g.barbadense_cottongen_reftransV1_0092622, g.barbadense_cottongen_reftransV1_0092622 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092622
Unique Nameg.barbadense_cottongen_reftransV1_0092622
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2774
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLA9_ARATH (Glucomannan 4-beta-mannosyltransferase 9 OS=Arabidopsis thaliana GN=CSLA9 PE=2 SV=1)

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 441/590 (74.75%), Postives = 482/590 (81.69%), Query Frame = 3
Query:  351 MDQFPSTTIFPDT----TDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPN 2108
            M+   +T++ PD+     DD++MQM+++  QI+APLIVP L+L V +CL MSVMLF+ERVYMGIVI+LVKLFGRKPDKRFK+E IKDD+ELGNSAYPMVL+QIPM+NEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKD+VE+EC RWASKG+NIKYEIRDNRNGYKAGALKEGMK SYVK CDYV IFDADFQPE DFLWRT+P+L+HNP+LALVQARWKFVN+DECLMTRMQEMSLDYHFTVEQEVGSSTY+FFGFNGTAG+WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPST KAYRYQQHRWSCGPANLFRKM  EI+ NK                            V+ WKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEV VPKWGAVYIPS+IT+LNAVGTPRS HL+VFWILFENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD     A   + +  RFRFG+                               R+HVLEL VG YL F GCY   FGKNHY++YLFAQAIAFFI GFG +GTIVPN
Sbjct:    1 MELGDTTSVIPDSFMGYRDDITMQMSMVLDQIRAPLIVPALRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKRFKYEPIKDDIELGNSAYPMVLIQIPMFNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEADFLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNK---------------------------NVTLWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVTVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDVKAKSATKTSKKVIRFRFGD-------------------------------RIHVLELGVGMYLLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN 532          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLA2_ARATH (Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana GN=CSLA2 PE=2 SV=1)

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 392/591 (66.33%), Postives = 463/591 (78.34%), Query Frame = 3
Query:  351 MDQFPSTTIFPDTTDDLSM----QMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERY-KVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPN 2108
            MD      + P+T D + M    Q+ +IW  +KAP+IVPLL+LAV +CL+MSVML  ERVYMGIVI LVKLF +KPDKR+K+E I DD ELG+S +P+VLVQIPM+NEREVY+LSIGAACGLSWPSDR+VIQVLDDSTDPT+K MVE+ECQRWASKGINI+Y+IR+NR GYKAGALKEG+K SYVKHC+YVVIFDADFQPEPDFL R+IPFL+HNP +ALVQARW+FVN+DECL+TRMQEMSLDYHFTVEQEVGSST++FFGFNGTAG+WRI+A+NEAGGWKDRTTVEDMDLAVRASL+GWKFLYLG L+VK+ELPST +A+R+QQHRWSCGPANLFRKMVMEI++NK                           KV  WKKV+VIYSFF VRK++AH VTF FYCV+LP T+LVPEV+VP WG+VYIPSIITILN+VGTPRS HLL +WILFENVMSLHRTKAT IGL EAGR NEW+VT KLG    +K   K          +R+ +++++                        RL+ LEL   A+LF CGCY  V GKN+YFIYLF Q ++FFI G G++GT VP+
Sbjct:    1 MDGVSPKFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVIVLVKLFWKKPDKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDRLVIQVLDDSTDPTVKQMVEVECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHCEYVVIFDADFQPEPDFLRRSIPFLMHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFRAFRFQQHRWSCGPANLFRKMVMEIVRNK---------------------------KVRFWKKVYVIYSFFFVRKIIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGI--------KRFPRIFKLPD----------------------RLNTLELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS 534          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLA9_ORYSJ (Probable mannan synthase 9 OS=Oryza sativa subsp. japonica GN=CSLA9 PE=2 SV=1)

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 380/578 (65.74%), Postives = 455/578 (78.72%), Query Frame = 3
Query:  399 LSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAI------KDDVELG--NSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPN 2108
            L  Q+A +W Q+KAP++VPLL+L+V  CL MSVMLF+E+VYM +V+  V LFGR+PD+R++ + I       DD EL   N+A+PMVL+QIPMYNEREVY+LSIGAACGLSWPSDR+++QVLDDSTDP IK+MV++EC+RW SKG+ IKYEIRDNR GYKAGAL+EGMKH YV+ CDYV IFDADFQP+PDFL RTIPFLVHNP++ALVQARWKFVNA+ECLMTRMQEMSLDYHF VEQEVGSST++FFGFNGTAGVWRISA+NEAGGWKDRTTVEDMDLAVRA LKGWKF+YLG L VK+ELPST KA+RYQQHRWSCGPANLFRKM++EI  NK                           KV+ WKK++VIY+FF+VRK++ HIVTF+FYC+++PATVL+PEVE+P+WG VY+PSI+TILN++GTPRS HLL+FW+LFENVMSLHRTKAT IGLLE GRVNEW+VTEKLGDA K K   KA R+PR R G+                               R++ LEL   AYL FCGCY + +GK +Y ++LF Q+I FFI+G GYVGTIVP+
Sbjct:    8 LPEQIAAMWEQVKAPVVVPLLRLSVAACLAMSVMLFVEKVYMSVVLVGVHLFGRRPDRRYRCDPIVAAGADNDDPELADANAAFPMVLIQIPMYNEREVYKLSIGAACGLSWPSDRVIVQVLDDSTDPVIKEMVQVECKRWESKGVRIKYEIRDNRVGYKAGALREGMKHGYVRDCDYVAIFDADFQPDPDFLARTIPFLVHNPDIALVQARWKFVNANECLMTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTAGVWRISAMNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDLMVKSELPSTFKAFRYQQHRWSCGPANLFRKMLVEIATNK---------------------------KVTLWKKIYVIYNFFLVRKIIGHIVTFVFYCLVVPATVLIPEVEIPRWGYVYLPSIVTILNSIGTPRSLHLLIFWVLFENVMSLHRTKATLIGLLETGRVNEWVVTEKLGDALKLKLPGKAFRRPRMRIGD-------------------------------RVNALELGFSAYLSFCGCYDIAYGKGYYSLFLFLQSITFFIIGVGYVGTIVPH 527          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLA1_ORYSJ (Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza sativa subsp. japonica GN=CSLA1 PE=3 SV=1)

