g.barbadense_cottongen_reftransV1_0092647, g.barbadense_cottongen_reftransV1_0092647 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092647
Unique Nameg.barbadense_cottongen_reftransV1_0092647
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length3428
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: ASHR1_ARATH (Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana GN=ASHR1 PE=2 SV=2)

HSP 1 Score: 294.278 bits (752), Expect = 1.610e-86
Identity = 134/185 (72.43%), Postives = 159/185 (85.95%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 710
            M +LQ  LQ R L +S  P KGRSL  ARDF PGEVI+SQ+PY+CVPNN+ +ESRCDGCF  +NLKKCSAC VVWYCGSSCQK EWKLHR EC+ L +L+KE+RK VTPTIR+MV+LY++R LQNE V+P+T  DNY+LVEALVSHMS+IDEKQ+LLYAQMANLVNLILQ P++D++EIAENFSK
Sbjct:    1 MADLQRFLQDRCLGVSNLPQKGRSLFTARDFRPGEVILSQKPYICVPNNTSSESRCDGCFKTNNLKKCSACQVVWYCGSSCQKSEWKLHRDECKALTRLEKEKRKFVTPTIRLMVRLYIKRNLQNEKVLPITTTDNYSLVEALVSHMSEIDEKQMLLYAQMANLVNLILQFPSVDLREIAENFSK 185          

HSP 2 Score: 233.802 bits (595), Expect = 3.502e-65
Identity = 104/156 (66.67%), Postives = 135/156 (86.54%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKA 1643
            +F+CNAH+ICDSELR  G GL+P++SIINHSC PNAVLVFE ++AVVRA+ +I KDSE++ISY+ETA ST+TRQK+LKEQYLF C C RC+  G+  DI+ESAILEGYRC +  C+GFLLR+ +EKGFVCQ+C L+R+KEE++K+ASD+K +S+KA
Sbjct:  185 KFSCNAHSICDSELRPQGIGLFPLVSIINHSCSPNAVLVFEEQMAVVRAMDNISKDSEITISYIETAGSTLTRQKSLKEQYLFHCQCARCSNFGKPHDIEESAILEGYRCANEKCTGFLLRDPEEKGFVCQKCLLLRSKEEVKKLASDLKTVSEKA 340          

HSP 3 Score: 73.9442 bits (180), Expect = 3.373e-12
Identity = 28/41 (68.29%), Postives = 34/41 (82.93%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 2391
            E W+EAL  CRL +PVY+RVYP  HPL+GLQ+Y+ GKLEWL
Sbjct:  389 EIWREALNYCRLIVPVYQRVYPATHPLIGLQFYTQGKLEWL 429          

HSP 4 Score: 72.4034 bits (176), Expect = 1.221e-11
Identity = 34/47 (72.34%), Postives = 38/47 (80.85%), Query Frame = 1
Query: 2920 LLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFK 3060
            LLGET +A+ S  KA DILRI+HG STPFMKEL  KLEEAR EAS+K
Sbjct:  429 LLGETKEAVSSLIKAFDILRISHGISTPFMKELSAKLEEARAEASYK 475          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: SMYD3_MOUSE (Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus GN=Smyd3 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 5.209e-18
Identity = 39/96 (40.62%), Postives = 64/96 (66.67%), Query Frame = 3
Query: 1185 CNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDI 1472
            CN+ TIC++E++ +G GLYP +S++NHSC PN  +VF G   ++RAV+ I    E++I Y++   ++  R+K L++QY F C C+RC    +  D+
Sbjct:  180 CNSFTICNAEMQEVGVGLYPSMSLLNHSCDPNCSIVFNGPHLLLRAVREIEAGEELTICYLDMLMTSEERRKQLRDQYCFECDCIRCQTQDKDADM 275          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: SMYD3_HUMAN (Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens GN=SMYD3 PE=1 SV=4)

HSP 1 Score: 90.5077 bits (223), Expect = 1.378e-17
Identity = 40/96 (41.67%), Postives = 63/96 (65.62%), Query Frame = 3
Query: 1185 CNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDI 1472
            CN+ TIC++E++ +G GLYP IS++NHSC PN  +VF G   ++RAV+ I    E++I Y++   ++  R+K L++QY F C C RC    +  D+
Sbjct:  180 CNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADM 275          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: SMY2B_XENLA (N-lysine methyltransferase SMYD2-B OS=Xenopus laevis GN=smyd2-b PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.607e-16
Identity = 60/197 (30.46%), Postives = 95/197 (48.22%), Query Frame = 3
Query:  180 QPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFS-KSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDID-EKQLLLYAQMANLVNLILQ-LPNIDIKEIAENFSKVHIERF*ASNSLVYHLS 761
            QP GL     P KGR L A R F  GE++ S   Y  V  ++   + CD CF+ K  L KC  C   +YC   CQK +W +H+LEC  +    +    S   T+R+  ++  ++K Q E     TA + +  V+   SH+S +D EK+ L+   ++ L     + + N D   +   F++V+   F   +  + HL 
Sbjct:    3 QPEGLERFDSPGKGRGLKATRSFALGELLFSCPAYTYVLTDNERGNHCDFCFTRKEGLSKCGKCKQAFYCNVDCQKGDWPMHKLECSSMCSSGQNWCPS--ETVRLTARILAKQKTQTER----TASERFMSVKEFESHLSKLDNEKKELIENDISALHRFYSKNVHNCDNAALEFLFAQVNCNGFTIEDEELSHLG 193          

HSP 2 Score: 86.2705 bits (212), Expect = 3.190e-16
Identity = 43/119 (36.13%), Postives = 63/119 (52.94%), Query Frame = 3
Query: 1092 FYCNKVRNLNKFCLSWMNICSYLLL*KWQFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCN 1448
            FY   V N +   L ++           Q  CN  TI D EL  LG+ ++P ++++NHSC PN ++ ++G +A VRAVQ I    EV  SY++    T  R   LK+ Y F+C C  C+
Sbjct:  157 FYSKNVHNCDNAALEFLFA---------QVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTVAEVRAVQEIHAGEEVFTSYIDLLYPTEDRNDRLKDSYFFSCDCRECS 266          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: SMYD2_CHICK (N-lysine methyltransferase SMYD2 OS=Gallus gallus GN=SMYD2 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.148e-16
Identity = 38/91 (41.76%), Postives = 54/91 (59.34%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCN 1448
            Q  CN  TI D EL  LG+ ++P ++++NHSC PN ++ ++G LA VRAV+ I    EV  SY++    T  R   L++ Y FTC C  C 
Sbjct:  181 QVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVKEIEPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCDCRECT 271          

