g.barbadense_cottongen_reftransV1_0092533, g.barbadense_cottongen_reftransV1_0092533 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092533
Unique Nameg.barbadense_cottongen_reftransV1_0092533
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2170
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy Swiss-Prot
Match: C3H41_ARATH (Zinc finger CCCH domain-containing protein 41 OS=Arabidopsis thaliana GN=At3g27700 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.119e-27
Identity = 103/256 (40.23%), Postives = 147/256 (57.42%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTAS-------VIPAQRKDYFQPI-----------PLNSPKPH----SMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGDT--EQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSPKSK--RQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHI 960
            +FS++EEAE+AL+APDAVMGNRFIKLW ANRD IPD  +++GSG S+  R +TAS       +  A + ++   I           P +S +P     + +G  V P  +KK +TLE++KE LRKKQE+LEQKR ++R++L  LEKQ + VK +   E  AKR K+D A D   A     +        P    ++    STE   + SP SK  +Q   S    ++  ++N+YKLDNR T  +V+ PLP+  A +
Sbjct:  480 QFSKREEAESALRAPDAVMGNRFIKLWWANRDSIPDNGLSTGSGASMKGRSMTASGAQNQFPIAAASKSNHVSSIAKVPTFQTGGAPSSSEQPKPVVVTTSGPKVTPLQQKKADTLERLKETLRKKQEMLEQKRNEYRKKLATLEKQGTVVKREEADEPDAKRVKLDTASDSGAAIASPKTESSTDKKVPILKPLSTAKLSTE---TPSPDSKNFKQRPYSFTTSLNAPMVNRYKLDNRTTTIKVVPPLPTGLADV 732          

HSP 2 Score: 63.929 bits (154), Expect = 4.560e-9
Identity = 33/70 (47.14%), Postives = 45/70 (64.29%), Query Frame = 1
Query: 1396 VDVLKEHFSQYSDLFSVELEDVENEDVMVS-ETLNDC-SAHITYSTCRSAEKAYANSKCWQGHNLQFSWL 1599
            V V+KEHFS Y ++  VELED  + D     ET N+  +A +T+    +AEKA+AN+KCWQ H LQ  W+
Sbjct:  732 VAVVKEHFSSYGEVSKVELEDNASIDSGKDHETQNESRAACVTFVKRSAAEKAFANAKCWQEHTLQLVWV 801          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy Swiss-Prot
Match: C3H27_ORYSJ (Zinc finger CCCH domain-containing protein 27 OS=Oryza sativa subsp. japonica GN=Os04g0394300 PE=2 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 1.248e-15
Identity = 96/267 (35.96%), Postives = 128/267 (47.94%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQRKDYFQPIPLNSPKPHSMN--------------------------GLMVPPA-------PRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGDTEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSPKSKRQSCQSAPVGIH---PFVL---NKYKLDNRPTAFRVISPLPSDFA 954
            +FS++EEAEAALKAPDAVMGNRFIKLW ANRDRIPD          V  R      IPA+       +  + P+P S N                          G  + PA       P  K +   ++ EELRKKQE+L QKR +FRRQL KL KQ  G+    +QA    K   + D  + +  +S         P     T  ++++  + S S KS   S Q   V      P ++   N++KLDNR T+FR++ PLP + A
Sbjct:  501 QFSKREEAEAALKAPDAVMGNRFIKLWWANRDRIPD---------EVEGR------IPAKSSHMSAALANSVPQPSSSNRGKENLQSATPRASSGSSAEASGPGTGHKMLPANSVKSLPPDTKRQESLELLEELRKKQEILAQKRDEFRRQLEKLAKQ-KGLANSAKQAEAGGKEVASNDVHRVTDSKSMNTGTEG--PRDAAGTLQNRTSGELASSSHKSSATSAQKPAVATKQTSPLLVPSQNRFKLDNRTTSFRILPPLPPEIA 749          

HSP 2 Score: 67.0106 bits (162), Expect = 4.212e-10
Identity = 34/71 (47.89%), Postives = 47/71 (66.20%), Query Frame = 1
Query: 1402 VLKEHFSQYSDLFSVELEDVE--NEDVMVSETLNDCSAHITYSTCRSAEKAYANSKCWQGHNLQFSWLISS 1608
            VLK+HF  + +L SV LED E  N D  +  +L+ CSA +TY+T +SAEKA+   K  +GH L+F WL +S
Sbjct:  753 VLKDHFMSFGELSSVVLEDTEAYNHDATLKPSLS-CSACVTYTTRQSAEKAFIGGKSCKGHTLRFMWLTAS 822          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A0B0PH16_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_03537 PE=4 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 2.210e-138
Identity = 235/290 (81.03%), Postives = 246/290 (84.83%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQRKDYFQPIPLNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGDTEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHIGCSLLFLV*GYCFLAPSFVRMKFTMIHHLLYIEKEKMK*AHFANNICLLCSDVRDACVRH 1140
            +FSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDG INSGSGVSVTSRGLTASVIPAQRKDYFQPIPLNSPKPHSMNGLMVPPAPRKKLETLEQMKEELRKKQELLEQKRKDFRRQLHKLEKQSSGVKGDTEQAAKRQKVDIAVDPAKASTPRSSGPCAS ATPCTMGVTDMDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAH+                  ++  F+    L  +E E +     AN   ++ S+  + C  H
Sbjct:  134 QFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGGINSGSGVSVTSRGLTASVIPAQRKDYFQPIPLNSPKPHSMNGLMVPPAPRKKLETLEQMKEELRKKQELLEQKRKDFRRQLHKLEKQSSGVKGDTEQAAKRQKVDIAVDPAKASTPRSSGPCASGATPCTMGVTDMDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHV----------------DVLKEHFSQYSDLFSVELEDV-----ANEDVVMVSETLNDCSAH 402          

HSP 2 Score: 292.738 bits (748), Expect = 2.540e-86
Identity = 143/147 (97.28%), Postives = 144/147 (97.96%), Query Frame = 1
Query: 1396 VDVLKEHFSQYSDLFSVELEDVENEDV-MVSETLNDCSAHITYSTCRSAEKAYANSKCWQGHNLQFSWLISSNSINDPISKETSSAPKEPLEADDIQTEEKLACSISQEVASDDGESENSDVKSFVEHKYLAEVSEHSPSPTSRVKE 1833
            VDVLKEHFSQYSDLFSVELEDV NEDV MVSETLNDCSAHITYSTCRSAEKAYANSKCWQGHNL+FSWL SSNSINDPISKETSSAPKEPLEADDIQTEEKLACSISQEVASDDGESENSDVKSFVEHKYLAEVSEHSPSPTSRVKE
Sbjct:  363 VDVLKEHFSQYSDLFSVELEDVANEDVVMVSETLNDCSAHITYSTCRSAEKAYANSKCWQGHNLKFSWLTSSNSINDPISKETSSAPKEPLEADDIQTEEKLACSISQEVASDDGESENSDVKSFVEHKYLAEVSEHSPSPTSRVKE 509          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A0D2P4S3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G075900 PE=4 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 2.035e-123
Identity = 219/256 (85.55%), Postives = 225/256 (87.89%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQ-----RKDYFQPIP-------------LNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGDTEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHIGCSLLFLV 984
            +FSR+EEAEA+LKAPDAVMGNRFIKLWC  RDRIPD  INSGSGVSVTSRGLTASVIPAQ      KD FQPIP             LNSPK HSMNGLM+PPAPRKKLETLEQMKEELRKKQELLEQKRKDF+RQL KLEKQSSGVKGDTEQAAKRQKVDIA DPA ASTPRSSGPCASAATPCTMGVTD DKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLP DFAH+ CSLLFLV
Sbjct:  227 QFSRREEAEASLKAPDAVMGNRFIKLWCTKRDRIPDVGINSGSGVSVTSRGLTASVIPAQPAANRGKDNFQPIPQKSNVIHGVDLPSLNSPKLHSMNGLMIPPAPRKKLETLEQMKEELRKKQELLEQKRKDFQRQLDKLEKQSSGVKGDTEQAAKRQKVDIAADPANASTPRSSGPCASAATPCTMGVTDTDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPPDFAHLSCSLLFLV 482          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A0D2S8U2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G075900 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 2.768e-122
Identity = 219/256 (85.55%), Postives = 225/256 (87.89%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQ-----RKDYFQPIP-------------LNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGDTEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHIGCSLLFLV 984
            +FSR+EEAEA+LKAPDAVMGNRFIKLWC  RDRIPD  INSGSGVSVTSRGLTASVIPAQ      KD FQPIP             LNSPK HSMNGLM+PPAPRKKLETLEQMKEELRKKQELLEQKRKDF+RQL KLEKQSSGVKGDTEQAAKRQKVDIA DPA ASTPRSSGPCASAATPCTMGVTD DKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLP DFAH+ CSLLFLV
Sbjct:  280 QFSRREEAEASLKAPDAVMGNRFIKLWCTKRDRIPDVGINSGSGVSVTSRGLTASVIPAQPAANRGKDNFQPIPQKSNVIHGVDLPSLNSPKLHSMNGLMIPPAPRKKLETLEQMKEELRKKQELLEQKRKDFQRQLDKLEKQSSGVKGDTEQAAKRQKVDIAADPANASTPRSSGPCASAATPCTMGVTDTDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPPDFAHLSCSLLFLV 535          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A0D2SFT1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G075900 PE=4 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 1.456e-121
Identity = 219/256 (85.55%), Postives = 225/256 (87.89%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQ-----RKDYFQPIP-------------LNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGDTEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHIGCSLLFLV 984
            +FSR+EEAEA+LKAPDAVMGNRFIKLWC  RDRIPD  INSGSGVSVTSRGLTASVIPAQ      KD FQPIP             LNSPK HSMNGLM+PPAPRKKLETLEQMKEELRKKQELLEQKRKDF+RQL KLEKQSSGVKGDTEQAAKRQKVDIA DPA ASTPRSSGPCASAATPCTMGVTD DKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLP DFAH+ CSLLFLV
Sbjct:  302 QFSRREEAEASLKAPDAVMGNRFIKLWCTKRDRIPDVGINSGSGVSVTSRGLTASVIPAQPAANRGKDNFQPIPQKSNVIHGVDLPSLNSPKLHSMNGLMIPPAPRKKLETLEQMKEELRKKQELLEQKRKDFQRQLDKLEKQSSGVKGDTEQAAKRQKVDIAADPANASTPRSSGPCASAATPCTMGVTDTDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPPDFAHLSCSLLFLV 557          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A0D2QNC1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G075900 PE=4 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 2.638e-121
Identity = 219/256 (85.55%), Postives = 225/256 (87.89%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQ-----RKDYFQPIP-------------LNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGDTEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHIGCSLLFLV 984
            +FSR+EEAEA+LKAPDAVMGNRFIKLWC  RDRIPD  INSGSGVSVTSRGLTASVIPAQ      KD FQPIP             LNSPK HSMNGLM+PPAPRKKLETLEQMKEELRKKQELLEQKRKDF+RQL KLEKQSSGVKGDTEQAAKRQKVDIA DPA ASTPRSSGPCASAATPCTMGVTD DKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLP DFAH+ CSLLFLV
Sbjct:  339 QFSRREEAEASLKAPDAVMGNRFIKLWCTKRDRIPDVGINSGSGVSVTSRGLTASVIPAQPAANRGKDNFQPIPQKSNVIHGVDLPSLNSPKLHSMNGLMIPPAPRKKLETLEQMKEELRKKQELLEQKRKDFQRQLDKLEKQSSGVKGDTEQAAKRQKVDIAADPANASTPRSSGPCASAATPCTMGVTDTDKSTENILSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPPDFAHLSCSLLFLV 594          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A061ECV5_THECC (Zinc finger family protein / RNA recognition motif-containing protein, putative OS=Theobroma cacao GN=TCM_016945 PE=4 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 2.550e-79
Identity = 179/263 (68.06%), Postives = 199/263 (75.67%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQR------KDYFQPIP-------------LNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGD--TEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSPK------------SKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHI 960
            +FSR+EEAEAALKAPDAVMGNRFIKLW ANRD IPD  ++SGSG+S+T RGLTASVIP+Q       KD  QPIP             LNSPKP S NG  VPP  +KK ETLEQMKEELRKKQE+LEQKR DFRRQL KLEKQSSGVKGD  TEQAAKRQKV IA DPAKASTP SS P ASAATPCT+G+T+ +KSTEN++SHSPK            SK+QS  SAP G HPF++N+YKLDNRP AFRVI PLPS FA +
Sbjct:  527 QFSRREEAEAALKAPDAVMGNRFIKLWWANRDSIPDDGVSSGSGISITPRGLTASVIPSQTSVANRGKDNLQPIPQKSNVVHGADVPSLNSPKPVSANGPKVPPPLQKKFETLEQMKEELRKKQEMLEQKRNDFRRQLDKLEKQSSGVKGDLMTEQAAKRQKVGIAADPAKASTPMSSEPGASAATPCTIGMTEKNKSTENVVSHSPKSNTTMALQESMSSKQQSRPSAPAG-HPFLMNRYKLDNRPPAFRVIPPLPSGFADV 788          

HSP 2 Score: 169.088 bits (427), Expect = 2.629e-40
Identity = 94/157 (59.87%), Postives = 115/157 (73.25%), Query Frame = 1
Query: 1396 VDVLKEHFSQYSDLFSVELEDVENE-DVMVSETLNDCSAHITYSTCRSAEKAYANSKCWQGHNLQFSWLISSNSINDPISKETSSA-PKEPLEADDIQTEEKLACSISQE-VASDDGESENSDVKSFVEHKYLAEVSEHSPSPTSRVKE*SPKGKAC 1857
            VD LKEHF QY DLF+VELE+VEN+ D + SE L +CSA ITYST R+AE+A+ N KCWQG+NLQF+WL S++  NDP SKETSS+ PK  L+A D+Q EEKL CS+SQE V S +GESENS+ KSFVEH  L E        +S  ++ S KG AC
Sbjct:  788 VDALKEHFLQYGDLFAVELEEVENDGDGLGSEALKNCSALITYSTRRAAERAFVNGKCWQGNNLQFTWLTSTS--NDPSSKETSSSIPKGSLDA-DVQREEKLTCSVSQEVVGSGNGESENSEGKSFVEHMELFEEVSRHSPSSSASEKESHKGDAC 941          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A0B0PES1_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_03576 PE=4 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 3.261e-73
Identity = 179/298 (60.07%), Postives = 200/298 (67.11%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQ------RKDYFQPIP-------------LNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGD--TEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSP------------KSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHIGCSLLFLV*GYCFLAPSFVRMKFTMIHHLLYIEKE 1065
            +FSR+EEAEAALKAPDAVMGNRFIKLW ANRD +PD  INSGS V+VTSRG T  VIPAQ       KD  QPI              +NSPKP  +NG  V    +KKLETLEQMKEELRKKQE LEQKR DFRRQL KL+KQSSGVKGD  TEQAAK+QKV IA DPAKASTP  S P A    PCT+G+TD +KSTEN+ SH P             SK+QS  SAP G +PF++NKYKLDNRPTAFRVI PLPS FA +  SL          APSF    F +I  L + EK+
Sbjct:  526 QFSRREEAEAALKAPDAVMGNRFIKLWWANRDSVPDDGINSGSSVTVTSRGPTVFVIPAQPVVNRGGKDNLQPIAQKSNAVHGAAVPSVNSPKPSGVNGPKVQLPLQKKLETLEQMKEELRKKQETLEQKRNDFRRQLDKLQKQSSGVKGDLPTEQAAKKQKVGIAADPAKASTPSLSEPGAPTTIPCTVGMTDKNKSTENVGSHGPTSNATMSLQESKSSKQQSRPSAPTG-YPFLMNKYKLDNRPTAFRVIPPLPSGFADVSHSLFSSE--KIVFAPSFYEDGFYLIILLFHFEKK 820          

HSP 2 Score: 154.066 bits (388), Expect = 2.120e-35
Identity = 102/156 (65.38%), Postives = 121/156 (77.56%), Query Frame = 1
Query: 1396 VDVLKEHFSQYSDLFSVELEDVENEDVMVSETLNDCSAHITYSTCRSAEKAYANSKCWQGHNLQFSWLISSNSINDPISKETSSA-PKEPLEADDIQTEEKLACSISQEV-ASDDGESENSDVKSFVEHKYLAEVSEHSPSPTSRVKE*SPKGKAC 1857
            VDVLKEHF QY DL +VE+EDVEN++ M SE +N+CS  ITY T RSAE+AY N KCWQG+NLQF+WL SSNS NDP SKE SS+ PK  LEA  +QTE +L CS+S EV AS D ES+NS+ +SFVE+  L EVSEHS SP+S +KE SPKG AC
Sbjct:  821 VDVLKEHFLQYGDLSAVEIEDVENDNDMGSEAMNNCSIVITYGTRRSAERAYVNGKCWQGNNLQFTWLKSSNSSNDPSSKENSSSTPKGTLEA-GVQTEGELECSVSPEVIASGDKESKNSEGESFVENMALPEVSEHSSSPSSCMKE-SPKGDAC 974          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A0D2TJI9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G063700 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 5.698e-71
Identity = 169/263 (64.26%), Postives = 188/263 (71.48%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQR------KDYFQPIP-------------LNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGD--TEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENILSHSP------------KSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHI 960
