMPQVFMMLSKILSSSLDWDPSDELNRSRSIDSGR 654          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: A0A059BWM8_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_F03625 PE=4 SV=1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 380/654 (58.10%), Postives = 485/654 (74.16%), Query Frame = -2
Query:  591 GYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQA--TQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXX-----XXXFRRQRQAHKARPIATASXXXXXPFNLKPFSDSTTYTPNSWSVSISSQG-----VRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDND-EGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLTSAR 2513
             YV+N QL CE+P+ +NNI++GFSC G   SC++Y+TFR     YN+ V++AYLL++Q   ++++S+NNL+ D+    P ++V+ PV+C+C+ + + SYYQHNASY ++   +TYF ++NDTYQGL+TCQA+ A+NP    NL VG  L VP+RCACPT NQ  AGAKYLL+Y+VTWGDSIS+ A+ FG  EKSVL+ANEL+   +I+PFTP+LVPLS EP+ I+       P   P +P       +S SSKKWVF+GVGVG G L +  +A  L         R+Q ++    P              K FSD++     S +V   S       +R AI++LT Y F+DL+ ATG FS+ N+IKGSV+RG F+ D AA+KV+ GDVS EIN+L++INH NI+RLSGFCVHEGNTYLVYEYA+ GS+SD LHS KF++   LSWKQRVQ+AY +ADALNYLHNY NPPY+HKNLK+SN+LLD NFRA V NFGLAR +ED+D EGGLQ+TRHVVGT+GYMAPEYIENGVITPKLDVFA GV++LELLSG +AA   KN GEELLSA+I+ VL GD+VRE L+ FIDPSL  EYPLDLAFSMA+LAK CV++DL+ARP MA+V +TLSK LSSSLDWDPS EF+RS S++  +
Sbjct:   28 AYVDNKQLNCENPS-NNNITQGFSCTGPLTSCRAYVTFRPTA-VYNSLVTVAYLLNSQPYISEMTSINNLT-DLEHPPPDTLVIAPVDCACTSS-SPSYYQHNASYVLQSVSDTYFLLANDTYQGLSTCQALIAENPYSAVNLSVGMNLTVPVRCACPTANQSSAGAKYLLTYLVTWGDSISAIAKMFGVSEKSVLDANELTVTSVIYPFTPILVPLSTEPTKIETASPPASPPEAPSVP----AGGNSGSSKKWVFVGVGVGGGGLAVALVALALWFFCYNPQKRKQSKSSGLTP--------------KKFSDTSATDHASLAVKGGSFSGFSSGIREAIDTLTVYTFQDLQIATGFFSKGNKIKGSVYRGKFKNDDAAVKVLKGDVSGEINILRQINHANIVRLSGFCVHEGNTYLVYEYAENGSLSDWLHSKKFESYSVLSWKQRVQVAYHIADALNYLHNYTNPPYVHKNLKTSNVLLDANFRAMVANFGLARAVEDSDEEGGLQMTRHVVGTQGYMAPEYIENGVITPKLDVFAFGVVMLELLSGREAAGDTKN-GEELLSAAIKRVLDGDSVRENLRGFIDPSLKDEYPLDLAFSMAELAKRCVSNDLNARPQMAEVFMTLSKTLSSSLDWDPSDEFDRSQSMSHGQ 658          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: B9R8W3_RICCO (Kinase, putative OS=Ricinus communis GN=RCOM_1602540 PE=4 SV=1)

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 383/641 (59.75%), Postives = 481/641 (75.04%), Query Frame = -2
Query:  615 AQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQ--ATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXXXXFRRQRQAHKARPIATASXXXXXPFNLKPFSDSTTYTPNS---WSVSISSQGVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSNKFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNGGEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFER 2522