HSP 2 Score: 85.5001 bits (210), Expect = 6.631e-16
Identity = 54/165 (32.73%), Postives = 80/165 (48.48%), Query Frame = 3
Query:  168 QASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFS-KSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDID-EKQLLLYAQMANLVNL 656
            +A  QP GL     P KGR L A R +  GE++ S   Y  V   S   S CDGCF+ K  L KC  C   +YC   CQK +W +H+LEC  +    +    S   T+R+  ++  ++K+  E     T  +    V+   SH+  +D EK+ L+   +A L + 
Sbjct:    4 EAVPQPGGLERFASPGKGRGLRALRRYAVGELLFSCPAYTAVLTVSERGSHCDGCFARKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECAAMCAFGQNWNPS--ETVRLTARILAKQKIHPER----TQSEKLLAVKEFESHLDKLDNEKRELIQNDIAALHHF 162          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: SMYD2_HUMAN (N-lysine methyltransferase SMYD2 OS=Homo sapiens GN=SMYD2 PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 4.323e-16
Identity = 39/90 (43.33%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRC 1445
            Q  CN  TI D EL  LG+ ++P ++++NHSC PN ++ ++G LA VRAVQ I    EV  SY++    T  R   L++ Y FTC C  C
Sbjct:  178 QVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQEC 267          

HSP 2 Score: 68.1662 bits (165), Expect = 2.052e-10
Identity = 49/169 (28.99%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  189 GLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFS-KSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDID-EKQLLLYAQMANLVNLI---LQLPNID 680
            GL     P KGR L A + F  G+++ S   Y  V   +   + C+ CF+ K  L KC  C   +YC   CQK +W +H+LEC  +    +    S   T+R+  ++  ++K+  E     T  +    V+   SH+  +D EK+ L+ + +A L +     L  P+ D
Sbjct:    8 GLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHPER----TPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDND 170          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: SMY2A_XENLA (N-lysine methyltransferase SMYD2-A OS=Xenopus laevis GN=smyd2-a PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 5.141e-16
Identity = 59/197 (29.95%), Postives = 94/197 (47.72%), Query Frame = 3
Query:  180 QPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFS-KSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDID-EKQLLLYAQMANLVNLILQ-LPNIDIKEIAENFSKVHIERF*ASNSLVYHLS 761
            QP GL     P KGR L A R F  GE++ +   Y  V  ++   + CD CF+ K  L KC  C   +YC   CQK +W +H+LEC  +    +    S   T+R+  ++  ++K Q E     T  + +  V+   SH+S +D EK+ L+ + +A L     + L   D   +   F++V+   F   +  + HL 
Sbjct:    3 QPEGLERFDSPGKGRGLKATRSFALGELLFTCPAYTYVLTDTERGNHCDFCFARKEGLSKCGKCKQAFYCNVDCQKGDWPMHKLECSAMCSYGQNWCPS--ETVRLTARILAKQKTQTER----TPSETFLSVKEFESHLSKLDNEKKELIESDIAALHRFYSKNLHYTDNAALVFLFAQVNCNGFTIEDEELSHLG 193          

HSP 2 Score: 85.5001 bits (210), Expect = 5.991e-16
Identity = 38/91 (41.76%), Postives = 54/91 (59.34%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCN 1448
            Q  CN  TI D EL  LG+ ++P ++++NHSC PN ++ F+G +A +RAVQ I    EV  SY++    T  R   L + Y FTC C  C+
Sbjct:  176 QVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNIIVTFKGTVAEIRAVQEIHAGDEVFTSYIDLLYPTEDRNDRLMDSYFFTCDCRECS 266          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: SMYD2_BOVIN (N-lysine methyltransferase SMYD2 OS=Bos taurus GN=SMYD2 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 5.661e-16
Identity = 39/90 (43.33%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRC 1445
            Q  CN  TI D EL  LG+ ++P ++++NHSC PN ++ ++G LA VRAVQ I    EV  SY++    T  R   L++ Y FTC C  C
Sbjct:  178 QVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQEC 267          

HSP 2 Score: 69.707 bits (169), Expect = 6.261e-11
Identity = 49/169 (28.99%), Postives = 81/169 (47.93%), Query Frame = 3
Query:  189 GLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFS-KSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDID-EKQLLLYAQMANLVNLI---LQLPNID 680
            GL     P KGR L A + F  G+++ S   Y  V   S   + C+ CF+ K  L KC  C   +YC   CQ+ +W +H+LEC  +    +    S   T+R+  ++  ++K+  E     T  +    V+   SH+  +D EK+ L+ + +A L +     L+ P+ D
Sbjct:    8 GLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVSERGNHCEFCFARKEGLSKCGRCKQAFYCNVECQREDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHPER----TPSEKLLAVKEFESHLDKLDNEKRDLIQSDIAALHHFYSKHLEFPDND 170          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: SMYD2_RAT (N-lysine methyltransferase SMYD2 OS=Rattus norvegicus GN=Smyd2 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.478e-16
Identity = 39/91 (42.86%), Postives = 54/91 (59.34%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCN 1448
            Q  CN  TI D EL  LG+ ++P ++++NHSC PN ++ ++G LA VRAVQ I    EV  SY++    T  R   L++ Y FTC C  C 
Sbjct:  178 QVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECT 268          