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 376/564 (66.67%), Postives = 450/564 (79.79%), Query Frame = 3
Query:  423 WGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAI-KDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            W Q++AP+IVPLL+LAV VCL MSV+LF+ER+YM +VI+ VK+  R+PD+R++ + I  DD ELG SA+P+VL+QIPM+NEREVYQLSIGA CGLSWPSDR+V+QVLDDSTDP IK+MV +EC+RWA KG+NI Y+IR+NR GYKAGALKEGMKH YV+ C+YV IFDADFQP+PDFL RTIPFLVHN ++ALVQARW+FVNADECLMTRMQEMSLDYHFTVEQEV SS  +FFGFNGTAGVWR+SA+NEAGGWKDRTTVEDMDLA+RASLKGWKF+YLG ++VK+ELPST KA+R+QQHRWSCGPANLFRKM+MEI++NK                           KV+ WKK+HVIY+FF++RK++AHIVTF FYC+I+PAT+ VPEV +PKWG VYIP+IIT+LN+VGTPRSFHLL FWILFENVMSLHRTKAT IGLLEAGR NEW+VTEKLG+A K K+++K+  K  F      +V+                          RL+V EL V A+LF CG Y + FGK+H+FIYLF Q  AFFI+G GYVGTIVP S
Sbjct:   15 WSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVISGVKILRRRPDRRYRCDPIPDDDPELGTSAFPVVLIQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDPVIKEMVRIECERWAHKGVNITYQIRENRKGYKAGALKEGMKHGYVRECEYVAIFDADFQPDPDFLRRTIPFLVHNSDIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGFNGTAGVWRVSAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQHRWSCGPANLFRKMLMEIVRNK---------------------------KVTIWKKIHVIYNFFLIRKIIAHIVTFAFYCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKATLIGLLEAGRANEWVVTEKLGNALKMKSSSKSSAKKSFM-----RVWD-------------------------RLNVTELGVAAFLFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQS 521          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLA3_ARATH (Probable mannan synthase 3 OS=Arabidopsis thaliana GN=CSLA3 PE=2 SV=1)