            +QQ YVNN QL C + +  N  ++GF CNG + SCQSY+TFRS PP+Y T V+I+YL   Q  A+ I+SLNN+S+DVSSI P+S + +PVNCSC G     +YQHNASYT+KF  ETYFS++NDTYQGL+TCQA+ +QNP   RNL VG +L VP+RCACPT NQ   G +YLL+Y+VTWGD+ISS AE FG   +S+L+AN+LS   IIFPFTP+LVPL+  P+ IK     P  +  P  P  P G     SS+KW ++GVG+G   LL+  ++GFLF + + + +     PI + +            SDS+   P+S   WS S  + GV   IESLT YKF DL+ AT  FSE NRIKGSV++GSF+GDAAA+KVM GDVSSEI++LKKINH+NIIRLSG C+++ NTYLVYE+A+ GS+++ +         TL+WKQRVQIA+DVADALNYLHNY NPPYIHKNLK+SNILLD N RAK+ NFGLART+++  EGGL LTRHVVGT+GYMAPEY+ENGVITPKLDVFA GV+ILELLSG++AA  +KN  EE+LSASI  VL+GDNVR KL  F+DPSLG +YPLDLAFS+AQLA+ C++HD++ARPS++ V ++LSKILSSSLDWDPS E  R
Sbjct:   24 SQQTYVNNKQLDCYNDSF-NYTTKGFECNGLRSSCQSYLTFRSAPPYYTTPVTISYLFSLQDSASLIASLNNISSDVSSIPPQSQLFIPVNCSCFG---GQFYQHNASYTLKFSSETYFSVANDTYQGLSTCQALMSQNPYGDRNLSVGMRLQVPLRCACPTSNQTALGFRYLLTYMVTWGDTISSIAELFGVRPQSILDANQLSSTSIIFPFTPILVPLTTPPTTIKASPPPPVVSPPPLTPVLPSG----GSSRKWTYVGVGLGAALLLIFAVSGFLFWYPKSKSRKLTTVPIPSKALQ----------SDSSAVPPDSSTPWSRS--AYGV---IESLTLYKFHDLQLATDYFSEKNRIKGSVYKGSFKGDAAAVKVMKGDVSSEISILKKINHSNIIRLSGVCLYDANTYLVYEFAENGSLAENVQ--------TLTWKQRVQIAHDVADALNYLHNYTNPPYIHKNLKTSNILLDANMRAKIANFGLARTLQNEAEGGLHLTRHVVGTQGYMAPEYMENGVITPKLDVFAFGVVILELLSGKEAATYDKNAREEMLSASICRVLEGDNVRHKLCGFMDPSLGKQYPLDLAFSLAQLAQTCISHDINARPSVSQVFISLSKILSSSLDWDPSLELPR 633          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: D3KU01_LOTJA (LysM type receptor kinase OS=Lotus japonicus GN=LYS14 PE=2 SV=1)

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 376/655 (57.40%), Postives = 477/655 (72.82%), Query Frame = -2
Query:  600 TQAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXXXXFRRQRQAHKARPIATASXXXXXPFNLKPFSDS-------TTYTPNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSN-KFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIEDNDE-GGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDA-ANAEKNG-GE-ELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLT 2528
            TQAQQ YVNN QL C+      N + G  CN    SCQSY+TF+S  P YNT  SI+YLL++  + ++  NN++ DV+ I   +MV VPV CSCSG      YQHNA+Y +K   ETYFSI+N+TYQ LTTCQA+ AQNP D +NL  G+ L VP+RCACPT  Q  AG KYLL+Y+V+ G+S  S AE FG D +SVL+ANEL    ++F FTP+LVPL  EP       +SPP +  P       G   S SSKKWV +GV VG+   L++ L  F  CF+ R+R+     P++           +K F DS       TT T  SWS  +SS+GVR+AIESLT YKF D++ AT  FSE N+IKGSV+R SF+GD AA+K++NGDVS+EINLLK+INH NIIRLSGFCVH+GNTYLVYE+A+  S+ D LHS+ K+Q S +LSW QRVQIAYDVADALNYLHNY NP +IHKNLKS N+LLD  FRAKV+NFGLAR +ED  E GG Q+TRHVVGT+GYM PEYIE+G+ITPK+DVFA GV++LELLSG +A ++ EKNG GE ++LS ++  VL+GDNVR+KL+ F+DP+L  EYPLDLA+SMA++AK CVAHDL++RP++++VL+TLSK+ S++LDWDPS E ERS S++
