g.barbadense_cottongen_reftransV1_0092163, g.barbadense_cottongen_reftransV1_0092163 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092163
Unique Nameg.barbadense_cottongen_reftransV1_0092163
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length3688
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Dt12chromosomeg.barbadense_cottongen_reftransV1_0092163:1..3685 .
Dt12:63326632..63333483 -
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: A0A0D2UC52_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G296700 PE=4 SV=1)

HSP 1 Score: 1655.96 bits (4287), Expect = 0.000e+0
Identity = 956/960 (99.58%), Postives = 959/960 (99.90%), Query Frame = 1
Query:  682 TVPPTAYITSSTPFTNALNVSVNISFTEXXXXXXXXXXXXVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFSTTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENKFFTGLKIASVGFLLYFVPQKLMKSFESTFPVFGLCMDTSTTGLPCDRNSSSSERAWPRQLREMAKASFSKDGSKAPTDPXXXXXXXXXXXXTKRXXXXXXXXXXXXXXXXXXXXXXXXXEAIFASNPRM 3561
            TVPPTAYITSSTPFTNALNVSVNISFTESCSGGGGFRCSSVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPILNSSTEILSSLSISKGTLLPITGENHGNRRFGFMVANISNIAIITISFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPVISSVISIFVTAIFLLTCFTAGLLTMSTASLQSVGAFSRPSSSLSSDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARS+EWSIPYFSLPWETGHVQP+MMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSLILLHAFLFFILKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPSGVVVGILLLGVVAFLLLSLFLFLSVGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFSTTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSEN+FFTGLKIASVGFLLYFVPQKLMKSFES FPVFGLCMDTSTTGLPCDRNSSSSERAWPRQLREMAKASFSKDGSKAPTDPSSSKSKWSGLWGTKRSGSSSLDSSLDYKSKSKSKGLYKDLEAIFASNPRM
Sbjct:  116 TVPPTAYITSSTPFTNALNVSVNISFTESCSGGGGFRCSSVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPILNSSTEILSSLSISKGTLLPITGENHGNRRFGFMVANISNIAIITISFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPVISSVISIFVTAIFLLTCFTAGLLTMSTASLQSVGAFSRPSSSLSSDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSIEWSIPYFSLPWETGHVQPIMMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSLILLHAFLFFILKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPSGVVVGILLLGVVAFLLLSLFLFLSVGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFSTTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENRFFTGLKIASVGFLLYFVPQKLMKSFESKFPVFGLCMDTSTTGLPCDRNSSSSERAWPRQLREMAKASFSKDGSKAPTDPSSSKSKWSGLWGTKRSGSSSLDSSLDYKSKSKSKGLYKDLEAIFASNPRM 1075          

HSP 2 Score: 218.394 bits (555), Expect = 1.056e-54
Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 2
Query:  305 MGFFNMSCLIXXXXXXXXXXXKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 646
            MGFFNMSCLILLSLVFSVLSFKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV
Sbjct:    1 MGFFNMSCLILLSLVFSVLSFKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 114          
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: A0A0D2T9D0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G296700 PE=4 SV=1)

HSP 1 Score: 1544.64 bits (3998), Expect = 0.000e+0
Identity = 913/960 (95.10%), Postives = 916/960 (95.42%), Query Frame = 1
Query:  682 TVPPTAYITSSTPFTNALNVSVNISFTEXXXXXXXXXXXXVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFSTTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENKFFTGLKIASVGFLLYFVPQKLMKSFESTFPVFGLCMDTSTTGLPCDRNSSSSERAWPRQLREMAKASFSKDGSKAPTDPXXXXXXXXXXXXTKRXXXXXXXXXXXXXXXXXXXXXXXXXEAIFASNPRM 3561
            TVPPTAYITSSTPFTNALNVSVNISFTESCSGGGGFRCSSVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHY                                           APILNSSTEILSSLSISKGTLLPITGENHGNRRFGFMVANISNIAIITISFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPVISSVISIFVTAIFLLTCFTAGLLTMSTASLQSVGAFSRPSSSLSSDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARS+EWSIPYFSLPWETGHVQP+MMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSLILLHAFLFFILKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPSGVVVGILLLGVVAFLLLSLFLFLSVGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFSTTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSEN+FFTGLKIASVGFLLYFVPQKLMKSFES FPVFGLCMDTSTTGLPCDRNSSSSERAWPRQLREMAKASFSKDGSKAPTDPSSSKSKWSGLWGTKRSGSSSLDSSLDYKSKSKSKGLYKDLEAIFASNPRM
Sbjct:  116 TVPPTAYITSSTPFTNALNVSVNISFTESCSGGGGFRCSSVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHY-------------------------------------------APILNSSTEILSSLSISKGTLLPITGENHGNRRFGFMVANISNIAIITISFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPVISSVISIFVTAIFLLTCFTAGLLTMSTASLQSVGAFSRPSSSLSSDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSIEWSIPYFSLPWETGHVQPIMMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSLILLHAFLFFILKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPSGVVVGILLLGVVAFLLLSLFLFLSVGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFSTTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENRFFTGLKIASVGFLLYFVPQKLMKSFESKFPVFGLCMDTSTTGLPCDRNSSSSERAWPRQLREMAKASFSKDGSKAPTDPSSSKSKWSGLWGTKRSGSSSLDSSLDYKSKSKSKGLYKDLEAIFASNPRM 1032          