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 358/581 (61.62%), Postives = 427/581 (73.49%), Query Frame = 3
Query:  384 DTTDDLSM-----QMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDD-VELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPN 2108
            DTTD +       ++  IW Q +  + +P+LK  V +CL+MS++LFIERVYM IV+  VKL  R P+K  KWE I DD +EL N+ YPMVL+QIPMYNE+EV QLSIGAAC LSWP DR+++QVLDDSTDP  K++V  EC +WA KGINI  EIRDNR GYKAGALK GM H+YVK C++V IFDADFQP+PDFL RTIPFL+HN E++LVQ RWKFVNA+ECLMTRMQEMSL+YHF  EQE GSS ++FFGFNGTAGVWRI+ALNEAGGWKDRTTVEDMDLAVRA L GWKF+Y+  ++VKNELPST KAYR+QQHRWSCGPANL+RKM MEI++NK                           KVS WKK+++IY+FF +RK+V HI TF+FYC+ILP TVL PE++VPKW  VY P+ ITILNA+ TPRS HLLVFWILFENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  KSK   KA  K   RFG+                               RL+  EL VG Y+FFCGCY   +G +++++YLF Q+ AFF+ G GY+GT VP 
Sbjct:   33 DTTDGVVRSGIIGEIIYIWKQTRIFVFIPILKCLVTICLVMSLLLFIERVYMSIVVVFVKLLRRTPEKVHKWEPINDDDLELANTNYPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKELVNAECDKWARKGINIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFLERTIPFLIHNHEISLVQCRWKFVNANECLMTRMQEMSLNYHFVAEQESGSSIHAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAYRFQQHRWSCGPANLWRKMTMEILQNK---------------------------KVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLIGKATTKLYTRFGQ-------------------------------RLNWRELVVGLYIFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVPT 555          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLA1_CYATE (Mannan synthase 1 OS=Cyamopsis tetragonoloba GN=ManS PE=1 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 335/569 (58.88%), Postives = 417/569 (73.29%), Query Frame = 3
Query:  402 SMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPN 2108
            S  +   W  I+AP+I+PLLKLAV+VC +MS+MLF+ERV M  VI +VK+  +K   ++  EA+K  +E  +  YPMVL+QIPMYNE+EVY+LSIGA CGLSWP+DR ++QVLDDST+P ++++VE+ECQ+W  KG+N+KYE R NRNGYKAGALKEG++  YV+ C++V IFDADFQP+ DFLW TIP+L+ NP+L LVQARWKFVN++EC+MTR+QEMSLDYHF+VEQEVGSSTYSFFGFNGTAGVWRI A+ +AGGWKDRTTVEDMDLAVRASL GW+F+++G +KVKNELPST KAYR+QQHRWSCGPANLF+KM  EI                           I  ++V   K++H+IY+FF VRK+VAH VTF FYC+++PA V+VPEV + K  A+YIP+ ITILNAV TPRS HLLV WILFENVMSLHRTKA  IGLLEA RVNEW+VTEKLG+A K           R     R+++                         + R+H LE+ VG Y+  C  Y ++FG +H+F+YL  QA AFF MGFG VGTIVP 
Sbjct:   17 SSSLRYAWQSIRAPVIIPLLKLAVIVCSVMSIMLFVERVAMAAVILIVKVLRKKRYTKYNLEAMKQKLE-RSKKYPMVLIQIPMYNEKEVYKLSIGAVCGLSWPADRFIVQVLDDSTNPVLRELVEMECQKWIQKGVNVKYENRRNRNGYKAGALKEGLEKQYVEDCEFVAIFDADFQPDADFLWNTIPYLLENPKLGLVQARWKFVNSEECMMTRLQEMSLDYHFSVEQEVGSSTYSFFGFNGTAGVWRIQAIKDAGGWKDRTTVEDMDLAVRASLHGWEFVFVGDVKVKNELPSTFKAYRFQQHRWSCGPANLFKKMTKEI---------------------------ICCKRVPLLKRLHLIYAFFFVRKIVAHWVTFFFYCIVIPACVIVPEVNLKKQIAIYIPATITILNAVSTPRSMHLLVLWILFENVMSLHRTKAAIIGLLEANRVNEWVVTEKLGNAMKQ------RNNARPSRASRFRI-------------------------IERIHPLEIIVGMYMLHCATYDLLFGHDHFFVYLLLQAGAFFTMGFGLVGTIVPT 526          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLAF_ARATH (Probable mannan synthase 15 OS=Arabidopsis thaliana GN=CSLA15 PE=3 SV=2)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 324/574 (56.45%), Postives = 407/574 (70.91%), Query Frame = 3
Query:  387 TTDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRL----HVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGT 2096
            + D + + M+ +W + +   IVPL K  VV+CLI+S+++F+E VYM +V+  VKLF RKP+K +KWEA+++D+ELG+  YPMVLVQIPMYNEREV++LSIGAAC L+WPSDR+++QVLDDSTDP I ++V +EC +WASK INI YE R+NRNGYKAGALK GM+HSYVK C Y+ IFDADFQPEPD+L R IPFL+HNPE+ALVQARW+FVNA+ CLMTRMQEMSL+YHF  EQ+ GS+ ++FFGFNGTAGVWR+ A+ EAGGWKDRTTVEDMDLAVR  L GWKF+++  L+VK+ELPS  KA+R+QQHRWSCGPANL RKM MEII NK                           +V  WKK +VIYSFF +RK+V H  T+ FYCVILP +V +PEV +P W  +Y+PS+IT+L+A+ TPRSF+L++FW+LFENVM++HRTK T IGL E GRVNEW+VTEKLGD                               T L P              GRL    ++ E+ +G Y+  C CY   FG    ++YLF QA AF I G G+VGT
Sbjct:   31 SVDGVGINMSTMWRETRNVFIVPLFKCIVVMCLIISLLVFVESVYMNLVVLYVKLFNRKPEKVYKWEAMQEDMELGHQNYPMVLVQIPMYNEREVFELSIGAACRLTWPSDRLIVQVLDDSTDPAIMELVSMECTKWASKDININYERRENRNGYKAGALKHGMRHSYVKQCQYLAIFDADFQPEPDYLQRAIPFLIHNPEVALVQARWRFVNANTCLMTRMQEMSLNYHFMAEQQSGSTRHAFFGFNGTAGVWRMVAMEEAGGWKDRTTVEDMDLAVRVGLLGWKFIFVNDLEVKSELPSQFKAFRFQQHRWSCGPANLIRKMTMEIIHNK---------------------------RVKIWKKFYVIYSFFFLRKIVVHFFTYFFYCVILPTSVFLPEVNIPNWSTIYVPSVITLLSAIATPRSFYLVIFWVLFENVMAMHRTKGTLIGLFEGGRVNEWVVTEKLGDTLN----------------------------TKLLP------------QNGRLPKRVNLKEMMMGIYILCCACYDFAFGNAFLYLYLFMQATAFLISGVGFVGT 537          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLA7_ARATH (Probable mannan synthase 7 OS=Arabidopsis thaliana GN=CSLA7 PE=2 SV=2)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 329/558 (58.96%), Postives = 415/558 (74.37%), Query Frame = 3
Query:  390 TDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIA 2063
            ++D+  ++ + W  I+A ++VP+ K  V++CL+MSVM F+E +YMGIV+  VKLF RKP+K +KWEA++DDVE G+++YPMVLVQIPMYNE+EV + SI AAC +SWPS+RI+IQVLDDSTDP  K++V+ EC RW+ +G+NI +EIRDNRNGYKAGAL+EGM+HSYVK CDYV IFDADFQP+PDFL RT+PFL+HNP+LALVQ RW+FVNA +C+MTR+QEMSL YHFT+EQ+VGSST++FFGFNGTAGVWRISALNE+GGW D+TTVEDMDLAVRA+L+GWKFLY+  LKVK+ELP + KA R QQHRW+CGPANL RKM  +II++                           + VS WKK +++YSFF +RK+VAHI+TF FYCVILPATVL PEV VPKW A Y+PS+IT+L A+G  RS HLL FW+LFEN MSL R KA  +GL E GRV EW+VTEKLGD  K+K   + P         R++                            R+H+LEL VGAYL FCG Y +V+GKN  ++YL  Q++A
Sbjct:   40 SEDIIARIGLWWQLIRAVVVVPVFKFLVLLCLVMSVMFFVEVMYMGIVVLYVKLFKRKPEKFYKWEAMEDDVECGSASYPMVLVQIPMYNEKEVCEQSIAAACKISWPSNRIIIQVLDDSTDPASKELVKKECDRWSKEGVNITFEIRDNRNGYKAGALREGMRHSYVKQCDYVAIFDADFQPDPDFLHRTVPFLIHNPKLALVQGRWEFVNAGQCMMTRLQEMSLSYHFTIEQQVGSSTFAFFGFNGTAGVWRISALNESGGWNDQTTVEDMDLAVRATLRGWKFLYIDDLKVKSELPCSFKALRSQQHRWTCGPANLLRKMAGQIIRS---------------------------ENVSLWKKWYMLYSFFFMRKIVAHILTFCFYCVILPATVLFPEVTVPKWAAFYLPSLITLLIAIGRLRSIHLLAFWVLFENAMSLLRAKALVMGLFETGRVQEWVVTEKLGDTLKTKLIPQVPNV-------RFR---------------------------ERVHLLELLVGAYLLFCGIYDIVYGKNTLYVYLLFQSVA 536          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLAA_ARATH (Probable mannan synthase 10 OS=Arabidopsis thaliana GN=CSLA10 PE=2 SV=2)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 322/556 (57.91%), Postives = 407/556 (73.20%), Query Frame = 3
Query:  429 QIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGT 2096
            + ++  IVPL K  V  CLI+S+++FIE +YM +V+  VK+F RKP+K ++WEA+++D+ELG+  YPMVLVQIPMYNE+EV QLSIGAAC L WP DR+++QVLDDSTD TIK++V  EC +W SKG+NIK E RDNRNGYKAGALKEGMKH+YVK C+YVVIFDADFQPEPD+L  ++PFLVHNPE+ALVQARW+F+NA++CLMTRMQEMSL+YHF  EQE GS+ ++FF FNGTAGVWR++A+ EAGGW DRTTVEDMDLAVRA L GWKF++L  L VK+ELPS  KA+R+QQHRWSCGPANLFRKM+MEII+NK                           +V+ WKK++++YSFF +RK++ H  TFIFYCVILP +V  PEV +P W   YIPS+IT+   + TPRSF+L++FWILFENVMS+HRTK TFIG+LE  RVNEW+VTEKLGDA K+        K   R G+   ++                        + R++  E+ VG Y+  C CY + FG    ++YLF QA+AF I G G+VGT
Sbjct:   56 EFRSLFIVPLFKCLVAFCLIISLLVFIEGIYMNLVVLYVKVFERKPEKVYRWEAMQEDIELGHETYPMVLVQIPMYNEKEVLQLSIGAACRLIWPLDRLIVQVLDDSTDQTIKELVNTECAKWESKGVNIKCERRDNRNGYKAGALKEGMKHNYVKLCNYVVIFDADFQPEPDYLQHSVPFLVHNPEVALVQARWRFMNANKCLMTRMQEMSLNYHFMAEQESGSTRHAFFSFNGTAGVWRMAAMEEAGGWHDRTTVEDMDLAVRAGLLGWKFVFLNDLTVKSELPSKFKAFRFQQHRWSCGPANLFRKMIMEIIRNK---------------------------RVTIWKKLYLVYSFFFLRKIIVHCFTFIFYCVILPTSVFFPEVNIPAWSTFYIPSMITLCIVIATPRSFYLVIFWILFENVMSMHRTKGTFIGILERQRVNEWVVTEKLGDALKT--------KLLPRIGKPSNMF------------------------LERVNSKEIMVGIYILCCACYGLFFGNTLLYLYLFMQAVAFLISGVGFVGT 552          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Match: CSLA1_ARATH (Probable mannan synthase 1 OS=Arabidopsis thaliana GN=CSLA1 PE=2 SV=1)