Sbjct:   33 TQAQQEYVNNKQLDCD---TQYNTTYGNVCNS-VTSCQSYLTFKSSSPEYNTPSSISYLLNSTPSLVAKSNNIT-DVTPIITDTMVTVPVTCSCSG----GRYQHNATYNLKKTGETYFSIANNTYQSLTTCQALMAQNPYDAKNLFAGDDLHVPLRCACPTKKQSDAGFKYLLTYLVSQGESPDSIAEIFGVDTQSVLDANELDSKSVVFYFTPLLVPLKTEPPARLQIAASPPESPPPAPA----GNDSSSSSKKWVIVGVTVGVAVCLVVALLVFFLCFYNRRRRQPAPPPVS-----------VKDFPDSAVKMVSETTPTTESWS--LSSEGVRYAIESLTAYKFGDIQTATKFFSEENKIKGSVYRASFKGDDAAVKILNGDVSAEINLLKRINHANIIRLSGFCVHKGNTYLVYEFAENDSLDDWLHSDKKYQNSVSLSWMQRVQIAYDVADALNYLHNYTNPIHIHKNLKSGNVLLDGKFRAKVSNFGLARVMEDQGEDGGFQMTRHVVGTQGYMPPEYIESGLITPKMDVFAFGVVMLELLSGREATSSGEKNGLGENKMLSETVNHVLEGDNVRDKLRGFMDPTLRDEYPLDLAYSMAEIAKRCVAHDLNSRPNISEVLMTLSKVQSTTLDWDPSDELERSRSVS 661          
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Match: V7BAY6_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_008G212500g PE=4 SV=1)

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 365/649 (56.24%), Postives = 479/649 (73.81%), Query Frame = -2
Query:  600 TQAQQGYVNNLQLACEDPTKDNNISRGFSCNGEQRSCQSYITFRSEPPFYNTAVSIAYLLDAQATQISSLNNLSADVSSITPKSMVVVPVNCSCSGTVNDSYYQHNASYTMKFDYETYFSISNDTYQGLTTCQAMKAQNPIDYRNLEVGNKLVVPIRCACPTHNQIRAGAKYLLSYIVTWGDSISSTAETFGADEKSVLEANELSEDDIIFPFTPVLVPLSEEXXXXXXXXXXXXXXXXXXXXXXPVGESDSKSSKKWXXXXXXXXXXXXXXXXXXXXXXXXFRRQR-QAHKARPIATASXXXXXPFNLKPFSDSTTYT-PNSWSVSISSQGVRHAIESLTRYKFEDLKAATGNFSESNRIKGSVFRGSFQGDAAAMKVMNGDVSSEINLLKKINHTNIIRLSGFCVHEGNTYLVYEYADKGSVSDLLHSN--KFQTSFTLSWKQRVQIAYDVADALNYLHNYINPPYIHKNLKSSNILLDVNFRAKVTNFGLARTIE-DNDEGGLQLTRHVVGTKGYMAPEYIENGVITPKLDVFALGVIILELLSGEDAANAEKNG-GEELLSASIRVVLQGDNVREKLKNFIDPSLGPEYPLDLAFSMAQLAKICVAHDLSARPSMADVLVTLSKILSSSLDWDPSSEFERSTSLT 2528
            +++QQ YVNN QL C +  ++   + G  CN    SC SY+TF+S  P Y T +SI+YLL++  T I++ NN++ DV SI   +++ VP+NCSCSG     YYQHNASYT+K   ETYFSI+N+TYQ LTTCQA+  QN     NL     L VP+RCACPT  Q  AG KYLL+Y+V+ G+++SS AE FG DE+S++EANELS +  IF FTP+ VPL  EP       ++PP  S    P +  G+SDS  SKKWV +G+ VG+  +LLL    F FCF+R++R Q     P A A       F+     +S   T P++ S S+SS+G+R+AIESL+ YKFE+L+ ATG FSE N+IKGSV+R SF+GD AA+K++ GDVS EIN+LKKINH N+IRLSGFCVH+G+TYLVYE+A+  S+ D LHS   K++TS  LSW QRV IA+DVADALNYLHNY +PP++HKNLKS N+LLD NFRAKV+NFGLART+E + D+GG QLTRHVVGT+GYM+PEYIENG+ITPK+DVFA GV++LELLSG +A   +KNG G+++LS ++  VL+G+NV+EKL+ F+DP+L  EYPL+LA+SMA+LAK CVA DL++RP +++V + LSKI SS+LDWDPS E ERS S++