            +FSR+EEAEAALKAPDAVMGNRFIKLW ANRD +PD  INSGS V+VTSRG T  VIPAQ       KD  QPI              +NSPKP  +NG  V    +KKLETLEQMKEELRKKQE+LEQKR DFRRQL KL+KQSSGVKGD  TEQAAK+QKV IA DPAKASTP  S P A    PCT+G+TD +KSTEN+ SH P             SK+QSC SAP G +PF++NKYKLDNRPTAFRVI PLPS FA +
Sbjct:  526 QFSRREEAEAALKAPDAVMGNRFIKLWWANRDSVPDDGINSGSSVTVTSRGPTVFVIPAQAVVNRGGKDNLQPIAQKSNAVHGAAVPSVNSPKPSGVNGPKVQLPLQKKLETLEQMKEELRKKQEMLEQKRNDFRRQLDKLQKQSSGVKGDLPTEQAAKKQKVGIAADPAKASTPSLSEPGAPTTIPCTVGMTDKNKSTENVGSHGPTSNATMSLQESKSSKQQSCPSAPTG-YPFLMNKYKLDNRPTAFRVIPPLPSGFADV 787          

HSP 2 Score: 154.066 bits (388), Expect = 2.053e-35
Identity = 102/156 (65.38%), Postives = 121/156 (77.56%), Query Frame = 1
Query: 1396 VDVLKEHFSQYSDLFSVELEDVENEDVMVSETLNDCSAHITYSTCRSAEKAYANSKCWQGHNLQFSWLISSNSINDPISKETSSA-PKEPLEADDIQTEEKLACSISQEV-ASDDGESENSDVKSFVEHKYLAEVSEHSPSPTSRVKE*SPKGKAC 1857
            VDVLKEHF QY DL +VE+EDVEN++ M SE +N+CS  ITY T  SAE+AY N KCWQG+NLQF+WL SSNS NDP SKETSS+ PK  LEA D+QTE +L  S+S EV AS D ES+NS+ +SFVE+  L EVSEHS SP+S +KE SPKG AC
Sbjct:  787 VDVLKEHFLQYGDLSAVEIEDVENDNDMGSEAMNNCSIVITYGTRWSAERAYVNGKCWQGNNLQFTWLTSSNSSNDPSSKETSSSTPKGTLEA-DVQTEGELEFSVSPEVIASGDKESKNSEGESFVENMALPEVSEHSSSPSSCMKE-SPKGDAC 940          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A0D2QWE2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G264400 PE=4 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.976e-62
Identity = 158/252 (62.70%), Postives = 178/252 (70.63%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTASVIPAQ-----RKDYFQPIP--------------LNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGD--TEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENI-LSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHI 960
            +FSR+EEAEAALK+PDAVMGNRFIKLW ANRD IPD  + SGSG++V   GLTA     Q      KD  QP                LNSP+P ++NG    P  +KKLETLEQMKEELRKKQE+LEQKR DFRRQL KL+KQSSG KGD  TEQAAKRQKV IA DPAKAST  SS P A  ATPCT+ VTD +KSTEN+ L  S  SK  S  SA VG HP ++NKYKLDNRPTAF+VI PLP+ FA +
Sbjct:  497 QFSRREEAEAALKSPDAVMGNRFIKLWWANRDSIPDDAVKSGSGIAVNPHGLTAPAFQVQPVATRGKDNLQPTAQKSNVIHDADLSPSLNSPRPVNLNGPKASPPLQKKLETLEQMKEELRKKQEMLEQKRNDFRRQLDKLQKQSSGAKGDLHTEQAAKRQKVGIAADPAKASTSSSSEPAAFVATPCTV-VTDKNKSTENLALQESTSSKHHSHPSAVVG-HPIMINKYKLDNRPTAFQVIPPLPAGFADV 746          

HSP 2 Score: 106.301 bits (264), Expect = 2.180e-20
Identity = 56/108 (51.85%), Postives = 68/108 (62.96%), Query Frame = 1
Query: 1396 VDVLKEHFSQYSDLFSVELEDVENEDVMVSETLNDCSAHITYSTCRSAEKAYANSKCWQGHNLQFSWLISSNSINDPISKETSSAPKEPLEADDIQTEEKLA--CSIS 1713
            VDVLK+HFSQY DL SVEL+DVE +D   SE  ++CS  ITYST  SAEKAYA+ KCW+ HNLQ SW             +TSS  +   +  D++T EKL   CS S
Sbjct:  746 VDVLKQHFSQYGDLVSVELQDVEKDDNTGSEASHNCSVLITYSTHHSAEKAYADGKCWKTHNLQLSW-------------QTSSKDQHSRKETDVETNEKLTACCSTS 840          
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Match: A0A0B0NPE9_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_00793 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 5.792e-59
Identity = 157/252 (62.30%), Postives = 180/252 (71.43%), Query Frame = 1
Query:  271 EFSRKEEAEAALKAPDAVMGNRFIKLWCANRDRIPDGDINSGSGVSVTSRGLTA-----SVIPAQRKDYFQP------------IP--LNSPKPHSMNGLMVPPAPRKKLETXXXXXXXXXXXXXXXXXXXXDFRRQLHKLEKQSSGVKGD--TEQAAKRQKVDIAVDPAKASTPRSSGPCASAATPCTMGVTDMDKSTENI-LSHSPKSKRQSCQSAPVGIHPFVLNKYKLDNRPTAFRVISPLPSDFAHI 960
            +FSR+EEAEAALK+PDAVMGNRFIKLW ANRD IPD  + SGS ++V   GLTA      ++  + KD  QP            +P  LNSPKP ++NG    P  +KKLETLEQMKEELRKKQE+LEQKR DFRRQL KL+KQSSG KGD  TEQAAKRQKV I  D AKAST  SS P A  ATPCT+ +TD +KSTEN+ L  S  SK QS  SA VG HP ++NKYKLDNRPTAFRVI PLP+ FA +
Sbjct:  497 QFSRREEAEAALKSPDAVMGNRFIKLWWANRDSIPDDAVKSGSSIAVNPHGLTAPAFQVQLVATRGKDNLQPTAQKSNVVHDAEVPPSLNSPKPVNLNGPKASPPLQKKLETLEQMKEELRKKQEMLEQKRNDFRRQLDKLQKQSSGAKGDLHTEQAAKRQKVGIVTDTAKASTSSSSEPAAFVATPCTV-MTDKNKSTENLALQESTSSKHQSHPSAVVG-HPIMINKYKLDNRPTAFRVIPPLPAGFADV 746          

HSP 2 Score: 107.071 bits (266), Expect = 1.222e-20
Identity = 59/108 (54.63%), Postives = 69/108 (63.89%), Query Frame = 1
Query: 1396 VDVLKEHFSQYSDLFSVELEDVENEDVMVSETLNDCSAHITYSTCRSAEKAYANSKCWQGHNLQFSWLISSNSINDPISKETSSAPKEPLEADDIQTEEKLA--CSIS 1713
            VDVLK HFSQY DL  VEL+DVE +D   SE  ++CS  ITYST RSAEKAYA+ KCW+ HNLQFSW  SSN  +    KET           +++T EKL   CS S
Sbjct:  746 VDVLKRHFSQYGDLVFVELQDVEKDDNTGSEASHNCSVLITYSTHRSAEKAYADGKCWKTHNLQFSWQTSSNDQHS--RKET-----------NVETNEKLTACCSTS 840          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 2
Match NameE-valueIdentityDescription
C3H41_ARATH5.119e-2740.23Zinc finger CCCH domain-containing protein 41 OS=A... [more]
C3H27_ORYSJ1.248e-1535.96Zinc finger CCCH domain-containing protein 27 OS=O... [more]
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092533 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PH16_GOSAR2.210e-13881.03Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2P4S3_GOSRA2.035e-12385.55Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2S8U2_GOSRA2.768e-12285.55Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2SFT1_GOSRA1.456e-12185.55Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QNC1_GOSRA2.638e-12185.55Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061ECV5_THECC2.550e-7968.06Zinc finger family protein / RNA recognition motif... [more]
A0A0B0PES1_GOSAR3.261e-7360.07Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2TJI9_GOSRA5.698e-7164.26Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QWE2_GOSRA4.976e-6262.70Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0NPE9_GOSAR5.792e-5962.30Uncharacterized protein OS=Gossypium arboreum GN=F... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 93..128