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 314/564 (55.67%), Postives = 401/564 (71.10%), Query Frame = 3
Query:  405 MQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGT 2096
            +Q+  +W + ++ +++P+ K  VV+CL++S+++F E  YM  VI  VKLF RKP K +KWEA+++DVE+G   YPMVL+QIPMYNE+EV+QLSI A C L WPS R+V+QV+DDSTDP +++ V++E  +W S+GINI+ E RDNRNGYKAGA+KE +  SYVK CD+V +FDADFQPEPD+L R +PFLVHNP++ALVQARW FVNA++CLMTRMQEMSL+YHF VEQE GS+ ++FFGFNGTAGVWRISA+  AGGWK RTTVEDMDLAVR  L GWKF+YL  L V+NELPS  KAYR+QQHRWSCGPANLFRKM MEII NK                           +VS WKK +VIYSFF VRK+  H +TF FYC+I+P +V  PE+ +P W  +Y+PS+I+I + + TPRSF+L++FW+LFENVM++HRTK T IGLLE GRVNEW+VTEKLGDA KSK  ++          +R   YQ                         R++  E+ VG Y+  C  Y +++G      YLF QA AFF+ GFG+VGT
Sbjct:   50 IQLQYLWTKTRSVVLLPVFKGLVVMCLVLSIIVFFESFYMNFVILFVKLFKRKPHKVYKWEAMQEDVEVGPDNYPMVLIQIPMYNEKEVFQLSIAAICSLVWPSSRLVVQVVDDSTDPAVREGVDVEIAKWQSQGINIRCERRDNRNGYKAGAMKEALTQSYVKQCDFVAVFDADFQPEPDYLIRAVPFLVHNPDVALVQARWIFVNANKCLMTRMQEMSLNYHFKVEQESGSTRHAFFGFNGTAGVWRISAMEAAGGWKSRTTVEDMDLAVRVGLHGWKFVYLNDLTVRNELPSKFKAYRFQQHRWSCGPANLFRKMTMEIIFNK---------------------------RVSIWKKFYVIYSFFFVRKVAVHFLTFFFYCIIVPTSVFFPEIHIPSWSTIYVPSLISIFHTLATPRSFYLVIFWVLFENVMAMHRTKGTCIGLLEGGRVNEWVVTEKLGDALKSKLLSRVV--------QRKSCYQ-------------------------RVNSKEVMVGVYILGCALYGLIYGHTWLHFYLFLQATAFFVSGFGFVGT 553          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: A0A0D2NSA3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G243400 PE=4 SV=1)

HSP 1 Score: 1026.93 bits (2654), Expect = 0.000e+0
Identity = 524/587 (89.27%), Postives = 527/587 (89.78%), Query Frame = 3
Query:  351 MDQFPSTTIFPDTTDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            MD+FPSTTIFPDTTDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNK                           KVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCV+LPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGD HKSKAAAKAPRKPRFRFGE                               RLHVLELSVGAYLFFCGCY VVFGKNHYFIYLFAQAIAFFIMGFGYVGTI+PNS
Sbjct:    1 MDRFPSTTIFPDTTDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNK---------------------------KVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDTHKSKAAAKAPRKPRFRFGE-------------------------------RLHVLELSVGAYLFFCGCYDVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIIPNS 529          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: A0A0B0P923_GOSAR (Glucomannan 4-beta-mannosyltransferase 9-like protein OS=Gossypium arboreum GN=F383_24230 PE=4 SV=1)

HSP 1 Score: 1011.91 bits (2615), Expect = 0.000e+0
Identity = 520/587 (88.59%), Postives = 524/587 (89.27%), Query Frame = 3
Query:  351 MDQFPSTTIFPDTTDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            MD+ PSTTIFPDT DDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLF+ERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVN+DECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNK                           KVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCV+LPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA KSKAAAKAPRKPRFRFGE                               RLHVLEL VGAYLFFCGCY VVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS
Sbjct:    1 MDRLPSTTIFPDTNDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFVERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNK---------------------------KVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAFKSKAAAKAPRKPRFRFGE-------------------------------RLHVLELCVGAYLFFCGCYDVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 529          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: A0A061EUM7_THECC (Nucleotide-diphospho-sugar transferases superfamily protein isoform 1 OS=Theobroma cacao GN=TCM_022423 PE=4 SV=1)

HSP 1 Score: 977.237 bits (2525), Expect = 0.000e+0
Identity = 497/591 (84.09%), Postives = 513/591 (86.80%), Query Frame = 3
Query:  351 MDQFPSTTIFPDT----TDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            MD+  STTI PDT     DD SMQMAVIWGQIKAPLIVPLL+L V+VCLIMS+MLFIERVYMGIVI LVKLFGRKP++R+KWE IKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRI+IQVLDDSTDPTIKD+VELECQRWASKGINIKYEIRDNRNGYKAGALKEGMK SYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTY+FFGFNGTAGVWRI+ALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEII NK                           KVS+WKKVHVIYSFFVVRKLVAHIVTFIFYCV+LPATVLVPEVEVPKWGAVYIP+IITILNAVGTPRS HLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA K+KA  KAPRKPRFRFGE                               RLH+LEL VGAYLFFCGCY VVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS
Sbjct:    1 MDRLSSTTILPDTFQGTRDDFSMQMAVIWGQIKAPLIVPLLRLTVIVCLIMSLMLFIERVYMGIVIMLVKLFGRKPERRYKWEPIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIITNK---------------------------KVSSWKKVHVIYSFFVVRKLVAHIVTFIFYCVVLPATVLVPEVEVPKWGAVYIPTIITILNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDALKAKAGTKAPRKPRFRFGE-------------------------------RLHLLELCVGAYLFFCGCYDVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 533          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: A0A067LFA8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_23699 PE=4 SV=1)

HSP 1 Score: 946.806 bits (2446), Expect = 0.000e+0
Identity = 469/591 (79.36%), Postives = 497/591 (84.09%), Query Frame = 3
Query:  351 MDQFPSTTIFPDT----TDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            MD+  +T + PD      DD+SMQ ++IW QIKAPLIVPLL+LAV +CLIMS+MLFIERVYMGIVI LVKLFGRKP+KR+KWE +KDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRI+IQVLDDSTDPTIKD+VELECQRWASKGINIKYEIRDNRNGYKAGALKEGMK SYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNP+LALVQARWKFVN+DECLMTRMQEMSLDYHFTVEQEVGSSTY+FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEII NK                           KV+ WKKVHVIYSFF+VRK+VAHIVTFIFYCV+LPATVLVPEVEVPKWGAVYIPSIIT+LNAVGTPRS HLLVFWILFENVMSLHRTKATFIGLLEA RVNEWIVTEKLGDA KSKA     +        R+K  +                         RLH+LEL  GAYLFFCGCY V FGKNHYF+YLFAQAIAFFI+GFGYVGT VP S
Sbjct:    1 MDRLTTTAVIPDAFQGARDDISMQFSIIWDQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMGIVIILVKLFGRKPEKRYKWEPLKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPQLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIINK---------------------------KVTLWKKVHVIYSFFLVRKIVAHIVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEASRVNEWIVTEKLGDAVKSKAVKAPKK-------PRFKFGE-------------------------RLHLLELGTGAYLFFCGCYDVAFGKNHYFLYLFAQAIAFFIIGFGYVGTFVPQS 532          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: A0A059DFA7_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_A01558 PE=4 SV=1)

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 459/591 (77.66%), Postives = 499/591 (84.43%), Query Frame = 3
Query:  351 MDQFPSTTIFPDT----TDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            MD+  +T + PDT     DD+SMQ+++IW QIKAPL+VPLL++AV +CL MS+MLF+ERVYM +VI LVKLFGRKP+KR++WE IKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRI+IQVLDDSTDPTIKD+VELECQRWASKGINI+YEIRDNRNGYKAGALKEGMK SYVK CDYV I DADFQPEPDFLWRTIPFLVHNPE+ALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSST++FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKF+YLGSLKVKNELPST KAYR+QQHRWSCGPANLFRKM MEII+NK                           KV+ WKKVHVIYSFF+VRK+VAHIVTFIFYCV+LPATV VPEV VPKWGAVYIPSIIT+LNAVGTPRS HL+VFWILFENVMS HRTKATFIGLLEAGRVNEWIVTEKLGDA K KA+ K P+KP+FRFG+                               RLHVLEL VGAYLFFCGCY + FG+NHYF+YLFAQAIAFFIMGFGY+GT VPNS
Sbjct:    1 MDRLSATGLLPDTFGGARDDISMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFLERVYMAVVILLVKLFGRKPEKRYRWEPIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAILDADFQPEPDFLWRTIPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSLKVKNELPSTFKAYRFQQHRWSCGPANLFRKMAMEIIRNK---------------------------KVTLWKKVHVIYSFFLVRKIVAHIVTFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKATFIGLLEAGRVNEWIVTEKLGDALKVKASNKVPKKPKFRFGD-------------------------------RLHVLELGVGAYLFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS 533          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: A0A059DFS3_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_A01558 PE=4 SV=1)

HSP 1 Score: 924.465 bits (2388), Expect = 0.000e+0
Identity = 458/591 (77.50%), Postives = 498/591 (84.26%), Query Frame = 3
Query:  351 MDQFPSTTIFPDT----TDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            MD+  +T + PDT     DD+SMQ+++IW QIKAPL+VPLL++AV +CL MS+MLF+ERVYM +VI LVKLFGRKP+KR++WE IKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRI+IQVLDDSTDPTIKD+VELECQRWASKGINI+YEIRDNRNGYKAGALKEGMK SYVK CDYV I DADFQPEPDFLWRTIPFLVHNPE+ALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSST++FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKF+YLGSLKVKNELPST KAYR+QQHRWSCGPANLFRKM MEII+N                            KV+ WKKVHVIYSFF+VRK+VAHIVTFIFYCV+LPATV VPEV VPKWGAVYIPSIIT+LNAVGTPRS HL+VFWILFENVMS HRTKATFIGLLEAGRVNEWIVTEKLGDA K KA+ K P+KP+FRFG+                               RLHVLEL VGAYLFFCGCY + FG+NHYF+YLFAQAIAFFIMGFGY+GT VPNS
Sbjct:    1 MDRLSATGLLPDTFGGARDDISMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFLERVYMAVVILLVKLFGRKPEKRYRWEPIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAILDADFQPEPDFLWRTIPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSLKVKNELPSTFKAYRFQQHRWSCGPANLFRKMAMEIIRN----------------------------KVTLWKKVHVIYSFFLVRKIVAHIVTFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKATFIGLLEAGRVNEWIVTEKLGDALKVKASNKVPKKPKFRFGD-------------------------------RLHVLELGVGAYLFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS 532          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: D7TJ10_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_08s0007g03990 PE=4 SV=1)

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 456/590 (77.29%), Postives = 497/590 (84.24%), Query Frame = 3
Query:  351 MDQFPSTTIFPD----TTDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPN 2108
            MD+  STT+ PD    T DD+S Q+ V+W QIKAP+IVPL+ +AV VCL MS+MLF ERVY+ IVI LVKLFGRKPDKR+KWE +KDDVELGNSAYPMVLVQIPMYNE+EVYQLSIGAACGLSWPSDRI+IQVLDDSTDPTIKD+VELECQRWASKGINIKYEIR+NRNGYKAGALKEGMKHSYVK CDYV IFDADFQPEPDFLWRT+PFLVHNPE+ALVQARWKFVN+DECLMTRMQEMSLDYHFTVEQEVGSSTY+FFGFNGTAGVWRI+ALNEAGGWKDRTTVEDMDLAVRASLKGWKF+YLG+LKVKNELPST KAYRYQQHRWSCGPANLFRKMVMEI++NK                           KVS WKKVHVIYSFF+VRKLVAHIVTF+FYCV+LPATVLVP+VEVP+WGAVYIP+IITILNAVGTPRS HL+VFWILFENVMSLHRTKATFIGLLE GRVNEW+VTEKLGDA K KAA KAP+KPRF+ GE                               RLH+LEL VGA+LFFCGCY V FG+NHYFIYL+ QAIAFFI+GFGYV T+  N
Sbjct:    1 MDRLSSTTLLPDALQGTRDDISEQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLFFERVYLSIVIVLVKLFGRKPDKRYKWEPMKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRNNRNGYKAGALKEGMKHSYVKECDYVAIFDADFQPEPDFLWRTVPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGTLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIVRNK---------------------------KVSLWKKVHVIYSFFIVRKLVAHIVTFVFYCVVLPATVLVPDVEVPRWGAVYIPTIITILNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWVVTEKLGDALKVKAATKAPKKPRFKIGE-------------------------------RLHLLELGVGAFLFFCGCYDVAFGRNHYFIYLYVQAIAFFIVGFGYVATLSHN 532          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: L7Z9A7_EUCCD (CSLA9-like protein OS=Eucalyptus cladocalyx PE=4 SV=1)

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 455/591 (76.99%), Postives = 499/591 (84.43%), Query Frame = 3
Query:  351 MDQFPSTTIFPDT----TDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            MD+  +T + PDT     DD+SMQ+++IW QIKAPL+VPLL++AV +CL MS+MLF+ERVYM +VI LVKLFGRKP+KR++WE +KDD+ELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRI+IQVLDDSTDPTIKD+VELECQRWASKGINI+YEIRDNRNGYKAGALKEGMK SYVK CDYV I DADFQPEPDFLWRT+PFLVHNPE+ALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSST++FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPST KAYR+QQHRWSCGPANLFRKM MEII+N                            KV+ WKK+HVIYSFF+VRK+VAHIVTFIFYCV+LPATV VPEV VPKWGAVYIPSIIT+LNAVGTPRS HL+VFWILFENVMS HRTKATFIGLLEAGRVNEWIVTEKLGDA K KA++K P+KP+FRFG+                               RLHVLEL VGAYLFFCGCY + FG+NHYF+YLFAQAIAFFIMGFGY+GT VPNS
Sbjct:    1 MDRLSATGLLPDTFGGARDDVSMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFVERVYMAVVILLVKLFGRKPEKRYRWEPMKDDIELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAILDADFQPEPDFLWRTVPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRFQQHRWSCGPANLFRKMAMEIIRN----------------------------KVTLWKKLHVIYSFFLVRKIVAHIVTFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKATFIGLLEAGRVNEWIVTEKLGDALKVKASSKVPKKPKFRFGD-------------------------------RLHVLELGVGAYLFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS 532          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: M1CQQ4_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400028267 PE=4 SV=1)

HSP 1 Score: 915.99 bits (2366), Expect = 0.000e+0
Identity = 452/591 (76.48%), Postives = 496/591 (83.93%), Query Frame = 3
Query:  351 MDQFPSTTIFPDT----TDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            MD+F STT+FPDT     DDL+ Q+ +IW QIKAPLIVPLL++AV +CL+MS++LFIERVYMGIVI LVKLFGRK DKR+KWE++KDDVE+GNS YPMVLVQIPMYNE+EVYQLSIGAACGLSWPSDRI+IQVLDDSTDP IK++V +ECQRWASKGI+I+YEIRDNRNGYKAGALKEG+KH YVK CDYV IFDADFQPEPDFLWRTIPFLVHNP+L LVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTY+FFGFNGTAGVWRI+AL EAGGWKDRTTVEDMDLAVRASLKGWKFLYL +LKVKNELPST KAYRYQQHRWSCGPANLFRKM MEII+NK                           KVS WKK+HVIYSFF VRK+VAHIVTF+FYCV+LPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHL++FWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGD  K K+A+KA +KPRFR G+                               RL +LEL+ GAYLFFCGCY V FGKNHYF+YLF QA AFFI+GFG++GT VPNS
Sbjct:    1 MDRFSSTTLFPDTLAGTRDDLTEQLTIIWEQIKAPLIVPLLRIAVFLCLLMSILLFIERVYMGIVITLVKLFGRKSDKRYKWESLKDDVEIGNSCYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPIIKNLVSMECQRWASKGIDIRYEIRDNRNGYKAGALKEGLKHPYVKQCDYVAIFDADFQPEPDFLWRTIPFLVHNPQLGLVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALEEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSALKVKNELPSTFKAYRYQQHRWSCGPANLFRKMFMEIIRNK---------------------------KVSLWKKIHVIYSFFFVRKVVAHIVTFVFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLIIFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDVLKMKSASKAVKKPRFRVGD-------------------------------RLLLLELATGAYLFFCGCYDVAFGKNHYFLYLFIQAFAFFIIGFGHIGTFVPNS 533          
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Match: U5G6I8_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s11810g PE=4 SV=1)

HSP 1 Score: 915.605 bits (2365), Expect = 0.000e+0
Identity = 457/591 (77.33%), Postives = 491/591 (83.08%), Query Frame = 3
Query:  351 MDQFPSTTIFPDT----TDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFIERVYMGIVIALVKLFGRKPDKRFKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKVKSIRETSYKC*EFVESVIDCFVISLQKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKSXXXXXXXXXXXXXXGERYKVYQIESAITSLQP*LVIQCLLI*QSNVGRLHVLELSVGAYLFFCGCYAVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS 2111
            M++  ST + PD      DD++MQ A+IWGQIKAPLIVPLL+LAV +CLIMS+MLFIERVYMGIVI LVKLFGRKPD+R+KWE +KDDVE GNS YPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRI+IQVLDDSTDPTIKDMVELECQRWASKGINIKYE+RD+RNGYK+GALKEGMK SYVK CDYV IFDADFQPEPDFL RTIPFLVHNPEL LVQ RWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTY+FFGFNGTAGVWRI+ALNEAGGWKDRTTVEDMDLAVRASLKGW+FLYL S+KVKNELPSTLKAYRYQQHRWSCGPANLFRKM MEII NK                            +++WKKVHVIYSFF+VRK+VAH+VTFIFYCV+LPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRS HLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA KSKA   A +        R++  +                         RLH+LEL  GAYLFFCGCY VVFGKNHYFIYL+AQAIAFFI+G G VGTIVP S
Sbjct:    1 MERLTSTQMIPDAFQGARDDVTMQFAMIWGQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMGIVIVLVKLFGRKPDRRYKWEPMKDDVEAGNSTYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDMVELECQRWASKGINIKYEVRDSRNGYKSGALKEGMKRSYVKSCDYVAIFDADFQPEPDFLRRTIPFLVHNPELGLVQTRWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWEFLYLSSVKVKNELPSTLKAYRYQQHRWSCGPANLFRKMFMEIITNKA---------------------------MTSWKKVHVIYSFFLVRKIVAHLVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDALKSKANKAAKK-------PRFRFGE-------------------------RLHLLELGTGAYLFFCGCYDVVFGKNHYFIYLYAQAIAFFIVGLGCVGTIVPRS 532          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
CSLA9_ARATH0.000e+074.75Glucomannan 4-beta-mannosyltransferase 9 OS=Arabid... [more]
CSLA2_ARATH0.000e+066.33Glucomannan 4-beta-mannosyltransferase 2 OS=Arabid... [more]
CSLA9_ORYSJ0.000e+065.74Probable mannan synthase 9 OS=Oryza sativa subsp. ... [more]
CSLA1_ORYSJ0.000e+066.67Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza ... [more]
CSLA3_ARATH0.000e+061.62Probable mannan synthase 3 OS=Arabidopsis thaliana... [more]
CSLA1_CYATE0.000e+058.88Mannan synthase 1 OS=Cyamopsis tetragonoloba GN=Ma... [more]
CSLAF_ARATH0.000e+056.45Probable mannan synthase 15 OS=Arabidopsis thalian... [more]
CSLA7_ARATH0.000e+058.96Probable mannan synthase 7 OS=Arabidopsis thaliana... [more]
CSLAA_ARATH0.000e+057.91Probable mannan synthase 10 OS=Arabidopsis thalian... [more]
CSLA1_ARATH0.000e+055.67Probable mannan synthase 1 OS=Arabidopsis thaliana... [more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092622 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2NSA3_GOSRA0.000e+089.27Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0P923_GOSAR0.000e+088.59Glucomannan 4-beta-mannosyltransferase 9-like prot... [more]
A0A061EUM7_THECC0.000e+084.09Nucleotide-diphospho-sugar transferases superfamil... [more]
A0A067LFA8_JATCU0.000e+079.36Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
A0A059DFA7_EUCGR0.000e+077.66Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]
A0A059DFS3_EUCGR0.000e+077.50Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]
D7TJ10_VITVI0.000e+077.29Putative uncharacterized protein OS=Vitis vinifera... [more]
L7Z9A7_EUCCD0.000e+076.99CSLA9-like protein OS=Eucalyptus cladocalyx PE=4 S... [more]
M1CQQ4_SOLTU0.000e+076.48Uncharacterized protein OS=Solanum tuberosum GN=PG... [more]
U5G6I8_POPTR0.000e+077.33Uncharacterized protein OS=Populus trichocarpa GN=... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029044Nucleotide-diphospho-sugar transferasesGENE3D3.90.550.10coord: 119..340
e-value: 1.5E-24
score: 86.2
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILY53448Nucleotide-diphospho-sugar transferasescoord: 119..363
NoneNo IPR availablePFAMPF13641Glyco_tranf_2_3coord: 120..354
e-value: 6.9E-22
score: 78.4
NoneNo IPR availablePANTHERPTHR32044FAMILY NOT NAMEDcoord: 31..371
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..20
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 65..91
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 21..64
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..3
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 4..15
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 92..381
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 16..20
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 2..24