Sbjct:   24 SESQQEYVNNKQLNCSE--QETKATYGNLCNSVP-SCTSYLTFKSSLPDYTTPISISYLLNSNTTAIAAANNIT-DVQSIPIDTLITVPINCSCSGL----YYQHNASYTIKTLGETYFSIANNTYQSLTTCQALMDQNNYSAVNLVANLNLHVPLRCACPTQKQSEAGFKYLLTYLVSQGETVSSIAEIFGVDEQSIIEANELSNNSFIFYFTPISVPLKTEPPTNFMGAAAPPEDSPSPPPPAADGDSDS--SKKWVIVGIVVGVVVVLLLCATLFFFCFYRQRRVQPPSPTPAAKA-------FSGPTHKESEEMTIPSTQSWSLSSEGIRYAIESLSVYKFEELQKATGFFSEENKIKGSVYRASFKGDYAAVKILKGDVSGEINILKKINHFNVIRLSGFCVHKGDTYLVYEFAENDSLEDCLHSGSKKYETSVCLSWVQRVHIAHDVADALNYLHNYTSPPHVHKNLKSGNVLLDGNFRAKVSNFGLARTVEGEGDDGGFQLTRHVVGTQGYMSPEYIENGLITPKMDVFAFGVVLLELLSGREAVGGDKNGSGDQMLSVTVNQVLEGENVKEKLRGFMDPNLRDEYPLELAYSMAELAKRCVARDLNSRPQISEVFMILSKIQSSTLDWDPSDELERSRSVS 655          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
LYK5_ARATH0.000e+054.45Protein LYK5 OS=Arabidopsis thaliana GN=LYK5 PE=2 ... [more]
LYK4_ARATH2.354e-6843.38LysM domain receptor-like kinase 4 OS=Arabidopsis ... [more]
LYK3_ARATH8.442e-5938.10LysM domain receptor-like kinase 3 OS=Arabidopsis ... [more]
CERK1_ARATH4.952e-5637.35Chitin elicitor receptor kinase 1 OS=Arabidopsis t... [more]
CERK1_ORYSJ5.051e-5036.36Chitin elicitor receptor kinase 1 OS=Oryza sativa ... [more]
Y2197_ARATH2.295e-4534.67Probable protein kinase At2g41970 OS=Arabidopsis t... [more]
Y5158_ARATH1.885e-4433.12Probable receptor-like protein kinase At5g15080 OS... [more]
ALE2_ARATH1.031e-4334.78Receptor-like serine/threonine-protein kinase ALE2... [more]
PBS1_ARATH1.587e-4333.76Serine/threonine-protein kinase PBS1 OS=Arabidopsi... [more]
APK2A_ARATH1.972e-4335.05Protein kinase 2A, chloroplastic OS=Arabidopsis th... [more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092691 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2TL25_GOSRA0.000e+098.36Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061F0X1_THECC0.000e+081.05LRR receptor-like serine/threonine-protein kinase,... [more]
A0A061F748_THECC0.000e+066.51LRR receptor-like serine/threonine-protein kinase,... [more]
F6I6Y0_VITVI0.000e+060.19Putative uncharacterized protein OS=Vitis vinifera... [more]
A0A067KWV5_JATCU0.000e+061.33Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
B9H5Z0_POPTR0.000e+059.51Kinase family protein OS=Populus trichocarpa GN=PO... [more]
A0A059BWM8_EUCGR0.000e+058.10Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]
