g.barbadense_cottongen_reftransV1_0092607, g.barbadense_cottongen_reftransV1_0092607 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092607
Unique Nameg.barbadense_cottongen_reftransV1_0092607
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2730
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: QKIL3_ARATH (KH domain-containing protein At2g38610 OS=Arabidopsis thaliana GN=At2g38610 PE=1 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 3.322e-124
Identity = 131/157 (83.44%), Postives = 143/157 (91.08%), Query Frame = -2
Query: 2052 MSGLYN--SNFSPARAASPQIRTTPDVDS-QYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYN  S FSPARAASPQIR+TP++DS QYL+ELLAEHQKL PFMQVLPICSRLLNQE+FRVSGMM+NQGFGDFDRLRHRSP PMASSNLMSNVS TGLGGWN L+QERLSG PGMTMDWQGAP SPSSYTVKRILRLEIPVD YP+ + + ++L
Sbjct:    1 MSGLYNNSSYFSPARAASPQIRSTPEIDSSQYLTELLAEHQKLTPFMQVLPICSRLLNQEMFRVSGMMSNQGFGDFDRLRHRSPSPMASSNLMSNVSNTGLGGWNGLSQERLSGTPGMTMDWQGAPGSPSSYTVKRILRLEIPVDNYPNFNFVGRLL 157          

HSP 2 Score: 199.904 bits (507), Expect = 3.322e-124
Identity = 96/105 (91.43%), Postives = 104/105 (99.05%), Query Frame = -1
Query: 1636 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAML 1950
            FNFVGRLLGPRGNSLKRVEATTGCRV+IRGKGSIKDP+KE+KLRGRPGYEHLN+ LHILIEADLPA++V+IRLRQAQEIIEELLKPVDESQDFIKRQQLRELA+L
Sbjct:  150 FNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDPEKEDKLRGRPGYEHLNEQLHILIEADLPASIVEIRLRQAQEIIEELLKPVDESQDFIKRQQLRELALL 254          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: QKIL4_ARATH (KH domain-containing protein At3g08620 OS=Arabidopsis thaliana GN=At3g08620 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.411e-113
Identity = 122/156 (78.21%), Postives = 138/156 (88.46%), Query Frame = -2
Query: 2052 MSGLYN-SNFSPARAASPQIRT-TPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYN +NFSP+RAASPQIRT + DVDSQY+S+LLAEHQKLGPFMQVLPICSRLLNQEIFR++GMM NQGF DFDRLRHRSP PMAS NLMSNVSG GLGGWN L  ER+ GP GM M+WQGAPASPSSY VKRILRL++PVDTYP+ + + ++L
Sbjct:    1 MSGLYNYNNFSPSRAASPQIRTPSSDVDSQYISQLLAEHQKLGPFMQVLPICSRLLNQEIFRITGMMPNQGFTDFDRLRHRSPSPMASPNLMSNVSGGGLGGWNGLPPERIGGPHGMAMEWQGAPASPSSYPVKRILRLDLPVDTYPNFNFVGRLL 156          

HSP 2 Score: 202.216 bits (513), Expect = 1.411e-113
Identity = 117/134 (87.31%), Postives = 128/134 (95.52%), Query Frame = -1
Query: 1549 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTG 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP+KEEKL+G+PGYEHLN+ LHILIEADLP ++VDI+LRQAQEIIEEL+KPVDESQD+IKRQQLRELA+LNSN  E SPGPSGSVSPFNS+ MKRPKTG
Sbjct:  149 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLKGKPGYEHLNEQLHILIEADLPIDIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLRENSPGPSGSVSPFNSNAMKRPKTG 282          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: SPIN1_ORYSJ (KH domain-containing protein SPIN1 OS=Oryza sativa subsp. japonica GN=SPIN1 PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.646e-100
Identity = 104/155 (67.10%), Postives = 123/155 (79.35%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTP-DVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLY+  FSPAR  SPQIR+ P DVDSQYL+ELLAEHQKLGPFMQVLPICS+LL+QEI RVS ++ N GFGDFDR R RSP PM+S N  SN SG G   WN L QERL  P G +MDWQGAP SPSS+ VK+ILRL++PVD+YP+ + + ++L
Sbjct:    1 MSGLYSPGFSPARNLSPQIRSNPTDVDSQYLAELLAEHQKLGPFMQVLPICSKLLSQEIMRVSSIVHNHGFGDFDRHRFRSPSPMSSPNPRSNRSGNGFSPWNGLHQERLGFPQGTSMDWQGAPPSPSSHVVKKILRLDVPVDSYPNFNFVGRIL 155          