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092622 ID=g.barbadense_cottongen_reftransV1_0092622|Name=g.barbadense_cottongen_reftransV1_0092622|organism=Gossypium barbadense|type=contig|length=2774bp
TTTTTTTTGAGCACTCATTTTTCAACTTGTTCATTGTCCTCCCACTCTGC
CTCTGTTTTTCTTCCAAATAACAGAGGGTCTAGTTGGAATAAGAAAATTA
TATGCTATGTACATTTCTGCAAATTAGTGTGGGTTTTTGAACCACTTAAG
CTCTGCTTTCATTGCTTCTGGTTCAAGCAAAAAACCAACAAAGATTCCAT
CTCTTTTTCCAATGGATGTACTTTAAATCTAAACAGATCTAGTGGGTTGT
TTTCAAAATCTGTTTTTGTTAGTTGTTCTTTGTTCTTTCCTTCTTTTTCC
TGTTTTGTTTCTTTTACAATTTAGTCCTCCCCTGTTTTTTTTTTCCCAAA
ATGGATCAGTTTCCTTCAACAACTATCTTCCCCGACACAACCGATGATTT
GTCGATGCAAATGGCAGTGATTTGGGGCCAAATCAAAGCACCATTGATCG
TGCCATTGTTGAAACTCGCCGTCGTGGTTTGTTTGATAATGTCTGTAATG
CTTTTTATTGAAAGAGTTTATATGGGGATAGTCATTGCTTTGGTCAAACT
GTTTGGTCGGAAACCAGACAAAAGGTTTAAATGGGAAGCCATTAAAGATG
ATGTCGAGTTGGGGAACTCAGCTTATCCTATGGTTCTGGTTCAAATCCCA
ATGTATAATGAAAGAGAGGTTTATCAACTGTCCATTGGAGCTGCATGTGG
CCTCTCATGGCCTTCTGATCGGATCGTTATTCAAGTCCTTGATGACTCAA
CTGACCCAACAATTAAGGATATGGTGGAATTAGAGTGTCAAAGATGGGCA
AGCAAAGGGATCAACATCAAGTATGAAATAAGGGACAATAGGAATGGATA
CAAAGCAGGGGCTTTAAAAGAAGGCATGAAACACAGTTATGTGAAACACT
GTGACTATGTTGTCATTTTCGATGCTGATTTCCAGCCCGAACCTGATTTC
CTTTGGCGAACCATTCCTTTCCTCGTTCACAACCCTGAATTAGCTTTGGT
TCAAGCTCGTTGGAAATTCGTGAATGCAGATGAATGTTTGATGACAAGGA
TGCAAGAAATGTCATTAGATTACCATTTTACTGTTGAACAAGAAGTGGGG
TCTTCCACCTATTCGTTCTTTGGCTTCAATGGAACTGCTGGTGTATGGAG
GATTAGTGCTTTGAATGAAGCCGGTGGATGGAAAGATCGAACCACGGTCG
AGGACATGGATTTAGCTGTTCGAGCTAGTCTCAAAGGATGGAAATTCCTT
TACCTTGGTAGCCTAAAGGTGAAAAATGAATTGCCGAGTACATTGAAAGC
GTATCGGTACCAACAGCATCGATGGTCTTGTGGTCCGGCTAACCTTTTCA
GGAAAATGGTCATGGAGATCATTAAAAACAAGGTAAAATCGATTCGTGAA
ACAAGTTATAAGTGCTAGGAATTTGTTGAATCGGTCATTGATTGTTTCGT
AATATCGTTGCAGAAAGTTTCGACATGGAAGAAAGTACATGTAATTTACA
GCTTCTTTGTGGTCAGAAAGCTTGTTGCCCACATTGTTACATTCATTTTT
TACTGTGTTATTTTACCTGCAACTGTACTTGTGCCTGAAGTTGAGGTTCC
AAAGTGGGGAGCTGTTTATATTCCTTCTATCATTACCATTCTCAATGCTG
TCGGAACTCCGAGGTCATTTCACTTACTGGTTTTTTGGATCCTTTTTGAA
AACGTCATGTCGTTGCATCGAACTAAGGCTACCTTCATCGGCTTATTAGA
GGCTGGTAGAGTAAACGAATGGATCGTCACTGAGAAACTCGGGGATGCTC
ACAAGTCTAAAGCAGCTGCAAAAGCACCCCGAAAACCCCGTTTCCGGTTC
GGAGAAAGGTATAAAGTCTATCAAATTGAATCTGCTATTACAAGTTTGCA
ACCTTAACTTGTTATTCAATGCCTTCTCATCTAACAATCGAATGTTGGCA
GACTCCATGTGTTAGAGCTAAGCGTCGGAGCTTATCTATTCTTCTGCGGC
TGCTACGCCGTCGTGTTCGGTAAAAACCATTACTTCATATACCTTTTTGC
ACAAGCAATCGCCTTCTTCATCATGGGATTCGGATATGTTGGCACCATCG
TCCCCAACTCGTAATGCAACTCCTTAAATTAGTCCATAGTGGCCATTATC
ATCATCTCCGGTGTAATTCTTTTGGCTACTAATGCCATCAACAGGTGATT
ATGTGGTGATTATAACAACATTTCCTTGCAATTTTTAGCTTTATGTAAAA
AAAAAAAACAAAAATCTAAAAAGGGTTATTCTTTTAAGGTTGAGCATAAG
ATTTTTTTTTTCGAGTTCGATAACTCGAAAAAAAAAAGTTAGTTATCTTT
GTGAATATCCAAGAAAATTAAGGGAAATACAGAAACATATGTTGTAATGG
TAATGCATATGCATCATACAGAGAATTATAAGGAGCTAATGGAAGGTTGT
TTCTGGGTTTTGACCCCCAAAATAGACAATATAGAGAAGATTTTGGAGTG
AATTGTTTGCATTTTTTTTCTATTTGTAGCTTTTTTTTCTTCTTTTTTTT
TTTTGCGGTGGTTGGGTTTGACCTTTTTAACGGAGAGGAAAAATACAGGG
GAGAAGAAAAGACGGTTCTTTGCCTTCTATGTTAAATGTTAATTGCGGTG
TAAGCAAAGCAAAACGGATAAATTTCAGATCAGTGGACAATGTTTTCTGA
AGTGCTCAATTAGGTTCTTCTCGGTCAAATGGATTTGGTTGATAGGTTAT
CTGCTAATTTGAGTTGTTTTTGAA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR029044Nucleotide-diphossugar_trans