B9R8W3_RICCO0.000e+059.75Kinase, putative OS=Ricinus communis GN=RCOM_16025... [more]
D3KU01_LOTJA0.000e+057.40LysM type receptor kinase OS=Lotus japonicus GN=LY... [more]
V7BAY6_PHAVU0.000e+056.24Uncharacterized protein OS=Phaseolus vulgaris GN=P... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D3.30.200.20coord: 376..426
e-value: 6.0E-12
score: 44.9
NoneNo IPR availableGENE3D1.10.510.10coord: 427..641
e-value: 2.0E-44
score: 150.7
NoneNo IPR availablePANTHERPTHR27001FAMILY NOT NAMEDcoord: 353..661
coord: 190..333
NoneNo IPR availablePANTHERPTHR27001:SF183PROTEIN LYK5coord: 353..661
coord: 190..333
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 308..670
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..11
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..27
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 28..281
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 23..27
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 282..307
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 12..22
NoneNo IPR availableSIGNALP_GRAM_POSITIVESignalP-TMSignalP-TMcoord: 1..27
score: 0.55
NoneNo IPR availableSIGNALP_GRAM_NEGATIVESignalP-noTMSignalP-noTMcoord: 1..27
score: 0.829
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..27
score: 0.909
NoneNo IPR availableTMHMMTMhelixcoord: 285..307
IPR018392LysM domainPFAMPF01476LysMcoord: 200..242
e-value: 0.029
score: 14.3
IPR013320Concanavalin A-like lectin/glucanase domainGENE3D2.60.120.200coord: 252..375
e-value: 4.0E-7
score: 29.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 402..641
e-value: 6.4E-40
score: 137.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 366..648
score: 32.358
IPR011009Protein kinase-like domainSUPERFAMILY56112Protein kinase-like (PK-like)coord: 347..641

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092691 ID=g.barbadense_cottongen_reftransV1_0092691|Name=g.barbadense_cottongen_reftransV1_0092691|organism=Gossypium barbadense|type=contig|length=2718bp
ATCAATGATGCAGGAGTGTGACTTCAACCTTGATGGAGAACTTGACCATG
AAGAATTTGTGGAATTCATTCAACGGCTCACGACCGACACATTAATTGTT
GTTAGTCAGGGACTGATTGTCACTTTGGTTGTTGCTCCAACTGTTGCCAT
GACGACAAAGAAGGCTACTGAGGGTGTTCCTGGTGTTGGGAAAGTGGTGC
AGAAGTTACCCAATTCGATTTATGCATCCCTTGTGACCCTTGCCATTGTT
TTGTTTCAGACTTCGCGTGAAGAGGTTTAGTTGAGCACTCTATTTTCTGT
CGAATTACCGTCTCCGTATATGAGATTATATCTCAGTTTGTATAGTATGT
CTTTCGAGTTGGCTTAACTATCCGAAGACCAACATTTCTGGAATTTGTGG
TAACGTATATAATGAAAATGTAAATGAAGTTGTGGGAAACTTAAGTTATT