NoneNo IPR availablePANTHERPTHR14398RNA RECOGNITION RRM/RNP DOMAINcoord: 4..229
NoneNo IPR availablePANTHERPTHR14398:SF0SECOND MITOTIC WAVE MISSING, ISOFORM Ccoord: 4..229

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092533 ID=g.barbadense_cottongen_reftransV1_0092533|Name=g.barbadense_cottongen_reftransV1_0092533|organism=Gossypium barbadense|type=contig|length=2170bp
CTTTCTAAACACACACACACAAAAAAAAAAAACCTTCAAATTCTCCTTGC
TTCTCTGACTATGGGACTTCTCCAGAGGTCTGCCCTACCGCCGCCGTAGC
CAGTGGCCGGCATTGCAGGAAAACGAGCCTTTACCCTTGCCTCCGAGCGA
ATTTGAAGGCCAAGCAATCGGAGCCCGAATAGCCGAGAAGTGATGGTTCT
CAATCCCATCCCTTTCACGGGTTGATCCTCGACGACAGAGAAGGACTCTC
CGACATCGGCCATGGGAAACGAGTTTTCAAGGAAGGAAGAGGCAGAAGCT
GCTCTGAAGGCACCCGATGCTGTAATGGGTAACCGCTTTATTAAGCTCTG
GTGTGCAAATCGGGATAGAATACCTGATGGTGACATAAACAGTGGCAGTG
GTGTGTCAGTAACTTCACGTGGTCTAACAGCTTCTGTTATTCCAGCTCAG
AGGAAAGATTATTTTCAACCTATTCCTCTGAATTCCCCCAAGCCTCATAG
TATGAATGGTCTCATGGTTCCTCCTGCACCGCGGAAAAAATTAGAGACTT
TGGAGCAGATGAAAGAGGAACTACGCAAGAAGCAGGAACTGCTGGAACAG
AAGCGGAAGGACTTCCGGCGCCAGTTGCACAAACTTGAGAAACAATCTAG
TGGTGTCAAAGGTGATACTGAACAAGCTGCCAAGAGGCAAAAGGTGGACA
TTGCGGTTGATCCTGCAAAAGCTTCAACTCCAAGATCCTCTGGACCTTGT
GCTTCTGCTGCAACACCATGCACAATGGGGGTGACAGATATGGACAAATC
AACAGAGAATATTCTGTCCCACAGTCCTAAATCAAAGCGGCAGTCTTGTC
AATCAGCACCAGTAGGCATTCATCCATTCGTGTTGAATAAATACAAATTG
GATAACAGACCTACTGCTTTTAGAGTTATTTCACCATTGCCTTCTGATTT
TGCACATATTGGTTGCTCTCTCCTTTTCCTTGTCTGAGGATATTGTTTTC
TGGCTCCATCTTTTGTGAGGATGAAATTTACAATGATTCATCATCTTTTA
TATATTGAAAAGGAAAAGATGAAATAAGCACATTTTGCAAACAATATATG
TCTCTTGTGCTCAGATGTTAGGGATGCATGTGTCCGGCATGGATATATTC
AATTTCTCCAAGTTTTTCATGTATTCGGAAAAACCTAGGCAGATCATATC
CCTACACCTATGTGTGTATGTGTTGGATATAGGTGTTAGGCTCAAGTACT
TGAAAAGAAAAATGATTAGTCATATAGTAGCATAACTTATTAATATGTCT
AGTTATTTGTAAATTATTCCAAAGTTCTTCGCTTAATGGCATAAAACTCG
ATTGGCTCTTCTGTTTTTCATTGTCATCAATGAAACAATTATTAGGTCGA
TGTTTTGAAGGAGCACTTCTCACAATATAGTGATCTTTTCTCTGTGGAGC
TGGAAGATGTGGAAAATGAAGATGTTATGGTATCTGAGACACTGAATGAT
TGCTCAGCTCATATAACTTACAGCACATGCCGCTCGGCAGAAAAGGCATA
TGCAAATAGTAAATGCTGGCAGGGTCACAATTTGCAGTTTTCATGGTTGA
TATCTAGCAATTCAATCAATGATCCGATTAGCAAAGAAACTTCTTCCGCA
CCAAAGGAGCCTTTGGAAGCTGATGATATCCAGACAGAAGAAAAATTAGC
ATGCAGCATCTCCCAAGAAGTTGCGTCAGATGATGGGGAATCTGAGAATT
CTGATGTAAAGAGTTTTGTGGAGCATAAGTATTTAGCTGAAGTTTCAGAA
CATAGTCCATCTCCAACGTCCAGAGTGAAAGAGTAGTCACCTAAAGGCAA
AGCATGTTAAATATAGGGGGCTGTCTCTGGTTTTTTTACGACAAGGTAAA
GTATTCAATTTGTTGAAGTCTAGTCGGCACCAAGGTTTAACAGTTTCACT
TCAGTAGCAAATTGTGTTGTCTTTTGAAATTAATTTTGTAGGACTAAATG
GATTAAAAGAATAGGAAAAAAGAACAATACATTAAGATTTTATTACATGA
AAAGTGATTGGGAACTGATTCCCATTTTAGTTGGGAGTTTGGGCTCATTT
TTAGATAGGAAATTAGGTATATAACCATGCAATATTTCCTCTGTTAAAAA
ACCGATCTATTTAAGGGTCC
back to top