HSP 2 Score: 191.43 bits (485), Expect = 5.646e-100
Identity = 89/105 (84.76%), Postives = 100/105 (95.24%), Query Frame = -1
Query: 1636 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAML 1950
            FNFVGR+LGPRGNSLKRVEA+TGCRV+IRGKGSIKDP KE+KLRG+PGYEHL+DPLHILIEA+ PA+++D RLR AQE+IEELLKPVDESQDF KRQQLRELAML
Sbjct:  148 FNFVGRILGPRGNSLKRVEASTGCRVFIRGKGSIKDPGKEDKLRGKPGYEHLSDPLHILIEAEFPASIIDARLRHAQEVIEELLKPVDESQDFYKRQQLRELAML 252          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: QKIL2_ARATH (KH domain-containing protein At5g56140 OS=Arabidopsis thaliana GN=At5g56140 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.497e-60
Identity = 93/133 (69.92%), Postives = 111/133 (83.46%), Query Frame = -1
Query: 1552 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKT 1950
            FNFVGRLLGPRGNSLKRVEA+T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLHIL+EA+LP  +VD RL QA+EI+++LL P++E+ D  K+QQLRELA+LN    EE    SGSVSP+NS GMKR KT
Sbjct:  180 FNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPMEETHDMYKKQQLRELALLNGTLREEGSPMSGSVSPYNSLGMKRAKT 312          

HSP 2 Score: 89.3521 bits (220), Expect = 5.497e-60
Identity = 51/127 (40.16%), Postives = 69/127 (54.33%), Query Frame = -2
Query: 2052 QYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2432
            +YLSELLAE  KL PF+ VLP   RLLNQEI RV+ ++ N        L H  P P+AS  +  N     + GW S      S P     +W  +P S S    KR +R++IPVD YP+ + + ++L
Sbjct:   64 KYLSELLAERHKLTPFLPVLPHAFRLLNQEILRVTTLLENATVLSQSGLDH--PSPLASGGIFQNARAD-MNGWASQFPSERSVPSSPGPNWLNSPGSSSGLIAKRTIRVDIPVDNYPNFNFVGRLL 187          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: QKIL1_ARATH (KH domain-containing protein At4g26480 OS=Arabidopsis thaliana GN=At4g26480 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 7.725e-60
Identity = 76/105 (72.38%), Postives = 94/105 (89.52%), Query Frame = -1
Query: 1636 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAML 1950
            +NFVGRLLGPRGNSLKRVEA+T CRV IRG+GSIKDP KE+ +RG+PGYEHLN+PLHIL+EA+LP  +VD RL QA+EI+++LL PV+E+ DF K+QQLRELA+L
Sbjct:  174 YNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMRGKPGYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPVEETHDFYKKQQLRELALL 278          

HSP 2 Score: 88.1965 bits (217), Expect = 7.725e-60
Identity = 50/127 (39.37%), Postives = 70/127 (55.12%), Query Frame = -2
Query: 2052 QYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2432
            +YLSELLAE  KL PF+ VLP   RL+NQEI RV+ ++ N       + R   P P+AS  +  N S   + GW S      S       +W  +P S S   VKR +R++IPVD YP+ + + ++L
Sbjct:   60 KYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA----LSQSRFDHPSPLASGGIFQN-SRADMNGWASQFPSERSVSSSPAPNWLNSPGSSSGLIVKRTIRVDIPVDKYPNYNFVGRLL 181          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: QKIL5_ARATH (KH domain-containing protein At1g09660/At1g09670 OS=Arabidopsis thaliana GN=At1g09660 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 2.174e-55
Identity = 69/105 (65.71%), Postives = 87/105 (82.86%), Query Frame = -1
Query: 1636 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAML 1950
            +NFVGR+LGPRGNSLKRVE  T CRV+IRG+GS+KD  KEEKL+G+PGYEHL +PLH+LIEA+LP ++++ RL  A   +E LLKP+DES D  KR+QL+ELA L
Sbjct:  161 YNFVGRILGPRGNSLKRVELATHCRVFIRGRGSVKDTVKEEKLKGKPGYEHLCEPLHVLIEAELPEDIINSRLEHAVHFLESLLKPMDESMDHYKREQLKELAAL 265          