HSP 2 Score: 71.633 bits (174), Expect = 1.826e-11
Identity = 48/158 (30.38%), Postives = 75/158 (47.47%), Query Frame = 3
Query:  216 KGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFS-KSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDID-EKQLLLYAQMANLVNLI---LQLPN 674
            KGR L A R F+ G+++ S   Y CV         C+ CF+ K  L KC  C   +YC   CQK +W LH+LEC  +    +    S   T+R+  ++  ++K+  E     T  +    V    SH+  +D EK+ L+ + +A L       L+ P+
Sbjct:   17 KGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVFGENWNPS--ETVRLTARILAKQKMHPER----TPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKHLEFPD 168          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Match: SMYD2_MOUSE (N-lysine methyltransferase SMYD2 OS=Mus musculus GN=Smyd2 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.655e-16
Identity = 39/91 (42.86%), Postives = 54/91 (59.34%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCN 1448
            Q  CN  TI D EL  LG+ ++P ++++NHSC PN ++ ++G LA VRAVQ I    EV  SY++    T  R   L++ Y FTC C  C 
Sbjct:  178 QVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECT 268          

HSP 2 Score: 72.4034 bits (176), Expect = 9.472e-12
Identity = 49/158 (31.01%), Postives = 76/158 (48.10%), Query Frame = 3
Query:  216 KGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFS-KSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDID-EKQLLLYAQMANLVNL---ILQLPN 674
            KGR L A R F+ G+++ S   Y CV         C+ CF+ K  L KC  C   +YC   CQK +W LH+LEC  +  L +    S   T+R+  ++  ++K+  E     T  +    V    SH+  +D EK+ L+ + +A L       L+ P+
Sbjct:   17 KGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPS--ETVRLTARILAKQKIHPER----TPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPD 168          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A0D2RI11_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G091200 PE=4 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 4.095e-117
Identity = 182/185 (98.38%), Postives = 184/185 (99.46%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 710
            MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQ+PYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHR ECQLLAKLDKERRKSVTPTIRM+VKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK
Sbjct:    1 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQDPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRFECQLLAKLDKERRKSVTPTIRMIVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 185          

HSP 2 Score: 327.405 bits (838), Expect = 2.903e-97
Identity = 156/159 (98.11%), Postives = 157/159 (98.74%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 1652
            +FACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTC CVRCNKLGQY DIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC
Sbjct:  185 KFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCTCVRCNKLGQYDDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 343          

HSP 3 Score: 69.3218 bits (168), Expect = 7.680e-9
Identity = 33/40 (82.50%), Postives = 37/40 (92.50%), Query Frame = 2
Query: 1826 TSDLQEAIVLYKNIEKLQKEVYHPFSIILLRTWEKLLEVL 1945
            + +LQEAIVLYKNIEKLQKEV HPFSIIL+RT EKLLE+L
Sbjct:  346 SGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLLEIL 385          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A0D2RBL7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G091200 PE=4 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 4.764e-116
Identity = 182/185 (98.38%), Postives = 184/185 (99.46%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 710
            MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQ+PYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHR ECQLLAKLDKERRKSVTPTIRM+VKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK
Sbjct:    1 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQDPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRFECQLLAKLDKERRKSVTPTIRMIVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 185          

HSP 2 Score: 327.02 bits (837), Expect = 2.863e-96
Identity = 156/159 (98.11%), Postives = 157/159 (98.74%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 1652
            +FACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTC CVRCNKLGQY DIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC
Sbjct:  185 KFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCTCVRCNKLGQYDDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 343          

HSP 3 Score: 111.694 bits (278), Expect = 2.498e-22
Identity = 60/85 (70.59%), Postives = 65/85 (76.47%), Query Frame = 1
Query: 2836 PLKESLYKWFDSFTQFWIKKTSIFINDRLLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFKLSSREDS*IT 3090
            P+ E +Y  F       ++  S    + LLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEAR EASFKLSSREDS IT
Sbjct:  403 PVYERVYPGFHPL--LGLQYYSCGKLEWLLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARAEASFKLSSREDSYIT 485          

HSP 4 Score: 102.834 bits (255), Expect = 1.694e-19
Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 2391
            EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL
Sbjct:  389 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 429          

HSP 5 Score: 68.9366 bits (167), Expect = 1.198e-8
Identity = 33/40 (82.50%), Postives = 37/40 (92.50%), Query Frame = 2
Query: 1826 TSDLQEAIVLYKNIEKLQKEVYHPFSIILLRTWEKLLEVL 1945
            + +LQEAIVLYKNIEKLQKEV HPFSIIL+RT EKLLE+L
Sbjct:  346 SGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLLEIL 385          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A0D2PQ85_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G091200 PE=4 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 1.500e-112
Identity = 180/185 (97.30%), Postives = 182/185 (98.38%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 710
            MEELQASLQPRGLTLSTFPDKGRSLLAARDFYP  VIISQ+PYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHR ECQLLAKLDKERRKSVTPTIRM+VKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK
Sbjct:    1 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYP--VIISQDPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRFECQLLAKLDKERRKSVTPTIRMIVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 183          

HSP 2 Score: 327.405 bits (838), Expect = 2.186e-96
Identity = 156/159 (98.11%), Postives = 157/159 (98.74%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 1652
            +FACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTC CVRCNKLGQY DIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC
Sbjct:  183 KFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCTCVRCNKLGQYDDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 341          

HSP 3 Score: 111.694 bits (278), Expect = 2.658e-22
Identity = 60/85 (70.59%), Postives = 65/85 (76.47%), Query Frame = 1
Query: 2836 PLKESLYKWFDSFTQFWIKKTSIFINDRLLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFKLSSREDS*IT 3090
            P+ E +Y  F       ++  S    + LLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEAR EASFKLSSREDS IT
Sbjct:  401 PVYERVYPGFHPL--LGLQYYSCGKLEWLLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARAEASFKLSSREDSYIT 483          

HSP 4 Score: 102.834 bits (255), Expect = 1.661e-19
Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 2391
            EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL
Sbjct:  387 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 427          