CCATTGCAAAACAATATTTCTCATACAAATATACTTGTTTTGAAAACTCC
ATTTTAGTACTATTGCAGGAAAAATGTCACAATATTTCCTTATTCTTTTT
GGTACTTGGGCCCTTTCACCAATGTAATAGCATCTCACTACCTGGCACTG
GTTAGAGATGTGGAACGTTCAAACTCACTAGAAGGATCCCAATCCAATGA
AGATGATAGAATCTTAGACAAGGTGACCAAAACGTCAGCCATGGAAGGAC
GAGCACTGAGATCATGAGCAACACAGATTTTAGCCAGTTGAGCCATGGAA
AAAGCCAAATCCAGGGGATATTCAGGCCCAAGAGAAGGATCGATGAAGTT
CTTGAGCTTCTCTCTCACATTATCCCCTTGAAGCACCACTCTGATAGATG
CAGATAACAGCTCTTCTCCACCATTCTTTTCAGCATTTGCAGCATCTTCC
CCTGATAAAAGCTCCAATATAATAACCCCCAATGCGAAAACATCGAGCTT
AGGCGTGATCACACCATTTTCAATGTACTCAGGAGCCATATAACCTTTAG
TCCCAACCACATGTCTTGTCAACTGCAATCCACCTTCATCGTTGTCCTCA
ATAGTTCTTGCCAACCCGAAGTTGGTGACTTTGGCTCTAAAGTTAACATC
CAAGAGAATGTTACTGCTCTTCAAATTCTTATGAATATAAGGAGGATTTA
TATAGTTATGCAAATAGTTGAGTGCATCAGCTACATCGTATGCAATCTGA
ACTCTTTGCTTCCAAGAAAGAGTAAATGAAGTTTGGAACTTGTTGGAGTG
AAGCAAATCACTGACTGAGCCTTTATCTGCGTACTCATAGACAAGGTATG
TGTTTCCTTCATGTACACAAAAACCTGAAAGCCTTATAATGTTGGTGTGA
TTGATCTTCTTCAATAAATTGATCTCTGAAGAAACATCCCCGTTCATTAC
TTTCATAGCAGCAGCATCACCTTGGAAAGAACCTCGAAAAACTGACCCTT
TAATCCTGTTGGATTCACTGAAGTTCCCTGTAGCAGCTTTCAAGTCCTCG
AACTTGTAACGAGTTAAGGATTCGATTGCATGACGAACCCCTTGGGAAGA
TATTGAAACAGACCAGGAGTTTGGAGTGTAAGTTGTTGAATCCGAGAAAG
GTTTCAGATTGAATGGTGGCATTGGTGGTGGTGAAGCAGTAGCTATTGGC
CTGGCCTTGTGAGCTTGGCGTTGACGTCTGAAGAAACAGAACAAGAACCC
TGCTAGGCCAAGAAGGAGAAGGGAACCGATTCCAACACCAACACCAATGA
AAACCCATTTCTTAGAAGACTTGGAATCTGATTCTCCAACTGGGGAAGTT
GGTATTTGAGGGACTGAGGCTGGAGGTGGGGAGCTTTGAGGCGGTTTAAT
CATGGAAGGCTCTTCAGAAAGTGGAACCAAAACAGGTGTAAATGGGAATA
TGATATCATCCTCAGATAACTCATTGGCCTCCAATACACTCTTCTCATCA
GCACCAAAAGTCTCAGCAGTAGAAGAAATGGAATCACCCCAAGTAACAAT
ATAAGAAAGCAAGTATTTAGCACCAGCTCGAATTTGATTATGAGTAGGAC
AAGCACATCTAATAGGAACTACAAGTTTATTACCCACTTCTAGATTCCTA
TAATCAATGGGGTTTTGAGCTTTCATTGCCTGACAAGTTGTAAGACCCTG
ATAAGTATCATTAGAAATGGAAAAATAAGTCTCGTAATCAAACTTCATAG
TGTAAGAAGCATTATGCTGGTAATAGCTGTCATTGACGGTGCCGGAACAG
GAACAGTTGACTGGAACAACCACCATTGACTTGGGGGTAATTGAAGAAAC
ATCAGCTGAAAGGTTGTTTAGAGATGAAATCTGGGTTGCTTGAGCGTCTA
ACAAGTATGCTATGGAGACAGCAGTGTTGTAAAAAGGTGGCTCCGACCGG
AAAGTGATGTAAGACTGACATGATCTTTGCTCACCGTTACATGAAAACCC
TCTGCTTATGTTGTTGTCTTTGGTTGGATCTTCACAGGCAAGCTGCAGAT
TATTTACATACCCTTGTTGCGCTTGAGTGAACCCAAGGAAGAACAGCAAC
AAGAAAGGAAGACAAAATTTTAGACAAGGTTTCAATCTTCCAACTGCCAT
AGGAAGATCAATTTTTTTTAAATGAAAAAGAAAAATCGTTTTGTTTAGAA
ATGGGGATAAGGAAAGGAGTGTTTTTTTAATTGGGAAGAGTTGAGAACGG
GAGACCCCTAATGTATAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR018392LysM_dom
IPR013320ConA-like_dom_sf
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation