g.barbadense_cottongen_reftransV1_0092164, g.barbadense_cottongen_reftransV1_0092164 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092164
Unique Nameg.barbadense_cottongen_reftransV1_0092164
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2359
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
At07chromosomeg.barbadense_cottongen_reftransV1_0092164:1..2359 .
At07:23595119..23597477 +
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy Swiss-Prot
Match: M310_ARATH (Uncharacterized mitochondrial protein AtMg00310 OS=Arabidopsis thaliana GN=AtMg00310 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.547e-29
Identity = 54/143 (37.76%), Postives = 86/143 (60.14%), Query Frame = 3
Query: 1647 AIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYG-MGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWI 2072
            A+P YAMSCF L   LC ++     +FWW     KR I W  W+ +C  KE+ G +G R++  FN ALLAKQ  R+I  P +L++R+ +++YFP+   +   +G + SY W++I   + +L++GL   +G G++  +  D WI
Sbjct:    2 ALPVYAMSCFRLSKLLCKKLTSAMTEFWWSSCENKRKISWVAWQKLCKSKEDDGGLGFRDLGWFNQALLAKQSFRIIHQPHTLLSRLLRSRYFPHSSMMECSVGTRPSYAWRSIIHGRELLSRGLLRTIGDGIHTKVWLDRWI 144          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy Swiss-Prot
Match: LIN1_NYCCO (LINE-1 reverse transcriptase homolog OS=Nycticebus coucang PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 6.022e-21
Identity = 52/200 (26.00%), Postives = 101/200 (50.50%), Query Frame = 3
Query: 1005 TVE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHLFADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVF-YSSISKGD--MKNEIS--------EFLGVRVSTNLEKYFGLPSMVGRRKESFLNLKERIS 1571
             ++  F+   + ++G    ++ L+    +  +  + +NG + + F    G RQG PLSP LF +  E L++ +R    E  +KGI      +++S LFADD I++ E T      + E++KEY + SG   N  KS  F Y++ ++ +  +K+ I         ++LGV ++ +++  +         KE++  L++ I+
Sbjct:  606 NIQHPFMIRTLKKIGIEGTFLKLIEAIYSKPTANIILNGVKLKSFPLRSGTRQGCPLSPLLFNIVMEVLAIAIR---EEKAIKGIHIGSEEIKLS-LFADDMIVYLENTRDSTTKLLEVIKEYSNVSGYKINTHKSVAFIYTNNNQAEKTVKDSIPFTVVPKKMKYLGVYLTKDVKDLY---------KENYETLRKEIA 792          

HSP 2 Score: 40.817 bits (94), Expect = 6.022e-21
Identity = 24/61 (39.34%), Postives = 32/61 (52.46%), Query Frame = 1
Query:  712 FKQTYIALIPK-SPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILG 891
            F +  I LIPK   +P    N+RPISL  +  K + K +TN +Q  I   I+  Q  FI G
Sbjct:  508 FYEANITLIPKPGKDPTRKENYRPISLMNIDAKILNKILTNRIQQHIKKIIHHDQVGFIPG 568          

HSP 3 Score: 37.3502 bits (85), Expect = 6.022e-21
Identity = 13/36 (36.11%), Postives = 24/36 (66.67%), Query Frame = 2
Query:  533 LSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRY 640
            L+ P ++ EI + +Q +   K+PGPDGF + F++ +
Sbjct:  448 LNRPISSSEIASTIQNLPKKKSPGPDGFTSEFYQTF 483          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy Swiss-Prot
Match: RNHX1_ARATH (Putative ribonuclease H protein At1g65750 OS=Arabidopsis thaliana GN=At1g65750 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.105e-16
Identity = 54/186 (29.03%), Postives = 90/186 (48.39%), Query Frame = 3
Query: 1536 KESFLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWAT-----KGILAKGLCWKVGTGLNFSIANDAWIPG 2078
            K++F  + ER+S +  G   + LS   +    K+VL ++P ++MS   L  S+   ++ +   F W     K+  H  +W  +C PK+E G+G+R     N AL++K G RL+   +SL T V + KY   E   +  L  K S  W + W +     + +++ G+ W  G G       D W+ G
Sbjct:   10 KDTFGEILERVSSRMSGWREKTLSFAGRLTLTKAVLSSMPVHSMSTILLPQSILNRLDQLSRTFLWGSTAEKKKQHLVKWSKVCSPKKEGGLGVRAAKSMNRALISKVGWRLLQEKNSLWTLVLQKKYHVGEIRDSRWLIPKGS--WSSTWRSIAIGLRDVVSHGVGWIPGDGQQIRFWTDRWVSG 193          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy Swiss-Prot
Match: M1250_ARATH (Uncharacterized mitochondrial protein AtMg01250 OS=Arabidopsis thaliana GN=AtMg01250 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.923e-12
Identity = 35/66 (53.03%), Postives = 45/66 (68.18%), Query Frame = 3
Query: 1113 INGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISH-LFADD 1307
            ING+   +  P+RGLRQGDPLSP+LF++C+E LS L R A  +G L GI+       I+H LFADD
Sbjct:   14 INGAPQGLVTPSRGLRQGDPLSPYLFILCTEVLSGLCRRAQEQGRLPGIRVSNNSPRINHLLFADD 79          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy Swiss-Prot
Match: YTX2_XENLA (Transposon TX1 uncharacterized 149 kDa protein OS=Xenopus laevis PE=3 SV=1)

HSP 1 Score: 48.1358 bits (113), Expect = 1.220e-10
Identity = 29/79 (36.71%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  715 KQTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGR-LFRIMFF*LMKSYIVFAR 948
            ++  ++L+PK  + R + N+RP+SL +  YK VAKAI+  L+ V+   I+  QS  + GR +F  +F  L++  + FAR
Sbjct:  506 RRAVLSLLPKKGDLRLIKNWRPVSLLSTDYKIVAKAISLRLKSVLAEVIHPDQSYTVPGRTIFDNVF--LIRDLLHFAR 582          

HSP 2 Score: 41.2022 bits (95), Expect = 1.220e-10
Identity = 26/83 (31.33%), Postives = 37/83 (44.58%), Query Frame = 2
Query:  416 ISEAATIFFQRLFTSNIIG-DLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKD 661
            I + A  F+Q LF+ + I  D    L       S     +L +P    E+  AL+ M   K+PG DG    FF+ +W   G D
Sbjct:  405 IRDRARSFYQNLFSPDPISPDACEELWDGLPVVSERRKERLETPITLDELSQALRLMPHNKSPGLDGLTIEFFQFFWDTLGPD 487          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy Swiss-Prot
Match: LORF2_MOUSE (LINE-1 retrotransposable element ORF2 protein OS=Mus musculus GN=Pol PE=1 SV=2)

HSP 1 Score: 41.9726 bits (97), Expect = 8.609e-9
Identity = 23/80 (28.75%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  413 EISEAATIFFQRLFTSNIIGDLSHLLMGIKKSFSYELNTK----LSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRY 640
            EI      F++RL+++ +  +L  +   + +    +LN      L+SP + KEI+  +  + + K+PGPDGF A F++ +
Sbjct:  413 EIQNTIRSFYKRLYSTKL-ENLDEMDKFLDRYQVPKLNQDQVDHLNSPISPKEIEAVINSLPTKKSPGPDGFSAEFYQTF 491          

HSP 2 Score: 41.2022 bits (95), Expect = 8.609e-9
Identity = 24/61 (39.34%), Postives = 33/61 (54.10%), Query Frame = 1
Query:  712 FKQTYIALIPK-SPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILG 891
            F +  I LIPK   +P  + NFRPISL  +  K + K + N +Q+ I   I+  Q  FI G
Sbjct:  516 FYEATITLIPKPQKDPTKIENFRPISLMNIDAKILNKILANRIQEHIKAIIHPDQVGFIPG 576          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: W5HDK0_WHEAT (Uncharacterized protein OS=Triticum aestivum PE=4 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 4.584e-122
Identity = 180/448 (40.18%), Postives = 255/448 (56.92%), Query Frame = 3
Query:  891 EII*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMT-VE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHL-FADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGRRK-ESFLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIPGAINFRLSSVPFTMTDFKVADLINSAERKWKGELIVDTFGEEVAGSFVSL 2225
             II DN+LLAYE+ H   ++R G        L + K    VE  FL+ IM+++GF  DWV LVMKCITT  Y V +N S      P RGLRQGDPLSP+LFL+C+EG S ++  A   G LKGIK CR    ISHL FADD ++  EA+   A ++  IL+ Y++CS Q  N EKS + +S  +    K E+   L +       KY GLP+ +G+ K ++F  LK++   K  G   +LLS+  K+I IK+  QAIP Y M+CF +  +L  ++  +  +FWW +   +  IHW  W+ +  PK E G+G R++  FN+A+LA+Q  RL+ NP SL  +V  AKY P    L +   N  SY W++I     +L KG+ W+VG G N +I +D WIP  I  R+SS        +V +LIN     W  +L+  TF  + A + + +
Sbjct:  518 HIISDNILLAYELTHFLQRRRRGRVGYATVKLDMSKAYDRVEWKFLEDIMMKLGFRHDWVNLVMKCITTVKYQVKVNRSTTGTIIPQRGLRQGDPLSPYLFLLCAEGFSAMLHEAERSGSLKGIKICREAPSISHLLFADDSLVLMEASANNARVMNSILESYEACSRQVINKEKSAILFSKNTNPGQKEEVMNSLQISSEGFKGKYLGLPAYIGKAKAKTFQYLKDKEWNKIHGWKEKLLSKAGKEILIKAAAQAIPVYTMACFDITRTLSDDLSSMVNRFWWSQMDKENKIHWMSWEKLSKPKSEGGLGFRDLHSFNLAMLARQAWRLLQNPSSLCAQVLAAKYHPRSCILEARPKNGISYTWRSILKGVQLLKKGIIWRVGDGSNINIWSDPWIPRGITRRVSSHKGRHLVTRVNELINPVMNSWDTDLVYQTFNADDAETILKI 965          

HSP 2 Score: 65.4698 bits (158), Expect = 4.584e-122
Identity = 30/85 (35.29%), Postives = 50/85 (58.82%), Query Frame = 2
Query:  416 ISEAATIFFQRLFTSNI--IGDLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDV 664
            +SE    +F  LFTS +    +  H+L  I+   S ++N +L + +  +E+++A+  +   KAPGPDG PA+F+R +W I G  V
Sbjct:  357 LSEHVANYFFNLFTSTMGFSREREHVLRTIRPKVSNQMNAELCAEYTEEEVRSAMFSIGDLKAPGPDGMPAIFYRSFWQIVGDQV 441          

HSP 3 Score: 59.6918 bits (143), Expect = 4.584e-122
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 1
Query:  706 EFFKQTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            E +  T I LIPK+ +P ++ + RPISLC V+YK ++K ITN L+ ++   I   QSAF+ G +
Sbjct:  456 EGWNDTMIVLIPKTAHPTSMKDLRPISLCNVVYKVISKVITNRLKTILPDIISPNQSAFVPGHI 519          

HSP 4 Score: 48.1358 bits (113), Expect = 4.584e-122
Identity = 24/56 (42.86%), Postives = 31/56 (55.36%), Query Frame = 1
Query:  250 FLKRLLYMEIDKHKMY*EQMARVNWLKFGYKNFVFFHKFTSARKRRNIISMLELRN 417
            FL+  L     +  M+  Q A V WL+ G KN  FFH F S R+RRN IS L+  +
Sbjct:  292 FLREKLERLEHQKDMFWRQRAHVKWLQSGDKNTTFFHAFASERRRRNTISKLKRED 347          

HSP 5 Score: 25.7942 bits (55), Expect = 4.584e-122
Identity = 15/40 (37.50%), Postives = 23/40 (57.50%), Query Frame = 2
Query: 2210 ILRIPLAREPHDDFMVCSGEPSGEFSVRSAYKLLQTSDPR 2329
            IL+IP+  E  +DF+    +    FSV+SAY++   S  R
Sbjct:  962 ILKIPIL-ENTNDFIAWHFDKKCVFSVKSAYRVAADSAKR 1000          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: F4NCI4_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris PE=4 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.797e-113
Identity = 173/439 (39.41%), Postives = 260/439 (59.23%), Query Frame = 3
Query:  894 II*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMT-VE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHLF-ADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGR-RKESFLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIPGAINFRLSSVPFTMTDF---KVADLINSAERKWKGELIVDTF 2192
            +I DNVL+AYE  H   +K+TG +      L + K    VE  FL+ +ML++GF   +  LVM C+T+  ++V +NG  +R F P+RGLRQGDPLSPFLF++C+EGLS L+R A  + ++ G+K   R   ISHLF ADD +LF  AT  +   + +IL  Y++ SGQ  N EKS + YS   + D  N +   L  +     EKY GLP+ +G  +K  F  +++R+  K +G  G+ LSQ  +++ IK+V QAIPTYAM CF +  S+   IE +   F+W +   +R + W  W+ +  PK+E G+G+RN   FN ALLAKQ  R++T PDSL+ RV K KYFP  +FL + +    S+  K+I + + ++ KG+C  +G G + +I  D W+P    + +++      D    KV +LI++   +W  EL+   F
Sbjct:  554 LITDNVLVAYECFHFLRKKKTGKKGYLGLKLDMSKAYDRVEWCFLENMMLKLGFPTRYTKLVMNCVTSARFSVLVNGQPSRNFFPSRGLRQGDPLSPFLFVVCAEGLSTLLRDAEEKKVIHGVKIGHRVSPISHLFFADDSLLFIRATEEEVENVMDILSTYEAASGQKLNMEKSEMSYSRNLEPDKINTLQMKLAFKTVEGHEKYLGLPTFIGSSKKRVFQAIQDRVWKKLKGWKGKYLSQAGREVLIKAVAQAIPTYAMQCFVIPKSIIDGIEKMCRNFFWGQKEEERRVAWVAWEKLFLPKKEGGLGIRNFDVFNRALLAKQAWRILTKPDSLMARVIKGKYFPRSNFLEARVSPNMSFTCKSILSARAVIQKGMCRVIGDGRDTTIWGDPWVPSLERYSIAATEGVSEDDGPQKVCELISND--RWNVELLNTLF 990          

HSP 2 Score: 69.3218 bits (168), Expect = 1.797e-113
Identity = 36/111 (32.43%), Postives = 57/111 (51.35%), Query Frame = 2
Query:  413 EISEAATIFFQRLFTSNIIGDLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDVKNFCLEFQILTRNVNFSNKRTLRLFQK 745
            +++E    +F+ LF S    ++  +L  +K   + EL T+L +PF  +E+  AL  M   KAPGPDG  ALF++ +W   G+DV    L       N+   N+  + L  K
Sbjct:  393 DVTECFAHYFENLFQSGNNCEMDPILNIVKPQITDELGTQLDAPFRREEVSAALAQMHPNKAPGPDGMNALFYQHFWDTIGEDVTTKVLNMLNNVDNIGAVNQTHIVLIPK 503          

HSP 3 Score: 63.929 bits (154), Expect = 1.797e-113
Identity = 30/60 (50.00%), Postives = 43/60 (71.67%), Query Frame = 1
Query:  718 QTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            QT+I LIPK  +  + V+FRPISLC V+YK VAK + N ++ V+   I+++QS F+ GRL
Sbjct:  495 QTHIVLIPKKKHCESPVDFRPISLCNVLYKIVAKVLANRMKMVLPMVIHESQSGFVPGRL 554          

HSP 4 Score: 37.7354 bits (86), Expect = 1.797e-113
Identity = 18/50 (36.00%), Postives = 30/50 (60.00%), Query Frame = 1
Query:  283 KHKMY*EQMARVNWLKFGYKNFVFFHKFTSARKRRNIISMLELRN*RGCY 432
            + ++Y  Q +R +W+K G KN  FFH+  S R++RN +    +RN  G +
Sbjct:  340 REEVYWHQRSRQDWIKSGDKNTKFFHQKASHREQRNNVR--RIRNEAGEW 387          

HSP 5 Score: 28.4906 bits (62), Expect = 1.797e-113
Identity = 14/34 (41.18%), Postives = 21/34 (61.76%), Query Frame = 2
Query: 2201 SSRILRIPLAREPHDDFMVCSGEPSGEFSVRSAY 2302
            S+ I RIP+A +   D  +     +G+F+VRSAY
Sbjct:  995 STAIQRIPVALQKKPDQWMWMMSKNGQFTVRSAY 1028          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: Q7XCU0_ORYSJ (Retrotransposon protein, putative, unclassified OS=Oryza sativa subsp. japonica GN=LOC_Os10g37170 PE=4 SV=2)

HSP 1 Score: 303.523 bits (776), Expect = 6.442e-112
Identity = 165/446 (37.00%), Postives = 248/446 (55.61%), Query Frame = 3
Query:  894 II*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMTVE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHL-FADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGRRKESFLN-LKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIPGAINFRLSSVPFTMTDFKVADLINSAERKWKGELIVDTFGEEVAGSFVSL 2225
            +I D+ L+AYE LH+  ++   N        ++     VE  +L   + ++GF++DW+  VM+C+++  YAV ING   +   P+RG+RQGDP+SP+LFL+C+EGLS L+      G L+GIK  R G  ISHL FADD I F +A +R    +K  L+ Y S SGQ  N  KS++F+       +K  +   L V      + Y G+P+ +G    +F   L ERI  +  G + R LS+   +  +K+V QAIP Y MSCF +  S+C +++   A  WW    GK+ +HW  W  +  PK   GMG R  + FN A+L +Q  RL+T+PDSL +RV K +YFPN  F  +      S+ W+++   + +LAKG+ W VG G    I +D WIPG     ++++    TD  V+ L+N   R W G+LI   F  ++A   + +
Sbjct:  518 LITDSALVAYECLHTIRKQHNKNPFFALKIDMMKAYDRVEWAYLSGCLSKLGFSQDWINTVMRCVSSVRYAVKINGELTKPVVPSRGIRQGDPISPYLFLLCTEGLSCLLHKKEVAGELQGIKNGRHGPPISHLLFADDSIFFAKADSRNVQALKNTLRSYCSASGQKINLHKSSIFFGKRCPDAVKISVKSCLQVDNEVLQDSYLGMPTEIGLATTNFFKFLPERIWKRVNGWTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWWGFEDGKKKMHWKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPNSSFWEAAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPGFRPQLVTTLSPFPTDATVSCLMNEDARCWDGDLIRSLFPVDIAKEILQI 963          

HSP 2 Score: 69.3218 bits (168), Expect = 6.442e-112
Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 2
Query:  395 SPCWSLE-ISEAATIFFQRLFTSNIIGDLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDVKN 670
            S C S E I   A +F++ LF+S     +  +L  I       +N +L   +  +EIKTAL  M STKAPGPDGFPALF++ +W I  + + N
Sbjct:  350 SRCISQEGIKRMAEVFYENLFSSEPCDSMEEVLDAIPNKVGDFINGELGKQYTNEEIKTALFQMGSTKAPGPDGFPALFYQTHWGILEEHICN 442          

HSP 3 Score: 52.7582 bits (125), Expect = 6.442e-112
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  670 FLFGISNSDQKCEFFKQTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            FL G    +  C+    + + LIPK  N   L  FRPISLC V+YK  +K + N L+  +   + + QSAF+ GRL
Sbjct:  447 FLLGEEIPEGLCD----SVVVLIPKVNNASHLSKFRPISLCNVLYKIASKVLANRLKPFLPDIVSEFQSAFVPGRL 518          

HSP 4 Score: 42.3578 bits (98), Expect = 6.442e-112
Identity = 22/63 (34.92%), Postives = 36/63 (57.14%), Query Frame = 1
Query:  229 PVFVFIIFLKRLLYMEI----DKHKMY*EQMARVNWLKFGYKNFVFFHKFTSARKRRNIISML 405
            PV   +I  ++L+  ++    +K ++   Q +RV+WL+ G +N  FFH   SAR+R N I  L
Sbjct:  282 PVNDVVIQEEKLIEQQLCELFEKEEIMARQRSRVDWLREGDRNTAFFHARASARRRTNRIKEL 344          

HSP 5 Score: 30.8018 bits (68), Expect = 6.442e-112
Identity = 15/39 (38.46%), Postives = 23/39 (58.97%), Query Frame = 2
Query: 2201 SSRILRIPLAREPHDDFMVCSGEPSGEFSVRSAYKLLQT 2317
            +  IL+IP++R    DF     +  G +SVRSAY L ++
Sbjct:  957 AKEILQIPISRHGDADFASWPHDKLGLYSVRSAYNLARS 995          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: Q9FW98_ORYSJ (Putative non-LTR retroelement reverse transcriptase OS=Oryza sativa subsp. japonica GN=OSJNBa0026L12.31 PE=4 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 6.709e-112
Identity = 165/446 (37.00%), Postives = 248/446 (55.61%), Query Frame = 3
Query:  894 II*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMTVE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHL-FADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGRRKESFLN-LKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIPGAINFRLSSVPFTMTDFKVADLINSAERKWKGELIVDTFGEEVAGSFVSL 2225
            +I D+ L+AYE LH+  ++   N        ++     VE  +L   + ++GF++DW+  VM+C+++  YAV ING   +   P+RG+RQGDP+SP+LFL+C+EGLS L+      G L+GIK  R G  ISHL FADD I F +A +R    +K  L+ Y S SGQ  N  KS++F+       +K  +   L V      + Y G+P+ +G    +F   L ERI  +  G + R LS+   +  +K+V QAIP Y MSCF +  S+C +++   A  WW    GK+ +HW  W  +  PK   GMG R  + FN A+L +Q  RL+T+PDSL +RV K +YFPN  F  +      S+ W+++   + +LAKG+ W VG G    I +D WIPG     ++++    TD  V+ L+N   R W G+LI   F  ++A   + +
Sbjct:  561 LITDSALVAYECLHTIRKQHNKNPFFALKIDMMKAYDRVEWAYLSGCLSKLGFSQDWINTVMRCVSSVRYAVKINGELTKPVVPSRGIRQGDPISPYLFLLCTEGLSCLLHKKEVAGELQGIKNGRHGPPISHLLFADDSIFFAKADSRNVQALKNTLRSYCSASGQKINLHKSSIFFGKRCPDAVKISVKSCLQVDNEVLQDSYLGMPTEIGLATTNFFKFLPERIWKRVNGWTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWWGFEDGKKKMHWKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPNSSFWEAAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPGFRPQLVTTLSPFPTDATVSCLMNEDARCWDGDLIRSLFPVDIAKEILQI 1006          

HSP 2 Score: 69.3218 bits (168), Expect = 6.709e-112
Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 2
Query:  395 SPCWSLE-ISEAATIFFQRLFTSNIIGDLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDVKN 670
            S C S E I   A +F++ LF+S     +  +L  I       +N +L   +  +EIKTAL  M STKAPGPDGFPALF++ +W I  + + N
Sbjct:  393 SRCISQEGIKRMAEVFYENLFSSEPCDSMEEVLDAIPNKVGDFINGELGKQYTNEEIKTALFQMGSTKAPGPDGFPALFYQTHWGILEEHICN 485          

HSP 3 Score: 52.7582 bits (125), Expect = 6.709e-112
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  670 FLFGISNSDQKCEFFKQTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            FL G    +  C+    + + LIPK  N   L  FRPISLC V+YK  +K + N L+  +   + + QSAF+ GRL
Sbjct:  490 FLLGEEIPEGLCD----SVVVLIPKVNNASHLSKFRPISLCNVLYKIASKVLANRLKPFLPDIVSEFQSAFVPGRL 561          

HSP 4 Score: 42.3578 bits (98), Expect = 6.709e-112
Identity = 22/63 (34.92%), Postives = 36/63 (57.14%), Query Frame = 1
Query:  229 PVFVFIIFLKRLLYMEI----DKHKMY*EQMARVNWLKFGYKNFVFFHKFTSARKRRNIISML 405
            PV   +I  ++L+  ++    +K ++   Q +RV+WL+ G +N  FFH   SAR+R N I  L
Sbjct:  325 PVNDVVIQEEKLIEQQLCELFEKEEIMARQRSRVDWLREGDRNTAFFHARASARRRTNRIKEL 387          

HSP 5 Score: 30.8018 bits (68), Expect = 6.709e-112
Identity = 15/39 (38.46%), Postives = 23/39 (58.97%), Query Frame = 2
Query: 2201 SSRILRIPLAREPHDDFMVCSGEPSGEFSVRSAYKLLQT 2317
            +  IL+IP++R    DF     +  G +SVRSAY L ++
Sbjct: 1000 AKEILQIPISRHGDADFASWPHDKLGLYSVRSAYNLARS 1038          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: C5XL09_SORBI (Putative uncharacterized protein Sb03g001780 OS=Sorghum bicolor GN=Sb03g001780 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.027e-110
Identity = 172/453 (37.97%), Postives = 264/453 (58.28%), Query Frame = 3
Query:  876 CFHSREII*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMT-VE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHLF-ADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGR-RKESFLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIPGAINFRLSSVPFTMTDFKVADLINSAERKWKGELIVDTFGEEVAGSFVSL 2225
             F    +I DNVLLAYEI+H     + G   +    L + K    VE  FL+ +M +MGF   WV L+MKC+TT +Y + +N S  +   P RGLRQGDPLSP+LF++C+EGLS +++ A  +G ++GIK CR   +++HLF ADD ++   A    A+ ++ IL  Y+  SGQ  N EKS++ +S  +    ++ +   L +    + EKY GLP  +G+ RK+ F  +K++I  + +G   +LLS+  K+I IK+V Q+IPTYAMSCF L   LC E+  I  ++WW +      IHW  W+ +   KE+ G+G R++  FN+A+L++Q  RL+TNPDSL  +V KA+YFP+ D L+     + SY W++I     +L +G+ W++G G N  I    WIP  I  +  +        +V +LIN    +W  +L+ D F  + A   + +
Sbjct:  120 AFVPGRLITDNVLLAYEIVHHLKSIKKGAGGLAAIKLDMSKAYDRVEWSFLENMMRKMGFDEKWVQLIMKCVTTVTYKIKVNDSYTQKIFPQRGLRQGDPLSPYLFIICAEGLSAMLQKAEQKGKIEGIKICRGAPKVNHLFFADDSLILMRARASDALELRRILDVYEKASGQVINKEKSSMMFSPNTGQHDRSLMRSNLSITDEASTEKYLGLPVNIGKSRKKPFEYIKKKIWSRIQGWQEKLLSKAGKEILIKAVAQSIPTYAMSCFDLTKGLCDELSSIIGRYWWSQQDKANKIHWISWEKLTQSKEKGGLGFRDLHLFNLAMLSRQAWRLLTNPDSLCGQVLKARYFPHSDILHCSPRPRISYTWRSILKGVALLKEGIIWRIGNGKNVKIWEHPWIPKGITRKPITPRGASLLTRVNELINPVTGEWDEQLVNDLFWPQDAEEILQI 572          

HSP 2 Score: 63.1586 bits (152), Expect = 1.027e-110
Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 1
Query:  667 KFLFGISNSDQKCEFFKQTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            K +  + N     E +  T I LIPK+  P+ L + RPISLC V+YK ++K + N L+ ++   I  +QSAF+ GRL
Sbjct:   50 KEVLAVLNGGPIPEGWNDTIIVLIPKTNTPQMLKDLRPISLCNVLYKLISKVLANRLKKILPNIISNSQSAFVPGRL 126          

HSP 3 Score: 50.447 bits (119), Expect = 1.027e-110
Identity = 21/53 (39.62%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  521 LNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDVKNFCL 679
            +N  L  PF   EI  AL  +   KAPG DG P++F++++W + G  VK   L
Sbjct:    1 MNKDLLLPFTGDEIWNALDNIGDLKAPGADGIPSIFYKKFWSVVGDQVKKEVL 53          

HSP 4 Score: 30.4166 bits (67), Expect = 1.027e-110
Identity = 15/36 (41.67%), Postives = 24/36 (66.67%), Query Frame = 2
Query: 2201 SSRILRIPLAREPHDDFMVCSGEPSGEFSVRSAYKL 2308
            +  IL+IP+  E  +D++    + +G FSV+SAYKL
Sbjct:  566 AEEILQIPI-DEHMEDWLAWHFDATGLFSVKSAYKL 600          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: B8AWH5_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_20882 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 2.185e-110
Identity = 164/397 (41.31%), Postives = 226/397 (56.93%), Query Frame = 3
Query:  894 II*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMT-VE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHL-FADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGRR-KESFLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIP 2075
            +I DN +LA+E  HS  + R          L L K    V+ GFL+  + ++GF   WV  +M CITT  Y+V  NG+    F P+RGLRQGDPLSPFLFL  ++GLSLL+   + +G L  +K CR+   ISHL FADD +LF +A   +A  +KE++ +Y S +GQ  N  K ++ +   S    ++ I   L +  S+  ++Y G P+  GR  K  F +L+ERI  +       LLS G K++ IKSV+QAIP Y M  F L  S+C E+  +   FWW    GKR  HW  W+ +  PK   G+G R+   FN ALLA+Q  RLI NPDSL  RV KAKYFPN   +++  G   S VWK I     +L +G+ W++G G +  I  D W+P
Sbjct: 1248 MITDNAILAFECFHSIQKNRKPESAACAYKLDLSKAYDRVDWGFLEQSLYKLGFAHRWVRWIMVCITTVRYSVKFNGTLLSTFAPSRGLRQGDPLSPFLFLFIADGLSLLLEDKVAQGALSPVKICRQAPGISHLLFADDTLLFFKADNVQAQAVKEVISDYASATGQLINPAKCSIMFGESSPPQTRDAIRVTLQIANSSFEDRYLGFPTPEGRMCKGKFQSLQERIWKRLIIWGENLLSSGGKEVLIKSVIQAIPVYVMGIFKLPESVCEELTKLTRNFWWGVEKGKRKTHWKSWECLTRPKSNGGLGFRDFRLFNQALLARQAWRLIVNPDSLCARVLKAKYFPNGSLVDTSFGGNASPVWKAIEYGLSLLKEGIIWRIGNGKSVRIWRDPWLP 1644          

HSP 2 Score: 63.1586 bits (152), Expect = 2.185e-110
Identity = 31/64 (48.44%), Postives = 40/64 (62.50%), Query Frame = 1
Query:  706 EFFKQTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            E    T I LIPK   P  L +FRPISLC VIYK V+K + N L+ ++   +   QSAF+LGR+
Sbjct: 1185 EGVNDTAIVLIPKIEQPMELRDFRPISLCNVIYKVVSKCLVNRLRPILDELVSPCQSAFVLGRM 1248          

HSP 3 Score: 59.6918 bits (143), Expect = 2.185e-110
Identity = 28/84 (33.33%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  413 EISEAATIFFQRLFTSNIIGDLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDV 664
            ++ + AT +F+ +F+++ + D S +   I++  S  +N  L S F  +EI  A+  +   KA GPDGFPA F++R+W     D+
Sbjct: 1087 KLEDMATEYFKEVFSADPLLDQSKVTRLIQRKVSPAMNETLCSEFKEEEISNAMFQIGPLKALGPDGFPARFYQRHWGFMKNDI 1170          

HSP 4 Score: 38.5058 bits (88), Expect = 2.185e-110
Identity = 23/54 (42.59%), Postives = 30/54 (55.56%), Query Frame = 1
Query:  253 LKRLLYMEIDKHKMY*EQMARVNWLKFGYKNFVFFHKFTSARKRRNIISMLELR 414
            L  LLY E    +M   Q +RVNWLK G +N  FFH     R ++N I+ L+ R
Sbjct: 1028 LHELLYRE----EMLWLQRSRVNWLKEGDRNTRFFHSKAVWRAKKNRITKLKDR 1077          

HSP 5 Score: 31.5722 bits (70), Expect = 2.185e-110
Identity = 19/48 (39.58%), Postives = 26/48 (54.17%), Query Frame = 2
Query: 2165 ERRVNC*YLWGRSSRILRIPLAREPHDDFMVCSGEPSGEFSVRSAYKL 2308
            E RVN  +L   +  I  I ++    DDF+    +  G+FSVRSAY L
Sbjct: 1675 ETRVNQVFLPVDAETICSIRVSSRQEDDFVAWHPDKHGKFSVRSAYGL 1722          

HSP 6 Score: 290.426 bits (742), Expect = 1.841e-105
Identity = 160/385 (41.56%), Postives = 219/385 (56.88%), Query Frame = 3
Query:  894 II*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMT-VE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHL-FADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGRR-KESFLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTG 2039
            +I DN +LA+E  HS  + R          L L K    V+ GFL+  + ++GF   WV  +M CITT  Y+V  NG+    F P+RGLRQGDPLSPFLFL  ++GLSLL+   + +G L  +K CR+   ISHL FADD +LF +A   +A  +KE++ +Y S +GQ  N  K ++ +   S    ++ I   L +  S   ++Y G P+  GR  K  F +L+ERI  +       LLS G K++ IKSV+QAIP Y M  F L  S+C E+  +   FWW    GKR  HW  W+ +  PK   G+G R+   FN ALLA+Q  RLI NPDSL  RV KAKYFPN   +++  G   S VWK I     +L +G+ W++G G
Sbjct:  550 MITDNAILAFECFHSIQKNRKPESAACAYKLDLSKAYDRVDWGFLEQSLYKLGFAHRWVRWIMVCITTVRYSVKFNGTLLSTFAPSRGLRQGDPLSPFLFLFIADGLSLLLEDKVAQGALSPVKICRQAPGISHLLFADDTLLFFKADNVQAQAVKEVISDYASATGQLINPAKCSIMFGESSPPQTRDAIRVTLQIANSGFEDRYLGFPTPEGRMCKGKFQSLQERIWKRLIIWGENLLSSGGKEVLIKSVIQAIPVYVMGIFKLPESVCEELTKLTRNFWWGVEKGKRKTHWKSWECLTRPKSNGGLGFRDFRLFNQALLARQAWRLIVNPDSLCARVLKAKYFPNGSLVDTSFGGNASPVWKAIEYGLSLLKEGIIWRIGNG 934          

HSP 7 Score: 63.929 bits (154), Expect = 1.841e-105
Identity = 29/84 (34.52%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  413 EISEAATIFFQRLFTSNIIGDLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDV 664
            ++ + AT +F+ +F+++ + D S +   I++  S  +N  L S F  +EI  A+  +   KAPGPDGFPA F++R+W     D+
Sbjct:  389 KLEDMATEYFKEVFSADPLLDQSKVTRLIQRKVSPAMNETLCSEFKEEEISNAMFQIGPLKAPGPDGFPARFYQRHWGFMKNDI 472          

HSP 8 Score: 63.1586 bits (152), Expect = 1.841e-105
Identity = 31/64 (48.44%), Postives = 40/64 (62.50%), Query Frame = 1
Query:  706 EFFKQTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            E    T I LIPK   P  L +FRPISLC VIYK V+K + N L+ ++   +   QSAF+LGR+
Sbjct:  487 EGVNDTAIVLIPKIEQPMELRDFRPISLCNVIYKVVSKCLVNRLRPILDELVSPCQSAFVLGRM 550          

HSP 9 Score: 38.5058 bits (88), Expect = 1.841e-105
Identity = 23/54 (42.59%), Postives = 30/54 (55.56%), Query Frame = 1
Query:  253 LKRLLYMEIDKHKMY*EQMARVNWLKFGYKNFVFFHKFTSARKRRNIISMLELR 414
            L  LLY E    +M   Q +RVNWLK G +N  FFH     R ++N I+ L+ R
Sbjct:  330 LHELLYRE----EMLWLQRSRVNWLKEGDRNTRFFHSKAVWRAKKNRITKLKDR 379          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: M5XHI9_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa019733mg PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 4.973e-108
Identity = 177/444 (39.86%), Postives = 248/444 (55.86%), Query Frame = 3
Query:  876 CFHSREII*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMT-VE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHLF-ADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGRRKES-FLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIPGAINFRLSSVPFT-MTDFKVADLI-NSAERKWKGELIVDTF 2192
             F    +I DN ++A+EI H   Q+R G +      L + K    VE  FL+ +ML MGF   WV +VM C+TT SY+  +NG   RI  PTRGLRQGDPLSP+LFL+C+EG + L+  A  +G L+GI  CR    +SHLF ADD  +F +AT                    CG         ++I   D ++ ++  LGV    +   Y GLP M+GR K   F  LKER+  K +G   + LS   K++ +K V Q+IP Y MSCF L   LC EIE + A+FWW +    R IHW +W+ +C  K E GMG R +  FN+A+LAKQG RL+ NP SL +R+ KAKYFP  +F  + LG++ S VWK+IW  + +L  G  +++G G +  I  D W+P    F + + P   M + KV++LI N    +W  + + + F
Sbjct:  503 AFVPGRLIIDNSIVAFEIAHFLKQRRRGRKGSLALKLDMSKAYDRVEWEFLEKMMLAMGFPILWVRMVMDCVTTVSYSFLVNGEPTRILYPTRGLRQGDPLSPYLFLLCAEGFTTLLSKAERQGQLQGIVICRGAPTVSHLFFADDSFVFAKAT-----------------DNNCG--------VANIHM-DTQSRLASVLGVPRVDSHATYLGLPMMLGRNKTVCFRYLKERVWKKLQGWREQTLSIAGKEVLLKVVAQSIPLYVMSCFLLPQGLCHEIEQMMARFWWGQQGENRKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLLKAKYFPQTNFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPATFAVITSPLDGMENTKVSELICNEGSPQWDLQKLNNLF 920          

HSP 2 Score: 64.6994 bits (156), Expect = 4.973e-108
Identity = 31/91 (34.07%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  401 CWSLE---ISEAATIFFQRLFTSNIIGDLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDV 664
            CW      I+     +F  LF S+    +  +L  ++   + ++   L + F+ +EIK A+  M+ +KAPGPDG P LF+++YW I G DV
Sbjct:  341 CWRTSRQGITSIVIDYFGDLFRSSGSSMMEEILSALEPKVTADMQQVLIADFSYQEIKDAVFQMQPSKAPGPDGLPPLFYQKYWRIVGDDV 431          

HSP 3 Score: 63.1586 bits (152), Expect = 4.973e-108
Identity = 29/69 (42.03%), Postives = 43/69 (62.32%), Query Frame = 1
Query:  691 SDQKCEFFKQTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            S++       T++ LIPK   PRT+   RPISLC V+Y+  AK + N ++ V+   I ++QSAF+ GRL
Sbjct:  441 SNEMLRQLNHTFVTLIPKVKEPRTMAQLRPISLCNVLYRIGAKTLANRMKFVMQSVISESQSAFVPGRL 509          

HSP 4 Score: 27.7202 bits (60), Expect = 4.973e-108
Identity = 13/33 (39.39%), Postives = 22/33 (66.67%), Query Frame = 2
Query: 2210 ILRIPLAREPHDDFMVCSGEPSGEFSVRSAYKL 2308
            I+RIPL+     D +V + +  G F+V+SAY++
Sbjct:  928 IVRIPLSIRAPPDRIVWNYDKHGLFTVKSAYRV 960          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: F4NCJ6_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris PE=4 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 1.540e-106
Identity = 174/438 (39.73%), Postives = 258/438 (58.90%), Query Frame = 3
Query:  894 II*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMT-VE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHLF-ADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGRRKES-FLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIPGAINFRLSSVPFTMTDFKVADLINSAERKWKGELIVDTFGE 2198
            +I DN L+A E+ HS   +    +      L + K    VE GFL+ ++L MGF   WV L+M+ +++ +Y+  INGS      P RGLRQGDPLSP+LF+M ++  S +++  + +  L G K  R G EISHLF ADD +LF  A  ++  +I +IL +Y+  SGQ  N+EKS V YS       K+E++  L +R     EKY G+PS+ GR K++ F +L +RI  K +G   +LLS+  K++ +KSV+QAIPTY M  +     +  +I+   A+FWW     +R IHW  W  MC+ K   GMG ++++ FN ALL +Q  RL   P SL+ RV KAKYFPN DFLN+ LG+ +SY W +IW++K +L +G+ W+VG G   ++ +D W+       L+S P     + V++LI+    +WK  L+     E
Sbjct:  549 LITDNALIAMEVFHSMKNRNRSRKGTIAMKLDMSKAYDRVEWGFLRKLLLTMGFDGRWVNLIMEFVSSVTYSFIINGSVCGSVVPARGLRQGDPLSPYLFIMVADAFSKMIQRKVQDKQLHGAKASRSGPEISHLFFADDSLLFTRANRQECTIIVDILNQYELASGQKINYEKSEVSYSRGVSVSQKDELTNILNMRQVDRHEKYLGIPSISGRSKKAIFDSLIDRIWKKLQGWKEKLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQKIQSAMARFWWGSSDTQRKIHWKNWDSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREPQSLLGRVMKAKYFPNCDFLNAPLGHSSSYSWSSIWSSKALLKEGVIWRVGNGSQINMWSDPWVLDEGGRFLTSTPHASIRW-VSELIDFDRMEWKTSLLESFLNE 985          

HSP 2 Score: 72.7886 bits (177), Expect = 1.540e-106
Identity = 37/83 (44.58%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  431 TIFFQRLFTSNIIGDLS--HLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDVKNF 673
            T +F  +FTS+   DLS   ++  I+   + E N KL  PF+  EI  ALQ M   KAPGPDG   +F++R+WHI G DV +F
Sbjct:  392 TSYFSSIFTSSNPSDLSLEAVMSVIEPVVTEEHNLKLLEPFSKDEILAALQQMHPCKAPGPDGMHVIFYQRFWHIVGDDVTSF 474          

HSP 3 Score: 58.9214 bits (141), Expect = 1.540e-106
Identity = 30/59 (50.85%), Postives = 38/59 (64.41%), Query Frame = 1
Query:  721 TYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            T IALIPK  NP     FRPI+LC V+YK ++KAI   L+  +   I + QSAF+ GRL
Sbjct:  491 TNIALIPKVKNPTKAAEFRPIALCNVLYKLMSKAIVMRLKSFLPEIISENQSAFVPGRL 549          

HSP 4 Score: 33.113 bits (74), Expect = 1.540e-106
Identity = 19/53 (35.85%), Postives = 28/53 (52.83%), Query Frame = 1
Query:  247 IFLKRLLYMEIDKHKMY*EQMARVNWLKFGYKNFVFFHKFTSARKRRNIISML 405
            + L++ L     KH+ Y    +RV  +K G KN  +FH   S RK+RN +  L
Sbjct:  321 VLLEKKLDELHAKHEAYWYLRSRVAEVKDGDKNTKYFHHKASQRKKRNFVKGL 373          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: B9FC76_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_15963 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 2.171e-106
Identity = 160/447 (35.79%), Postives = 239/447 (53.47%), Query Frame = 3
Query:  894 II*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMT-VE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHL-FADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGRRK-ESFLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIPGAINFRLSSVPFTMTDFKVADLINSAERKWKGELIVDTFGEEVAGSFVSL 2225
            +I DN L+A+E  HS  +    ++D     L L K    V+ GFL   + ++GF   W   +M C+T+  Y+V +NG+    F PTRGLR+GDPL+P+LFL  ++GLS +++    E  ++ +K CR    +SHL FADD +LF +A   +A  IKE L  Y+ C+GQ  N ++ ++ +S++   + ++ I   L V  +   +K  GLP+  GR K E F  +KER   +    S R LS   K+  IKSV QA+PTY M  F +    C E E +   FWW    G++ +HW  W+ +  PK   G+G R++  FN ALLA+Q  RLI +PDSL  RV KAKY+PN    ++   + +S  WK I     +L KGL W++G G    I  + W+    N ++           V +LI +  + W   LI     EE A   + +
Sbjct:  797 MITDNALVAFECFHSIHKCTRESQDFCALKLDLSKAYDRVDWGFLDGALQKLGFGNIWRKWIMSCVTSVRYSVRLNGNMLEPFYPTRGLREGDPLNPYLFLFIADGLSNILQRRRDERQIQPLKVCRSAPGVSHLLFADDSLLFFKAEVIQATRIKEALDLYERCTGQLINPKECSLLFSALCPQERQDGIKAVLQVERTCFDDKCLGLPTPDGRMKAEQFQPIKERFEKRLTDWSERFLSLAGKEALIKSVAQALPTYTMGVFKMPERFCEEYEQLVRNFWWGHEKGEKKVHWIAWEKLTSPKLLGGLGFRDIRCFNQALLARQAWRLIESPDSLCARVLKAKYYPNGTITDTAFPSVSSPTWKGIVHGLELLKKGLIWRIGDGSKTKIWRNHWVAHGENLKILEKKTWNRLIYVRELIVTDTKTWNEPLIRHIIREEDADEILKI 1243          

HSP 2 Score: 68.1662 bits (165), Expect = 2.171e-106
Identity = 36/91 (39.56%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  413 EISEAATIFFQRLFTSNIIGDLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDVKNFCLEF 685
            E+ E A  FF+ L+T +   +   LL   +   + E+N  L+ PF  +EI  AL  +   KAPGPDGFPA FF+R W +  +DV     EF
Sbjct:  636 ELGEIARSFFRDLYTKDESLNPGELLNMFEPKITDEMNGMLTKPFTDEEISDALFQIGPLKAPGPDGFPARFFQRNWGVLKRDVIEGVREF 726          

HSP 3 Score: 59.6918 bits (143), Expect = 2.171e-106
Identity = 29/64 (45.31%), Postives = 41/64 (64.06%), Query Frame = 1
Query:  706 EFFKQTYIALIPKSPNPRTLVNFRPISLCTVIYKFVAKAITNCLQDVIG*CIYQAQSAFILGRL 897
            E    T I +IPK+  P  + +FRP+SLC VIYK VAK + N L+ ++   I + QSAF+ GR+
Sbjct:  734 EGMNDTVIVMIPKTNAPVEMKDFRPVSLCNVIYKVVAKCLVNRLRPLLQEIISETQSAFVPGRM 797          

HSP 4 Score: 44.2838 bits (103), Expect = 2.171e-106
Identity = 24/74 (32.43%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  184 EMTTSHLVEKDQS*LPVFVFIIFLKRLLYMEIDKHKMY*EQMARVNWLKFGYKNFVFFHKFTSARKRRNIISML 405
            E+    +  ++ S   V    IFL+ LL+ E    +++ +Q +R+ WLK G +N  +FH   S R R+N+I  L
Sbjct:  554 ELEEMRMRGREDSEPDVHRLKIFLQELLHRE----EIWWKQRSRITWLKEGDRNTRYFHLKASWRARKNLIKKL 623          

HSP 5 Score: 29.6462 bits (65), Expect = 2.171e-106
Identity = 14/36 (38.89%), Postives = 21/36 (58.33%), Query Frame = 2
Query: 2201 SSRILRIPLAREPHDDFMVCSGEPSGEFSVRSAYKL 2308
            +  IL+I + +   +DF     E +G FSVRS Y+L
Sbjct: 1237 ADEILKIRIPQREEEDFPAWHYEKTGIFSVRSVYRL 1272          
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Match: Q2QQV8_ORYSJ (Retrotransposon protein, putative, unclassified OS=Oryza sativa subsp. japonica GN=LOC_Os12g29700 PE=4 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 2.061e-104
Identity = 180/453 (39.74%), Postives = 255/453 (56.29%), Query Frame = 3
Query:  876 CFHSREII*DNVLLAYEILHSFCQKRTGNRDIWQ*NLILGKLMT-VE*GFLQAIMLQMGFTRDWVALVMKCITTTSYAVNINGSRARIF*PTRGLRQGDPLSPFLFLMCSEGLSLLMRLAMGEGLLKGIKTCRRGLEISHL-FADDCILFDEATTRKAMMIKEILKEYKSCSGQCGNFEKSTVFYSSISKGDMKNEISEFLGVRVSTNLEKYFGLPSMVGR-RKESFLNLKERISWKFEGRSGRLLSQGVKDIFIKSVLQAIPTYAMSCFFLRNSLCGEIEMIFAKFWWQKGYGKRGIHWCQWKHMCHPKEEYGMGLRNMSQFNIALLAKQG*RLITNPDSLVTRVFKAKYFPNEDFLNSCLGNKNSYVWKNIWATKGILAKGLCWKVGTGLNFSIANDAWIPGAINFRLSSVPFTMTDFKVADLINSAERKWKGELIVDTFGEEVAGSFVSL 2225
             F    +I DN+L+A E+ H    KR+G        L + K    VE  FL  ++L++GF  DWV L+MKC++T +Y + +NG  +  F P RGLRQGDPLSP+LFL+C+EG S L+     EG L GI+ C+    +SHL FADD ++   A   +A  ++ IL+ Y+ CSGQ  N +KS V +S  +    K  +   L ++  T  E+Y GLP  VGR R + F  LKERI  + +G   +LLS+  K+I IK+V QAIPT+AM CF L   LC +I  + AK+WW        +HW  W  +  PK   G+G R++  FN+A+LAKQG RLI +PDSL +RV +AKYFP  D       +  SY W++I     +L  G+ W+VG G   +I  D WIP   + +  +        KV +LI+     W  +L+  TF EE   +  S+
Sbjct:  795 AFVPGRLISDNILIADEMTHYMRNKRSGQVGYAAFKLDMSKAYDRVEWSFLHDMILKLGFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPGRGLRQGDPLSPYLFLLCAEGFSALLSKTEEEGRLHGIRICQGAPSVSHLLFADDSLILCRANGGEAQQLQTILQIYEECSGQVINKDKSAVMFSPNTSSLEKRAVMAALNMQRETTNERYLGLPVFVGRSRTKIFSYLKERIWQRIQGWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWWSNQEKDNKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYFPLGDCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGWSRKPMTPRGANLVTKVEELIDPYTGTWDEDLLSQTFWEEDVAAIKSI 1247          

HSP 2 Score: 67.781 bits (164), Expect = 2.061e-104
Identity = 43/115 (37.39%), Postives = 60/115 (52.17%), Query Frame = 2
Query:  437 FFQRLFTSNIIGDLSHLLMGIKKSFSYELNTKLSSPFNAKEIKTALQGMESTKAPGPDGFPALFFRRYWHIAGKDVKNFCLEFQILTRNVNFSNKRTLRLFQKVQIPEH*LILDL 781
            FF++LFTSN   +   LL  + +  S  +N  L + F  +E+K AL  +   KAPGPDG PA F++  W + G+ V +  LE           N  T+ L  KV+ PE  LI DL
Sbjct:  648 FFKQLFTSNGGQNSQKLLDVVDRKVSGAMNESLRAEFTREEVKEALDAIGDLKAPGPDGMPAGFYKACWDVVGEKVTDEVLEVLRGGAIPEGWNDITIVLIPKVKKPE--LIKDL 760          

HSP 3 Score: 38.891 bits (89), Expect = 2.061e-104
Identity = 18/38 (47.37%), Postives = 23/38 (60.53%), Query Frame = 1
Query:  292 MY*EQMARVNWLKFGYKNFVFFHKFTSARKRRNIISML 405
            +Y +Q A  NWL  G +N  FFH   S R+RRN I+ L
Sbjct:  590 IYWKQRAHTNWLNKGDRNTSFFHASCSERRRRNRINKL 627          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 6
Match NameE-valueIdentityDescription
M310_ARATH4.547e-2937.76Uncharacterized mitochondrial protein AtMg00310 OS... [more]
LIN1_NYCCO6.022e-2126.00LINE-1 reverse transcriptase homolog OS=Nycticebus... [more]
RNHX1_ARATH2.105e-1629.03Putative ribonuclease H protein At1g65750 OS=Arabi... [more]
M1250_ARATH1.923e-1253.03Uncharacterized mitochondrial protein AtMg01250 OS... [more]
YTX2_XENLA1.220e-1036.71Transposon TX1 uncharacterized 149 kDa protein OS=... [more]
LORF2_MOUSE8.609e-928.75LINE-1 retrotransposable element ORF2 protein OS=M... [more]
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092164 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
W5HDK0_WHEAT4.584e-12240.18Uncharacterized protein OS=Triticum aestivum PE=4 ... [more]
F4NCI4_BETVU1.797e-11339.41Uncharacterized protein OS=Beta vulgaris subsp. vu... [more]
Q7XCU0_ORYSJ6.442e-11237.00Retrotransposon protein, putative, unclassified OS... [more]
Q9FW98_ORYSJ6.709e-11237.00Putative non-LTR retroelement reverse transcriptas... [more]
C5XL09_SORBI1.027e-11037.97Putative uncharacterized protein Sb03g001780 OS=So... [more]
B8AWH5_ORYSI2.185e-11041.31Putative uncharacterized protein OS=Oryza sativa s... [more]
M5XHI9_PRUPE4.973e-10839.86Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
F4NCJ6_BETVU1.540e-10639.73Uncharacterized protein OS=Beta vulgaris subsp. vu... [more]
B9FC76_ORYSJ2.171e-10635.79Putative uncharacterized protein OS=Oryza sativa s... [more]
Q2QQV8_ORYSJ2.061e-10439.74Retrotransposon protein, putative, unclassified OS... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR19446REVERSE TRANSCRIPTASEScoord: 1..141
NoneNo IPR availablePANTHERPTHR19446:SF340REVERSE TRANSCRIPTASE-RELATEDcoord: 1..141

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092164 ID=g.barbadense_cottongen_reftransV1_0092164|Name=g.barbadense_cottongen_reftransV1_0092164|organism=Gossypium barbadense|type=contig|length=2359bp
CTTTCAAATTTTCAATCCTTGACACTAAGACACTAATTAATCAACTAGGT
ACCAATTTTAAACGTATCGACGTTACTAATCCTTCCTCGTGCGTGACCAA
CTCCCAAACCTATTTTCTTAATTTACGTAGAGCAAAATTATTTTTTAAAT
AAATAAAATTATTTATTAAAAAACTACTTTAACGAGATGACCACATCACA
CCTAGTCGAAAAGGATCAATCGTGACTACCGGTTTTTGTGTTCATCATTT
TTCTAAAAAGACTTCTTTATATGGAAATTGACAAACATAAAATGTATTGA
GAACAAATGGCAAGAGTAAATTGGCTAAAATTTGGGTACAAAAATTTTGT
ATTTTTTCATAAGTTCACCTCAGCTCGAAAACGAAGAAACATAATCTCCA
TGTTGGAGCTTAGAAATTAGCGAGGCTGCTACAATATTTTTTCAAAGGTT
GTTTACGTCAAACATAATTGGCGATCTGTCTCACTTGCTAATGGGTATTA
AAAAGAGTTTTTCTTATGAATTAAATACTAAACTTTCGTCACCGTTCAAT
GCAAAAGAAATTAAGACAGCTTTACAAGGTATGGAGTCTACTAAAGCACC
AGGTCCCGATGGTTTTCCAGCGTTATTTTTTCGGAGGTACTGGCACATTG
CTGGAAAAGACGTTAAAAATTTTTGTTTGGAATTTCAAATTCTGACCAGA
AATGTGAATTTTTCAAACAAACGTACATTGCGCTTATTCCAAAAAGTCCA
AATCCCAGAACACTAGTTAATTTTAGACCTATAAGCTTATGTACGGTTAT
CTACAAATTTGTGGCAAAAGCAATAACAAATTGTCTTCAAGATGTTATTG
GGTGATGTATTTATCAGGCACAAAGTGCTTTCATTCTCGGGAGATTATTT
AGGATAATGTTCTTCTAGCTTATGAAATCCTACATAGTTTTTGCCAGAAA
CGCACGGGTAATAGGGATATATGGCAGTGAAACTTAATATTAGGAAAGCT
TATGACAGTCGAATAGGGTTTTCTTCAGGCCATAATGTTACAGATGGGAT
TCACAAGAGACTGGGTGGCACTTGTTATGAAGTGCATTACTACAACCTCG
TATGCAGTAAATATTAACGGAAGTAGGGCAAGAATTTTTTAACCAACTAG
GGGGCTTCGACAAGGTGATCCTCTTAGCCCTTTTCTTTTTCTTATGTGCA
GTGAGGGTCTCTCATTATTGATGAGATTGGCAATGGGGGAAGGGCTATTA
AAAGGAATAAAGACTTGTAGAAGAGGCCTAGAGATTTCCCACCTTTTTGC
AGATGATTGCATTCTGTTCGACGAAGCAACAACAAGGAAAGCAATGATGA
TCAAAGAAATATTGAAGGAATATAAAAGCTGTTCAGGCCAATGTGGAAAT
TTTGAAAAATCAACAGTATTTTATAGTTCGATTTCAAAAGGAGACATGAA
GAACGAAATTTCAGAGTTCCTAGGAGTGAGGGTTTCAACAAACTTGGAGA
AATACTTCGGGCTCCCTAGCATGGTTGGCAGAAGAAAGGAGTCTTTTCTA
AACCTTAAGGAAAGGATTTCTTGGAAATTTGAAGGACGGAGTGGTAGACT
ATTATCACAAGGGGTAAAGGATATCTTCATCAAATCAGTTCTTCAAGCAA
TACCTACCTATGCTATGTCTTGTTTCTTCCTACGAAATTCATTGTGCGGA
GAAATTGAAATGATTTTCGCGAAATTCTGGTGGCAAAAAGGGTATGGAAA
GAGAGGTATTCATTGGTGCCAGTGGAAGCACATGTGTCACCCTAAGGAAG
AATATGGAATGGGCTTAAGGAATATGTCTCAATTTAATATAGCGCTTTTA
GCAAAACAAGGGTGAAGGCTTATAACCAATCCAGATTCTTTAGTTACGAG
AGTTTTTAAAGCGAAGTACTTCCCGAATGAGGATTTTTTAAATTCATGTT
TGGGGAATAAAAACTCGTATGTTTGGAAAAATATATGGGCGACTAAGGGT
ATCTTGGCAAAAGGTCTTTGTTGGAAGGTGGGTACGGGATTGAACTTCTC
TATTGCCAACGATGCATGGATTCCAGGTGCAATTAATTTTAGATTATCCT
CGGTTCCTTTTACTATGACAGATTTTAAAGTTGCTGATTTGATTAATAGT
GCTGAACGTAAATGGAAAGGAGAGTTAATTGTTGATACCTTTGGGGAAGA
AGTAGCAGGATCCTTCGTATCCCTCTGGCGAGAGAGCCTCACGATGATTT
CATGGTGTGTAGTGGTGAGCCGTCGGGAGAATTTTCAGTGCGGAGCGCCT
ACAAACTATTACAGACTTCGGATCCTAGAGCTTATGCTTTACAAAACATC
TATAGGGAT
back to top