HSP 5 Score: 68.9366 bits (167), Expect = 1.151e-8
Identity = 33/40 (82.50%), Postives = 37/40 (92.50%), Query Frame = 2
Query: 1826 TSDLQEAIVLYKNIEKLQKEVYHPFSIILLRTWEKLLEVL 1945
            + +LQEAIVLYKNIEKLQKEV HPFSIIL+RT EKLLE+L
Sbjct:  344 SGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLLEIL 383          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A0D2N9S9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G091200 PE=4 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.249e-111
Identity = 181/195 (92.82%), Postives = 183/195 (93.85%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVS----------HMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 710
            MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQ+PYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHR ECQLLAKLDKERRKSVTPTIRM+VKLYLRRKLQNENVIPVTAMDNYNLVEALVS           MSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK
Sbjct:    1 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQDPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRFECQLLAKLDKERRKSVTPTIRMIVKLYLRRKLQNENVIPVTAMDNYNLVEALVSPILFSLKLEKDMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 195          

HSP 2 Score: 327.405 bits (838), Expect = 2.968e-96
Identity = 156/159 (98.11%), Postives = 157/159 (98.74%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 1652
            +FACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTC CVRCNKLGQY DIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC
Sbjct:  195 KFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCTCVRCNKLGQYDDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 353          

HSP 3 Score: 111.694 bits (278), Expect = 2.983e-22
Identity = 60/85 (70.59%), Postives = 65/85 (76.47%), Query Frame = 1
Query: 2836 PLKESLYKWFDSFTQFWIKKTSIFINDRLLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFKLSSREDS*IT 3090
            P+ E +Y  F       ++  S    + LLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEAR EASFKLSSREDS IT
Sbjct:  413 PVYERVYPGFHPL--LGLQYYSCGKLEWLLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARAEASFKLSSREDSYIT 495          

HSP 4 Score: 103.219 bits (256), Expect = 1.746e-19
Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 2391
            EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL
Sbjct:  399 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 439          

HSP 5 Score: 68.9366 bits (167), Expect = 1.306e-8
Identity = 33/40 (82.50%), Postives = 37/40 (92.50%), Query Frame = 2
Query: 1826 TSDLQEAIVLYKNIEKLQKEVYHPFSIILLRTWEKLLEVL 1945
            + +LQEAIVLYKNIEKLQKEV HPFSIIL+RT EKLLE+L
Sbjct:  356 SGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLLEIL 395          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A0B0MR97_GOSAR (Histone-lysine N-methyltransferase ASHR1-like protein OS=Gossypium arboreum GN=F383_24011 PE=4 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 7.448e-110
Identity = 179/185 (96.76%), Postives = 179/185 (96.76%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 710
            MEELQASLQPRGLTLSTF DKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQN NVIPVTAMDNYNLVEAL   MSDIDEKQLLLYAQMANLVNLILQLPN DIKEIAENFSK
Sbjct:    1 MEELQASLQPRGLTLSTFHDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNGNVIPVTAMDNYNLVEAL-KDMSDIDEKQLLLYAQMANLVNLILQLPNNDIKEIAENFSK 184          

HSP 2 Score: 318.546 bits (815), Expect = 2.836e-93
Identity = 151/156 (96.79%), Postives = 153/156 (98.08%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKA 1643
            +FACNAHTICDSELR LGTGLYPVISIINHSCLPNAVL+FEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTC CVRCNKLGQY DIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKA
Sbjct:  184 KFACNAHTICDSELRPLGTGLYPVISIINHSCLPNAVLIFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCTCVRCNKLGQYDDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKA 339          

HSP 3 Score: 104.375 bits (259), Expect = 5.673e-20
Identity = 56/82 (68.29%), Postives = 61/82 (74.39%), Query Frame = 1
Query: 2836 PLKESLYKWFDSFTQFWIKKTSIFINDRLLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFKLSSREDS 3081
            P+ E +Y  F       ++  S    + LLGETDDAIK FTKAVDILRITHGTSTPFMKELLMKLEEAR EA FKLSSREDS
Sbjct:  399 PVYERVYPGFHPL--LGLQYYSCGKLEWLLGETDDAIKLFTKAVDILRITHGTSTPFMKELLMKLEEARAEALFKLSSREDS 478          

HSP 4 Score: 100.908 bits (250), Expect = 8.685e-19
Identity = 40/41 (97.56%), Postives = 40/41 (97.56%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 2391
            EEWKEAL ICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL
Sbjct:  385 EEWKEALTICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 425          

HSP 5 Score: 72.4034 bits (176), Expect = 9.355e-10
Identity = 35/40 (87.50%), Postives = 38/40 (95.00%), Query Frame = 2
Query: 1826 TSDLQEAIVLYKNIEKLQKEVYHPFSIILLRTWEKLLEVL 1945
            + +LQEAIVLYKNIEKLQKEVYHPFSIILLRT EKLLE+L
Sbjct:  342 SGNLQEAIVLYKNIEKLQKEVYHPFSIILLRTREKLLEIL 381          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A061FFX1_THECC (SET domain protein isoform 3 OS=Theobroma cacao GN=TCM_035036 PE=4 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 6.689e-100
Identity = 161/186 (86.56%), Postives = 172/186 (92.47%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSKV 713
            ME+LQASLQ RGL++S  PDKGRSL+  +DFYPGEVIISQEPYV VPNNSLTES CDGCFSKSNLKKCSAC VVWYCGS+CQKLEWKLHRLECQ LAKLDKERRKSVTPTIRMMVKLYLRRKLQ+E VIPVTA+DNYNLVE LVSHM DIDEKQL+LYAQMANLVNLIL  P+IDIKEIAENFSK+
Sbjct:    1 MEQLQASLQARGLSVSNLPDKGRSLVTTKDFYPGEVIISQEPYVFVPNNSLTESSCDGCFSKSNLKKCSACQVVWYCGSTCQKLEWKLHRLECQALAKLDKERRKSVTPTIRMMVKLYLRRKLQSERVIPVTAIDNYNLVEQLVSHMLDIDEKQLVLYAQMANLVNLILGCPDIDIKEIAENFSKI 186          

HSP 2 Score: 280.796 bits (717), Expect = 1.060e-79
Identity = 134/158 (84.81%), Postives = 143/158 (90.51%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALK 1649
            + ACNAHTICDSELR LGTGLYPVISIINHSCLPN+VLVFEGRLAVVRAVQHIPKD+E+ ISY+ETA STITRQKTLKEQYLFTC C  C K+GQ+ DIQESAILEGYRCRDN CSGFLLRESD+KGFVCQQCGL RNKEEIRK + DIKAL DKA K
Sbjct:  185 KIACNAHTICDSELRPLGTGLYPVISIINHSCLPNSVLVFEGRLAVVRAVQHIPKDAEILISYIETATSTITRQKTLKEQYLFTCTCPCCIKVGQHDDIQESAILEGYRCRDNRCSGFLLRESDDKGFVCQQCGLTRNKEEIRKKSRDIKALLDKAPK 342          

HSP 3 Score: 93.5893 bits (231), Expect = 2.156e-16
Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 1
Query: 2920 LLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFKLSSRE 3075
            LLGETDDAIKS TKAVDILRITHGT+TPFMKELLMKLEEAR EAS+ LS +E
Sbjct:  430 LLGETDDAIKSLTKAVDILRITHGTNTPFMKELLMKLEEARAEASYTLSCKE 481          

HSP 4 Score: 88.9669 bits (219), Expect = 5.832e-15
Identity = 39/41 (95.12%), Postives = 39/41 (95.12%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 2391
            EEWKEAL  CRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL
Sbjct:  389 EEWKEALTFCRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 429          

HSP 5 Score: 63.5438 bits (153), Expect = 5.750e-7
Identity = 29/42 (69.05%), Postives = 36/42 (85.71%), Query Frame = 2
Query: 1820 T*TSDLQEAIVLYKNIEKLQKEVYHPFSIILLRTWEKLLEVL 1945
            T + + Q+A++LYKNIEKLQKEV HPFSI L+RTWEKL E+L
Sbjct:  344 TSSGNPQDAMILYKNIEKLQKEVCHPFSISLMRTWEKLHEIL 385          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A061FH39_THECC (SET domain protein isoform 1 OS=Theobroma cacao GN=TCM_035036 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 6.702e-100
Identity = 161/186 (86.56%), Postives = 172/186 (92.47%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSKV 713
            ME+LQASLQ RGL++S  PDKGRSL+  +DFYPGEVIISQEPYV VPNNSLTES CDGCFSKSNLKKCSAC VVWYCGS+CQKLEWKLHRLECQ LAKLDKERRKSVTPTIRMMVKLYLRRKLQ+E VIPVTA+DNYNLVE LVSHM DIDEKQL+LYAQMANLVNLIL  P+IDIKEIAENFSK+
Sbjct:    1 MEQLQASLQARGLSVSNLPDKGRSLVTTKDFYPGEVIISQEPYVFVPNNSLTESSCDGCFSKSNLKKCSACQVVWYCGSTCQKLEWKLHRLECQALAKLDKERRKSVTPTIRMMVKLYLRRKLQSERVIPVTAIDNYNLVEQLVSHMLDIDEKQLVLYAQMANLVNLILGCPDIDIKEIAENFSKI 186          

HSP 2 Score: 280.796 bits (717), Expect = 9.296e-80
Identity = 134/158 (84.81%), Postives = 143/158 (90.51%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALK 1649
            + ACNAHTICDSELR LGTGLYPVISIINHSCLPN+VLVFEGRLAVVRAVQHIPKD+E+ ISY+ETA STITRQKTLKEQYLFTC C  C K+GQ+ DIQESAILEGYRCRDN CSGFLLRESD+KGFVCQQCGL RNKEEIRK + DIKAL DKA K
Sbjct:  185 KIACNAHTICDSELRPLGTGLYPVISIINHSCLPNSVLVFEGRLAVVRAVQHIPKDAEILISYIETATSTITRQKTLKEQYLFTCTCPCCIKVGQHDDIQESAILEGYRCRDNRCSGFLLRESDDKGFVCQQCGLTRNKEEIRKKSRDIKALLDKAPK 342          

HSP 3 Score: 93.2041 bits (230), Expect = 2.202e-16
Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 1
Query: 2920 LLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFKLSSRE 3075
            LLGETDDAIKS TKAVDILRITHGT+TPFMKELLMKLEEAR EAS+ LS +E
Sbjct:  428 LLGETDDAIKSLTKAVDILRITHGTNTPFMKELLMKLEEARAEASYTLSCKE 479          

HSP 4 Score: 88.9669 bits (219), Expect = 5.614e-15
Identity = 39/41 (95.12%), Postives = 39/41 (95.12%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 2391
            EEWKEAL  CRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL
Sbjct:  388 EEWKEALTFCRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 428          

HSP 5 Score: 67.0106 bits (162), Expect = 5.322e-8
Identity = 30/40 (75.00%), Postives = 36/40 (90.00%), Query Frame = 2
Query: 1826 TSDLQEAIVLYKNIEKLQKEVYHPFSIILLRTWEKLLEVL 1945
            +SD Q+A++LYKNIEKLQKEV HPFSI L+RTWEKL E+L
Sbjct:  345 SSDPQDAMILYKNIEKLQKEVCHPFSISLMRTWEKLHEIL 384          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A061FNX5_THECC (SET domain protein isoform 2 OS=Theobroma cacao GN=TCM_035036 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 7.412e-100
Identity = 161/186 (86.56%), Postives = 172/186 (92.47%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSKV 713
            ME+LQASLQ RGL++S  PDKGRSL+  +DFYPGEVIISQEPYV VPNNSLTES CDGCFSKSNLKKCSAC VVWYCGS+CQKLEWKLHRLECQ LAKLDKERRKSVTPTIRMMVKLYLRRKLQ+E VIPVTA+DNYNLVE LVSHM DIDEKQL+LYAQMANLVNLIL  P+IDIKEIAENFSK+
Sbjct:    1 MEQLQASLQARGLSVSNLPDKGRSLVTTKDFYPGEVIISQEPYVFVPNNSLTESSCDGCFSKSNLKKCSACQVVWYCGSTCQKLEWKLHRLECQALAKLDKERRKSVTPTIRMMVKLYLRRKLQSERVIPVTAIDNYNLVEQLVSHMLDIDEKQLVLYAQMANLVNLILGCPDIDIKEIAENFSKI 186          

HSP 2 Score: 280.411 bits (716), Expect = 1.126e-79
Identity = 134/158 (84.81%), Postives = 143/158 (90.51%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALK 1649
            + ACNAHTICDSELR LGTGLYPVISIINHSCLPN+VLVFEGRLAVVRAVQHIPKD+E+ ISY+ETA STITRQKTLKEQYLFTC C  C K+GQ+ DIQESAILEGYRCRDN CSGFLLRESD+KGFVCQQCGL RNKEEIRK + DIKAL DKA K
Sbjct:  185 KIACNAHTICDSELRPLGTGLYPVISIINHSCLPNSVLVFEGRLAVVRAVQHIPKDAEILISYIETATSTITRQKTLKEQYLFTCTCPCCIKVGQHDDIQESAILEGYRCRDNRCSGFLLRESDDKGFVCQQCGLTRNKEEIRKKSRDIKALLDKAPK 342          

HSP 3 Score: 93.2041 bits (230), Expect = 2.198e-16
Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 1
Query: 2920 LLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFKLSSRE 3075
            LLGETDDAIKS TKAVDILRITHGT+TPFMKELLMKLEEAR EAS+ LS +E
Sbjct:  429 LLGETDDAIKSLTKAVDILRITHGTNTPFMKELLMKLEEARAEASYTLSCKE 480          

HSP 4 Score: 88.9669 bits (219), Expect = 5.799e-15
Identity = 39/41 (95.12%), Postives = 39/41 (95.12%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 2391
            EEWKEAL  CRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL
Sbjct:  389 EEWKEALTFCRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 429          

HSP 5 Score: 63.5438 bits (153), Expect = 5.687e-7
Identity = 29/42 (69.05%), Postives = 36/42 (85.71%), Query Frame = 2
Query: 1820 T*TSDLQEAIVLYKNIEKLQKEVYHPFSIILLRTWEKLLEVL 1945
            T + + Q+A++LYKNIEKLQKEV HPFSI L+RTWEKL E+L
Sbjct:  344 TSSGNPQDAMILYKNIEKLQKEVCHPFSISLMRTWEKLHEIL 385          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A0D2SDG4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G091200 PE=4 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 2.890e-97
Identity = 156/159 (98.11%), Postives = 157/159 (98.74%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 1652
            +FACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTC CVRCNKLGQY DIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC
Sbjct:   52 KFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCTCVRCNKLGQYDDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKALKC 210          

HSP 2 Score: 112.079 bits (279), Expect = 8.332e-23
Identity = 60/85 (70.59%), Postives = 65/85 (76.47%), Query Frame = 1
Query: 2836 PLKESLYKWFDSFTQFWIKKTSIFINDRLLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFKLSSREDS*IT 3090
            P+ E +Y  F       ++  S    + LLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEAR EASFKLSSREDS IT
Sbjct:  270 PVYERVYPGFHPL--LGLQYYSCGKLEWLLGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARAEASFKLSSREDSYIT 352          

HSP 3 Score: 107.842 bits (268), Expect = 1.639e-21
Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 3
Query:  555 MDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 710
            MDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK
Sbjct:    1 MDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSK 52          

HSP 4 Score: 103.605 bits (257), Expect = 3.573e-20
Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 2391
            EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL
Sbjct:  256 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWL 296          

HSP 5 Score: 68.9366 bits (167), Expect = 6.573e-9
Identity = 33/40 (82.50%), Postives = 37/40 (92.50%), Query Frame = 2
Query: 1826 TSDLQEAIVLYKNIEKLQKEVYHPFSIILLRTWEKLLEVL 1945
            + +LQEAIVLYKNIEKLQKEV HPFSIIL+RT EKLLE+L
Sbjct:  213 SGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLLEIL 252          
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Match: A0A067GM08_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g011626mg PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 4.495e-92
Identity = 146/186 (78.49%), Postives = 167/186 (89.78%), Query Frame = 3
Query:  156 MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLTESRCDGCFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLYLRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQLPNIDIKEIAENFSKV 713
            MEELQ +LQ RGLT++  P+KGR L   +DFYPGEVIISQEPYVCVPNNS + SRCDGCF+ SNLKKCSAC VVWYCGS+CQKL+WKLHRLECQ+L++LDKE+RKSVTP+IR+M+KLYLRRKLQN+NVIP T  DNY+LVEALV+HMSDIDEKQLLLYAQ+ANLVNLILQ P I I EIAENFSK+
Sbjct:    1 MEELQKALQDRGLTVTGLPEKGRCLYTTKDFYPGEVIISQEPYVCVPNNSSSISRCDGCFASSNLKKCSACQVVWYCGSNCQKLDWKLHRLECQVLSRLDKEKRKSVTPSIRLMLKLYLRRKLQNDNVIPSTTTDNYSLVEALVAHMSDIDEKQLLLYAQIANLVNLILQWPEISINEIAENFSKL 186          

HSP 2 Score: 274.633 bits (701), Expect = 1.243e-77
Identity = 126/157 (80.25%), Postives = 142/157 (90.45%), Query Frame = 3
Query: 1176 QFACNAHTICDSELRSLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHIPKDSEVSISYVETAASTITRQKTLKEQYLFTCICVRCNKLGQYGDIQESAILEGYRCRDNGCSGFLLRESDEKGFVCQQCGLIRNKEEIRKIASDIKALSDKAL 1646
            + ACNAHTIC+SELR LGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQH+PK +EV ISY+ETA ST+TRQK LKEQYLFTC C RC KLGQ+ DIQESAILEGYRC+D+GCSGFLLR+SD+KGF CQQCGL+R+KEEI+KIAS++  LS K L
Sbjct:  185 KLACNAHTICNSELRPLGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHVPKGAEVLISYIETAGSTMTRQKALKEQYLFTCTCPRCIKLGQFDDIQESAILEGYRCKDDGCSGFLLRDSDDKGFTCQQCGLVRSKEEIKKIASEVNILSKKTL 341          

HSP 3 Score: 81.6481 bits (200), Expect = 1.130e-12
Identity = 36/52 (69.23%), Postives = 50/52 (96.15%), Query Frame = 1
Query: 2923 LGETDDAIKSFTKAVDILRITHGTSTPFMKELLMKLEEARVEASFKLSSRED 3078
            LG+T++AIKS T+AV+ILRITHGT++PFMKEL++KLEEA+ EAS+KLSS+++
Sbjct:  430 LGDTENAIKSMTEAVEILRITHGTNSPFMKELILKLEEAQAEASYKLSSKDE 481          

HSP 4 Score: 80.4925 bits (197), Expect = 2.855e-12
Identity = 34/40 (85.00%), Postives = 38/40 (95.00%), Query Frame = 1
Query: 2269 EEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEW 2388
            E+WKEALA C+LTIPVY+RVYP FHPLLGLQYY+CGKLEW
Sbjct:  389 EDWKEALAYCQLTIPVYQRVYPQFHPLLGLQYYTCGKLEW 428          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
ASHR1_ARATH1.610e-8672.43Histone-lysine N-methyltransferase ASHR1 OS=Arabid... [more]
SMYD3_MOUSE5.209e-1840.63Histone-lysine N-methyltransferase SMYD3 OS=Mus mu... [more]
SMYD3_HUMAN1.378e-1741.67Histone-lysine N-methyltransferase SMYD3 OS=Homo s... [more]
SMY2B_XENLA1.607e-1630.46N-lysine methyltransferase SMYD2-B OS=Xenopus laev... [more]
SMYD2_CHICK3.148e-1641.76N-lysine methyltransferase SMYD2 OS=Gallus gallus ... [more]
SMYD2_HUMAN4.323e-1643.33N-lysine methyltransferase SMYD2 OS=Homo sapiens G... [more]
SMY2A_XENLA5.141e-1629.95N-lysine methyltransferase SMYD2-A OS=Xenopus laev... [more]
SMYD2_BOVIN5.661e-1643.33N-lysine methyltransferase SMYD2 OS=Bos taurus GN=... [more]
SMYD2_RAT6.478e-1642.86N-lysine methyltransferase SMYD2 OS=Rattus norvegi... [more]
SMYD2_MOUSE6.655e-1642.86N-lysine methyltransferase SMYD2 OS=Mus musculus G... [more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092647 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2RI11_GOSRA4.095e-11798.38Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RBL7_GOSRA4.764e-11698.38Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PQ85_GOSRA1.500e-11297.30Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2N9S9_GOSRA1.249e-11192.82Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MR97_GOSAR7.448e-11096.76Histone-lysine N-methyltransferase ASHR1-like prot... [more]
A0A061FFX1_THECC6.689e-10086.56SET domain protein isoform 3 OS=Theobroma cacao GN... [more]
A0A061FH39_THECC6.702e-10086.56SET domain protein isoform 1 OS=Theobroma cacao GN... [more]
A0A061FNX5_THECC7.412e-10086.56SET domain protein isoform 2 OS=Theobroma cacao GN... [more]
A0A0D2SDG4_GOSRA2.890e-9798.11Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A067GM08_CITSI4.495e-9278.49Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002893Zinc finger, MYND-typePFAMPF01753zf-MYNDcoord: 58..95
e-value: 2.8E-9
score: 36.8
IPR002893Zinc finger, MYND-typePROSITEPS01360ZF_MYND_1coord: 58..95
IPR002893Zinc finger, MYND-typePROSITEPS50865ZF_MYND_2coord: 58..95
score: 11.603
NoneNo IPR availablePANTHERPTHR12197SET AND MYND DOMAIN CONTAININGcoord: 1..187
NoneNo IPR availablePANTHERPTHR12197:SF165HISTONE-LYSINE N-METHYLTRANSFERASE ASHR1coord: 1..187
NoneNo IPR availableSUPERFAMILY82199SET domaincoord: 13..65
NoneNo IPR availableSUPERFAMILY144232HIT/MYND zinc finger-likecoord: 53..100

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092647 ID=g.barbadense_cottongen_reftransV1_0092647|Name=g.barbadense_cottongen_reftransV1_0092647|organism=Gossypium barbadense|type=contig|length=3428bp
GTCGTTTTTATCCAAAATTACTTTTGAAGAGCAATGAGAGTGCCGTTTTA
ATTTTTTTTTTCTTGTTTACGAAAAGATCTGACGCCGAGGATTAGTCTTT
CATTAGTCTAAAGCAAAAACCTTCCAGAGCTTACTAGTTCTGGCTTTGCT
TGTTGATGGAGGAATTACAGGCTTCTCTTCAACCTCGAGGCTTAACCCTT
TCAACTTTCCCCGATAAAGGCCGTTCCCTCCTCGCTGCCAGGGATTTCTA
TCCAGGAGAAGTGATTATAAGCCAAGAGCCATACGTCTGCGTGCCCAACA
ACTCCTTAACCGAATCAAGGTGCGATGGATGTTTCAGCAAAAGCAATCTT
AAGAAATGCTCAGCTTGTCATGTTGTTTGGTATTGTGGGAGCTCATGTCA
GAAACTGGAATGGAAGTTGCATCGGCTCGAGTGTCAGTTACTCGCTAAGC
TTGACAAAGAAAGGAGAAAATCTGTTACGCCTACCATCCGAATGATGGTG
AAACTTTACCTTAGGAGAAAGTTGCAAAATGAGAATGTCATCCCTGTTAC
AGCTATGGACAATTACAATTTGGTGGAGGCTTTGGTTTCTCACATGTCGG
ATATTGATGAGAAGCAGCTATTGTTATATGCGCAGATGGCTAACCTTGTT
AACTTGATTCTTCAGCTCCCCAACATCGACATAAAGGAGATTGCTGAAAA
CTTTTCCAAGGTCCATATTGAACGGTTTTAAGCTTCTAATTCCTTAGTTT
ATCATTTGAGTCATAATTACTTGAAACATATTAAATTTAATATGTTTTCC
TTCCTCACTCACTCCAAGAAAGAAATTAATGAAGGTTATATCTAGGTACT
ATGTAAGCAGTCTTGCATTTCTTCCATGTGATCTTTTGCTATTTTATCAT
TAAATCTTAAATTTCAAATCAACAGGAAGAATGCAAGCTTCTGTTAGGAA
CTTATGGGTTGCTTAAAACATTATGCAGAAAAGGATCAAGGTTGTATAAG
TTATGTTTCAATTAGATGGATGTTCAATCCAAAAGTAAGATTGGCCTGAA
TAAGCAGTCCCGGAATTTATTACAGTGTAATTTCATGCCTCTTTTATTGT
AACAAAGTTAGGAATCTTAACAAGTTCTGTCTAAGCTGGATGAACATATG
TTCTTATTTATTATTATGAAAATGGCAGTTTGCATGTAATGCGCATACCA
TTTGTGACAGTGAACTGAGATCGCTTGGGACAGGACTGTATCCTGTTATT
TCTATTATCAACCACAGCTGCTTGCCAAATGCTGTCTTGGTATTTGAAGG
AAGGTTGGCTGTGGTACGTGCTGTACAACATATACCCAAAGATTCTGAGG
TATCAATCAGTTATGTAGAGACTGCTGCAAGTACAATTACTCGGCAAAAG
ACTCTCAAAGAACAGTACCTTTTCACTTGTATATGTGTTCGCTGTAACAA
ACTGGGTCAGTATGGTGATATCCAAGAAAGTGCAATTCTAGAAGGCTATC
GGTGCAGGGACAACGGATGCAGTGGCTTCTTGCTTAGAGAATCAGATGAA
AAAGGATTTGTTTGCCAACAATGTGGCCTCATTAGAAACAAGGAAGAGAT
AAGAAAGATTGCTAGTGATATCAAAGCATTGTCGGACAAGGCTCTTAAGT
GTAGTTCCTCGGGCAGTATCCTTCTCTTCTTTTCTTTGTTGACTAACTAG
GCATTATTGGTGGAAATTCAATTAAATATCATTGAATATAATCTCATTGG
TGAACTAATCTCATCTGGTAATAATTTAATTCACATTCATTGAAGGAAAG
GAATGAAAGTTGATTCTTAACCTGAACTTCAGATCTTCAGGAAGCCATTG
TTTTGTATAAAAATATTGAAAAGCTCCAGAAGGAAGTGTACCATCCTTTT
TCAATCATTTTGTTGAGAACTTGGGAAAAACTTCTTGAGGTACTTCCTTG
AGTCATGTTCACATTTCTGAGCAGAATGTAGCTTGAAGAAACATAGTTTA
AAGATGATTCAATTTCATATGATGTAGCAGTAGGATTCTTATTACTAATT
CAGCTTCACATCAGTGTATATTCTTGTCTTGTTACTTCCCAATCTGATGA
ATCGCTAGATCATGTCAGAAGCTAAACTGAAAGCTAACACCTCTTGTTTC
CTCTTCTATCAAACATCCCTTGGTAAAATAACATTGGTTTTATCGGCAAT
AACAATTGTGTTGATGTGTGATTTGATACAAATTGAATCAATTAATCCTG
CAGATATTAATGCAGCTGGAAGAATGGAAAGAAGCTTTGGCAATTTGCAG
ATTGACGATTCCGGTGTATGAAAGGGTTTATCCAGGATTTCATCCTTTGC
TTGGATTACAATACTACAGTTGTGGAAAGCTTGAATGGTTAGAGAAATAT
CTTGCCCTTGTTATTGACTTCATTCTCTGGTTTACTTCTTTCTTCCACTT
GTTCATCTTAGAAAATGTTAGTCATATCCAGCACCCTATAAGCTTTATAA
AATGAACTGAGGCCATCACTTTCTATGAAGTTGTCTCTCGGGACCTTGTA
GCAGCTAAAGTACACACTTTCGTCTGCTCAACATGAATGTGAAATGCACC
AAATTTTATGACTTAACATAGCTGTGTTCATCCAGGAATATAACCAAAAA
TTCAGAACTGCATCAGATTTATCGGATTATTACTTAATAAGAACTTCAGT
ATCTTTAGCAACTTTTCTTGAACCTGGCAAAGTTTATTCCAAGGTCCTTT
AGAGGCAAATATGCATTCTTTTAGTTGTAGCTGGTAGGTTTTGAGATCTT
TAACAGGTCAATGAGTGGGCATGATCTTAAAATAACCTCTCAAAGAATCC
CTTTACAAATGGTTTGATAGTTTTACTCAGTTTTGGATTAAAAAAACTTC
GATATTTATTAATGACAGGTTGCTAGGGGAGACAGATGATGCTATCAAGT
CGTTCACCAAGGCGGTTGACATACTGCGAATCACTCATGGGACAAGTACA
CCATTTATGAAAGAACTGTTGATGAAGTTGGAGGAAGCTCGTGTTGAAGC
GTCGTTCAAGCTCTCATCAAGAGAGGACTCATAAATTACGTTGTGAATGT
TATTGGCATTGTCTTCAATGTGAAGCTTACAGGCTTGCATCAAGGAATGA
CTCAATTGTGCTCTTCCATATCCGGAAGCCAAGAGCTTGGTTTCTCTCGG
GTTCATTGGAGATTTTTCAGCTTAAATGAGAAAAGGATTATGTATCGACT
GAAAAATATCAGTATTAGCTAATGTTGTAAGAATTGGATCGGACTGTGAT
TAAACGGTGGTCTAATTGGTGTATTACACTATATGAAACCACCCACTTAG
ATAAAGACCTGTTTTCGTCTTCTTCTTTTTTCATTTTTTATTTTAAAAAT
GATAAAATTTGAGTTTTCAATACGTTAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002893Znf_MYND