HSP 2 Score: 90.5077 bits (223), Expect = 2.174e-55
Identity = 60/151 (39.74%), Postives = 79/151 (52.32%), Query Frame = -2
Query: 2052 ASPQIRTTPDVDSQ-YLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGT-GLGGWNSLTQER---------LSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2471
            ASP     P  D + YL+ELL E QKLGPF+QV+P C RLLN EI RVS       F D DR  H SP      +L    +G   L GW+ +  E            GP    + W G P  P+   VK+++RL++PVD YPS + + ++L
Sbjct:   30 ASPNRSPCPPSDRERYLTELLQERQKLGPFLQVMPNCCRLLNHEIRRVS------SFPDLDRYEHGSP----FRSLGQPTNGKLDLEGWSMMQAEENCHLQRASPFRGP--SPVGWIGMPGLPNPPIVKKVIRLDVPVDKYPSYNFVGRIL 168          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: QKIB_DANRE (Protein quaking-B OS=Danio rerio GN=qkib PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.067e-26
Identity = 54/105 (51.43%), Postives = 80/105 (76.19%), Query Frame = -1
Query: 1636 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAML 1950
            FNFVGR+LGPRG + K++EA TGC++ +RGKGS++D  KEE+ RG+P +EHLN+ LH+LI  +   N  +I+L++A E +++LL P  E +D +K+ QL ELA+L
Sbjct:   96 FNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAIL 200          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: QKIB_XENLA (Protein quaking-B OS=Xenopus laevis GN=qki-b PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.393e-26
Identity = 54/105 (51.43%), Postives = 80/105 (76.19%), Query Frame = -1
Query: 1636 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAML 1950
            FNFVGR+LGPRG + K++EA TGC++ +RGKGS++D  KEE+ RG+P +EHLN+ LH+LI  +   N  +I+L++A E +++LL P  E +D +K+ QL ELA+L
Sbjct:   97 FNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAIL 201          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: QKI_PIG (Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.844e-26
Identity = 54/105 (51.43%), Postives = 80/105 (76.19%), Query Frame = -1
Query: 1636 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAML 1950
            FNFVGR+LGPRG + K++EA TGC++ +RGKGS++D  KEE+ RG+P +EHLN+ LH+LI  +   N  +I+L++A E +++LL P  E +D +K+ QL ELA+L
Sbjct:   96 FNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAIL 200          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Match: QKI_MOUSE (Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.844e-26
Identity = 54/105 (51.43%), Postives = 80/105 (76.19%), Query Frame = -1
Query: 1636 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAML 1950
            FNFVGR+LGPRG + K++EA TGC++ +RGKGS++D  KEE+ RG+P +EHLN+ LH+LI  +   N  +I+L++A E +++LL P  E +D +K+ QL ELA+L
Sbjct:   96 FNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAIL 200          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: A0A0B0PD94_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_31230 PE=4 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.212e-138
Identity = 145/154 (94.16%), Postives = 150/154 (97.40%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSP PMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPSPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLL 154          

HSP 2 Score: 219.55 bits (558), Expect = 1.212e-138
Identity = 130/134 (97.01%), Postives = 132/134 (98.51%), Query Frame = -1
Query: 1549 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTG 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPAN+VD RLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNF E+SPGPSGSVSPFNSSGMKRPKTG
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVDTRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSSGMKRPKTG 280          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: A0A0D2UT88_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G125700 PE=4 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 5.839e-138
Identity = 144/154 (93.51%), Postives = 149/154 (96.75%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGD DRLRHRSP PMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDLDRLRHRSPSPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLL 154          

HSP 2 Score: 219.55 bits (558), Expect = 5.839e-138
Identity = 130/134 (97.01%), Postives = 132/134 (98.51%), Query Frame = -1
Query: 1549 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTG 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPAN+VD RLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNF E+SPGPSGSVSPFNSSGMKRPKTG
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVDTRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSSGMKRPKTG 280          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: A0A061EIY7_THECC (RNA-binding KH domain-containing protein OS=Theobroma cacao GN=TCM_019653 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 5.172e-136
Identity = 139/154 (90.26%), Postives = 148/154 (96.10%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYN NFSPARAASPQIR+TPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMM+NQGFGDFDR+RHRSP PMASSNL+SNVSGTGLGGWNSL QERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYNPNFSPARAASPQIRSTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMSNQGFGDFDRMRHRSPSPMASSNLISNVSGTGLGGWNSLPQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLL 154          

HSP 2 Score: 221.09 bits (562), Expect = 5.172e-136
Identity = 132/134 (98.51%), Postives = 133/134 (99.25%), Query Frame = -1
Query: 1549 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTG 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPAN+VDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNF EESPGPSGSVSPFNSSGMKRPKTG
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNSSGMKRPKTG 280          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: A0A0B0NLG2_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_20322 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 2.686e-135
Identity = 136/154 (88.31%), Postives = 147/154 (95.45%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYNSNFSPARAASPQIR+TP+V+SQYLSELLAEHQKLGPF+QVLPICSRLLNQEIFRVSGMM+NQGFGDFDRLRHRSP PMASSNLMSNV GTGLG WNSL QERLSGPPG+TMDWQGAPASPSSYTVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYNSNFSPARAASPQIRSTPEVESQYLSELLAEHQKLGPFLQVLPICSRLLNQEIFRVSGMMSNQGFGDFDRLRHRSPSPMASSNLMSNVYGTGLGSWNSLPQERLSGPPGVTMDWQGAPASPSSYTVKRILRLEIPVDTYPTFNFVGRLL 154          

HSP 2 Score: 224.942 bits (572), Expect = 2.686e-135
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = -1
Query: 1546 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTGY 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNF EESPGPSGSVSPFNSSGMKRPKTGY
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNSSGMKRPKTGY 281          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: A0A0D2UYJ5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G352600 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 2.686e-135
Identity = 136/154 (88.31%), Postives = 147/154 (95.45%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYNSNFSPARAASPQIR+TP+V+SQYLSELLAEHQKLGPF+QVLPICSRLLNQEIFRVSGMM+NQGFGDFDRLRHRSP PMASSNLMSNV GTGLG WNSL QERLSGPPG+TMDWQGAPASPSSYTVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYNSNFSPARAASPQIRSTPEVESQYLSELLAEHQKLGPFLQVLPICSRLLNQEIFRVSGMMSNQGFGDFDRLRHRSPSPMASSNLMSNVYGTGLGSWNSLPQERLSGPPGVTMDWQGAPASPSSYTVKRILRLEIPVDTYPTFNFVGRLL 154          

HSP 2 Score: 224.942 bits (572), Expect = 2.686e-135
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = -1
Query: 1546 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTGY 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNF EESPGPSGSVSPFNSSGMKRPKTGY
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNSSGMKRPKTGY 281          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: A0A067JPA7_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_00627 PE=4 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 2.439e-133
Identity = 137/154 (88.96%), Postives = 145/154 (94.16%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLY+ NFSPARAASPQIR+TPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMM+NQGFGDFDRLRHRSP PMASSNLMSNV GTGLG WN L QERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYDPNFSPARAASPQIRSTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMSNQGFGDFDRLRHRSPSPMASSNLMSNVGGTGLGSWNGLPQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLL 154          

HSP 2 Score: 216.468 bits (550), Expect = 2.439e-133
Identity = 129/134 (96.27%), Postives = 132/134 (98.51%), Query Frame = -1
Query: 1549 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTG 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPAN+VD+RLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNF EESPGPSGSVSPFN+SGMKR KTG
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVDMRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTSGMKRAKTG 280          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: B9MTT7_POPTR (KH domain-containing family protein OS=Populus trichocarpa GN=POPTR_0006s11210g PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 6.898e-133
Identity = 135/154 (87.66%), Postives = 144/154 (93.51%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYN NFSPARAASPQIR+TPDVDSQYLSELLAEHQKLGPFMQVLP CSRLLNQEIFRVSGMM+NQGFGDFDRLRHRSP PMASSNL+SNV GTGL GWN + QERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYNPNFSPARAASPQIRSTPDVDSQYLSELLAEHQKLGPFMQVLPTCSRLLNQEIFRVSGMMSNQGFGDFDRLRHRSPSPMASSNLLSNVGGTGLSGWNGIPQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLL 154          

HSP 2 Score: 218.009 bits (554), Expect = 6.898e-133
Identity = 130/134 (97.01%), Postives = 132/134 (98.51%), Query Frame = -1
Query: 1549 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTG 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPAN+VDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNF EESPGPSGSVSPFN+SGMKR KTG
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTSGMKRAKTG 280          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: B9T0N9_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0126290 PE=4 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 2.294e-132
Identity = 138/154 (89.61%), Postives = 145/154 (94.16%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYN NFSPARAASPQIR+TPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMM+NQGFGDFDRLRHRSP PMASSNLMSNVSGTGLG WN L QERLSGPPGMTMDWQ APASPSSYTVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYNPNFSPARAASPQIRSTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMSNQGFGDFDRLRHRSPSPMASSNLMSNVSGTGLGSWNGLPQERLSGPPGMTMDWQSAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLL 154          

HSP 2 Score: 211.846 bits (538), Expect = 2.294e-132
Identity = 125/133 (93.98%), Postives = 130/133 (97.74%), Query Frame = -1
Query: 1552 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKT 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPAN+V++RLRQAQEII ELLKPVDESQDFIKRQQLRELAMLNSNF E+SPGPSGSVSPFN+SGMKR KT
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVEMRLRQAQEIIGELLKPVDESQDFIKRQQLRELAMLNSNFREDSPGPSGSVSPFNTSGMKRAKT 279          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: M5WJA4_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa009701mg PE=4 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 7.698e-132
Identity = 135/154 (87.66%), Postives = 144/154 (93.51%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYN NFSPARAASPQIR+TPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEI RVSGMM+NQGFGDFDR+RHRSP PMASSNLMSNV+GTGLGGWN L QERL GP GMTMDWQGAPASPSSYTVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYNPNFSPARAASPQIRSTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMMSNQGFGDFDRMRHRSPSPMASSNLMSNVTGTGLGGWNGLPQERLGGPHGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLL 154          

HSP 2 Score: 214.927 bits (546), Expect = 7.698e-132
Identity = 130/134 (97.01%), Postives = 132/134 (98.51%), Query Frame = -1
Query: 1549 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTG 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLN+PLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELA+LNSNF EESPGPSGSVSPFNSSGMKR KTG
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNSSGMKRAKTG 280          
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Match: I1N3C0_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 4.166e-131
Identity = 134/154 (87.01%), Postives = 144/154 (93.51%), Query Frame = -2
Query: 2052 MSGLYNSNFSPARAASPQIRTTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPGPMASSNLMSNVSGTGLGGWNSLTQERLSGPPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYPSVSCIWKML 2513
            MSGLYN NFSPARAASPQIR+ P+VDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEI RVSGM++NQGFGDFDRLRHRSP PMASSNLMSNVSGTGLGGWNSL QERL GPPGMTMDWQ APASPSS+TVKRILRLEIPVDTYP+ + + ++L
Sbjct:    1 MSGLYNPNFSPARAASPQIRSNPEVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMLSNQGFGDFDRLRHRSPSPMASSNLMSNVSGTGLGGWNSLQQERLCGPPGMTMDWQSAPASPSSFTVKRILRLEIPVDTYPNFNFVGRLL 154          

HSP 2 Score: 213.772 bits (543), Expect = 4.166e-131
Identity = 129/134 (96.27%), Postives = 132/134 (98.51%), Query Frame = -1
Query: 1549 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVDIRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLXXXXXXXXXXXXXXXXXXXXXGMKRPKTG 1950
            FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLN+PLHILIEA+LPANVVDIRLRQAQEIIEELLKPVDESQD+IKRQQLRELAMLNSNF EESPGPSGSVSPFNSSGMKR KTG
Sbjct:  147 FNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEAELPANVVDIRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREESPGPSGSVSPFNSSGMKRAKTG 280          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
QKIL3_ARATH3.322e-12483.44KH domain-containing protein At2g38610 OS=Arabidop... [more]
QKIL4_ARATH1.411e-11378.21KH domain-containing protein At3g08620 OS=Arabidop... [more]
SPIN1_ORYSJ5.646e-10067.10KH domain-containing protein SPIN1 OS=Oryza sativa... [more]
QKIL2_ARATH5.497e-6069.92KH domain-containing protein At5g56140 OS=Arabidop... [more]
QKIL1_ARATH7.725e-6072.38KH domain-containing protein At4g26480 OS=Arabidop... [more]
QKIL5_ARATH2.174e-5565.71KH domain-containing protein At1g09660/At1g09670 O... [more]
QKIB_DANRE1.067e-2651.43Protein quaking-B OS=Danio rerio GN=qkib PE=2 SV=1[more]
QKIB_XENLA1.393e-2651.43Protein quaking-B OS=Xenopus laevis GN=qki-b PE=1 ... [more]
QKI_PIG1.844e-2651.43Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1[more]
QKI_MOUSE1.844e-2651.43Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1[more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092607 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PD94_GOSAR1.212e-13894.16Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2UT88_GOSRA5.839e-13893.51Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061EIY7_THECC5.172e-13690.26RNA-binding KH domain-containing protein OS=Theobr... [more]
A0A0B0NLG2_GOSAR2.686e-13588.31Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2UYJ5_GOSRA2.686e-13588.31Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A067JPA7_JATCU2.439e-13388.96Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
B9MTT7_POPTR6.898e-13387.66KH domain-containing family protein OS=Populus tri... [more]
B9T0N9_RICCO2.294e-13289.61Putative uncharacterized protein OS=Ricinus commun... [more]
M5WJA4_PRUPE7.698e-13287.66Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
I1N3C0_SOYBN4.166e-13187.01Uncharacterized protein OS=Glycine max PE=4 SV=1[more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032377STAR protein, homodimerisation regionPFAMPF16544STAR_dimercoord: 23..71
e-value: 4.2E-14
score: 51.7
NoneNo IPR availablePANTHERPTHR11208RNA-BINDING PROTEIN RELATEDcoord: 1..145
NoneNo IPR availablePANTHERPTHR11208:SF59SUBFAMILY NOT NAMEDcoord: 1..145

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092607 ID=g.barbadense_cottongen_reftransV1_0092607|Name=g.barbadense_cottongen_reftransV1_0092607|organism=Gossypium barbadense|type=contig|length=2730bp
CTCTATATTTTTTGAGTTTTTATTTTATTTTCTTTTCTTTCATTTTTCAA
CTCTAACATACAGTCAGTGGATCAGAAGAAATTTATTTTTTCTTTTAATT
TTTCCTACCAAAAAAATTTATTTTACATATTTTTATTTTTCTACCCTTCA
ATTTTTCATCCATCCATTTCTTTTTCCACTCTACTAAGTAAAGCATTCAG
CTATAGATAAAACTTGTATCCAAAATGCTACAGTCCAATTCAAGTAAAAA
TTCAATATCAACATCAATCCTGATACTTTATAGATACAGCCAATTATAAA
AGGATTCAAGTTTCAAGGGCAGGCTTTTAGCATCATTGAATAAACTATCA
CATTGCTAGTTTTCTATTTAGGTTAAATTATTATATTAGTCCCTGTACTT
TACAAAAGTTGTGAATTTATAGTCCCTACACTTTTCAAATTTTAAAATTT
CAGTCACCAAACGATAACTATTAAATTCATTAATTTATGTTTTACTATTT
CCAAAATTTGATGGGACAAACATATTATCATATGTTAACGCACTAAAAAT
CCAGTTAATTGTTTAATGATTGTGATTTATGTTAAGACTAAAATTTTAAA
ATTCGAGAAGAATAGAAACCTAGAATGATCCCAGGGGAGAATATGAACTA
AATCTATAATGGTATGCATAGTACAGACTAGCAATTGAATTTAACTAATC
GGATTTATCTGCAACTTGTACTAAAATTGACCAATTCAAAAAGTAAAAGC
TTAAGAGTACAAAAACTAAATCCACAATTTACATATGGTATAGGGACTAA
TAACATAATTTGACCTATATTTTAACATAGGTAAAAGTGCAAGAGGAAAA
GTAGATAAGATAACCTCCATTGACAAAAGTTCCCAAGGGACAGATCTTTG
AGAATCTTGAATAAATTTACTTCATTGAAGCTATAAAGATACAAATTCCA
TCTGACCACTAAGGGAGGCTTTGAAATGCTTATGCAGGGATAATAACAAT
AATAATAATCTAAATAAAATTTTAACCAACATAAAACGACTGAGAGAGAA
GATGAAGATTCATATGCTAGTATATTGTAGGTCCAACTTAACATTGCTAT
GCTTCTTTCATATAAACTACAAAAGAAAGGAAAGGAGACAAGCAACGGAA
CAACAAATATGACACACCTACAAAACTCAAATCGACCACACCAGGCCTAA
TACTAGCAACATATATATATTCCACACTCCTCAAAGCTCTGCTAACACAA
GAATAAATCCAATGAATGTATTGAGTTTACAGGAAAACTGACCTCACAGA
ACCTAAACTTGAGAGCCATCTATATATTTCTTTTTCTTTGTTCATTTTTG
TTCCTCTTTAGTCCGAAGAGCAAAACAAATTAATAATGAAAAGCCCATCA
GAAAAAGCTCACCAGCAAAAACAGTTAACCTAATATTTTCAAGCTGTGCT
GAATTGATCTGTATCAGAATTCAGAAGGTATACTTTGGCTAAGAAATTCT
GGAGCACGTTGGATCATTTTCAGATGATTTATGGTTAAACTCTCAGTATC
CTGTTTTGGGGCGCTTCATTCCACTGGAATTAAAAGGAGAAACACTACCA
CTTGGACCAGGACTCTCCTCACTGAAATTTGAATTTAGCATTGCCAGTTC
ACGTAGTTGCTGCCTCTTAATAAAATCTTGCGACTCATCCACAGGTTTGA
GTAATTCTTCTATGATTTCCTGCGCCTGTCTAAGCCTTATATCAACAACA
TTAGCAGGTAAATCAGCCTCAATCAAGATGTGGAGAGGATCATTCAGGTG
CTCATATCCAGGCCGACCTCTCAGCTTCTCTTCCTTGTCCGGATCCTTTA
TTGATCCTTTTCCTCTAATGTACACACGGCAGCCAGTAGTAGCTTCCACC
CGCTTTAATGAATTTCCTCTAGGGCCTAGAAGTCGTCCAACAAAATTGAA
CTAACAAGGAAAGACAGACTCTAAACCTCAATACTCACAAAAGAGTTTTC
ATTCAATTGAAATATGAAAAATATAATCAAACAAAACTTAATCTAATGCA
CTAGCATTTTCCATATACAGCTTACGCTTGGATATGTATCAACAGGAATT
TCAAGACGCAAAATCCTCTTCACAGTGTATGAACTAGGGCTTGCTGGGGC
ACCTTGCCAGTCCATTGTCATCCCAGGTGGCCCACTTAGTCTCTCTTGGG
TAAGACTATTCCAGCCGCCCAATCCGGTGCCAGAAACATTTGACATAAGG
TTTGAAGAAGCCATGGGACCGGGGCTTCTATGCCTCAACCGGTCAAAGTC
GCCAAATCCTTGGTTGGCCATCATTCCCGAGACTCGAAATATCTCTTGAT
TTAACAGCCGGCTGCATATAGGAAGGACTTGCATGAAAGGTCCAAGCTTT
TGATGCTCTGCCAACAGTTCTGATAAGTACTGACTGTCAACATCTGGAGT
GGTTCTGATCTGTGGAGAAGCAGCTCTAGCAGGAGAAAAGTTGGAGTTAT
ACAGACCTGACATAGCTTTGCCTTTTGATTTGGGGGATTCAATTCTTTTC
TTTTTTTAAATAAAATGAAAAAATTTTAGTTTTTGAAGAGAAAAAAAATC
AAGTTTGAGCTTCTGGCAGAGAAGAAAGAAGAAAAACACAACACCAAGAG
GGGTGTAATAGGAGGCAACAATATATTTATATATAAAAATGATAAAAAAA
TATTATAAAAAAAAGAAAAAAGAAAAAGAA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR032377STAR_dimer