HSP 2 Score: 218.394 bits (555), Expect = 9.093e-55
Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 2
Query:  305 MGFFNMSCLIXXXXXXXXXXXKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 646
            MGFFNMSCLILLSLVFSVLSFKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV
Sbjct:    1 MGFFNMSCLILLSLVFSVLSFKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 114          
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: A0A0B0MKZ5_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_23226 PE=4 SV=1)

HSP 1 Score: 1504.58 bits (3894), Expect = 0.000e+0
Identity = 863/874 (98.74%), Postives = 867/874 (99.20%), Query Frame = 1
Query:  940 MDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFSTTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENKFFTGLKIASVGFLLYFVPQKLMKSFESTFPVFGLCMDTSTTGLPCDRNSSSSERAWPRQLREMAKASFSKDGSKAPTDPXXXXXXXXXXXXTKRXXXXXXXXXXXXXXXXXXXXXXXXXEAIFASNPRM 3561
            MDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPILNSSTEILSSLSISKGTLLPITGENHGNRRFGFMVA ISNIAIITISFDANSTISRQGT VSPVAPVTFLYDSQRTAVRLSTTCRMRTRE NIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPVISSV+SIFVTAIFLLTCFTAGLLTMSTASLQSVGAFSRPSSSLSSDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARS+EWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQ NKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDR MFWLAVIGGSLILLHAFLFFILKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAAL+AGGTPSGVVVGILLLGVVAFLLLSLFLFLSVGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKE STTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSEN+FFTGLKIASVGFLLYFVPQKLMKSFES FPVFGLCMDTSTTGLPCDRNSSSSERAWPRQLREMAKASFSKDGSKAPTDPSSSKSKWSGLWGTKRSGSSSLDSSLDYKSKSKSKGLYKDLEAIFASNPRM
Sbjct:    1 MDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPILNSSTEILSSLSISKGTLLPITGENHGNRRFGFMVAKISNIAIITISFDANSTISRQGTPVSPVAPVTFLYDSQRTAVRLSTTCRMRTREDNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPVISSVMSIFVTAIFLLTCFTAGLLTMSTASLQSVGAFSRPSSSLSSDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSIEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQLNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRRMFWLAVIGGSLILLHAFLFFILKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALVAGGTPSGVVVGILLLGVVAFLLLSLFLFLSVGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKELSTTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENRFFTGLKIASVGFLLYFVPQKLMKSFESKFPVFGLCMDTSTTGLPCDRNSSSSERAWPRQLREMAKASFSKDGSKAPTDPSSSKSKWSGLWGTKRSGSSSLDSSLDYKSKSKSKGLYKDLEAIFASNPRM 874          
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: A0A061FUM2_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_012102 PE=4 SV=1)

HSP 1 Score: 1345.49 bits (3481), Expect = 0.000e+0
Identity = 757/931 (81.31%), Postives = 830/931 (89.15%), Query Frame = 1
Query:  670 FIIYTVPPTAYITSSTPFTNALNVSVNISFTEXXXXXXXXXXXXVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQPN----KIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFS----TTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENKFFTGLKIASVGFLLYFVPQKLMKSFESTFPVFGLCMD-TSTTGLPCDR--------NSSSSERAWPRQLREMAKASFSKDGSKAPTDP 3411
            + + TVPPTAY+TSS PFTNALNVSVNISFTESC GGGGFRCSSVNDCNLLVYGAGQVVPSSL ++EPNLKY LLV+ISSA++YGRLVLVMD +FCTD+AGN F RS NSSF VH+D+R+VFVDLR HVPEKLLQ+ S+ RT++ATNN+NNLKVYLYFSAPILNSS EILSSL+I +G LLPI+GE+HGNRRFGF+VANIS+IAI+TIS   NSTISRQGT VSPVAPVTFLYDSQRTAVRLSTT  MRTREHN+PISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAA IQADDDVVSV++PENVTGDVAGNKNLASNVL+VRHY+IP+ISSVISIF TA FLLTCF AGLLTMSTASLQSVGAFSRPS SLSSDP RILFRSACHIQ+FALSRWL VTLPVEYYE ARS+EWSIPYFSLPWETGH+QPVMMGSSP+  S SF SR YD  IS SFQP     K+AA VYG PL+ +EYRSFFE+QS+ PEA+YI D LHSNGWR+FDRS+FWLAVIGGSL+LLH FL+FILK K+RD EKQGSYGALIFPRFEIFLVI+ALPCICQA+AAL+AGGTPSGVVVGILLLGVVAF+LLSL LFLSVGIT GKLLQYKEVHREGQQFHWYQ++IRVTLGPGKRGQWTWK +ANSV+LTMFGPLFEDLRGPPKYMVSQISG N SRQG  IIASDDETEDAEAPFIQKLFGILRIYYT+LES +R +LG+LAGAYL  NN  SKTP++ILLC+TSFQLFFLVLKKPFIKKKVQLVEIISLSCEV MFATCFVLL+KEFS    T IGIFML LFL GFLAQM  E YALYEQTKQ+DT+ N F TGLKIAS+GFLLYF+PQKLMKSFES FP F    + T+ TG+P DR        +S + E+ WP+QLREMAKASFSKDGSK PTDP
Sbjct:  112 WTVDTVPPTAYVTSSAPFTNALNVSVNISFTESCPGGGGFRCSSVNDCNLLVYGAGQVVPSSLIILEPNLKYSLLVAISSAAQYGRLVLVMDRSFCTDSAGNTFTRSANSSFQVHFDRRSVFVDLRTHVPEKLLQVNSKIRTVRATNNHNNLKVYLYFSAPILNSSAEILSSLNIRQGRLLPISGEHHGNRRFGFLVANISDIAIVTISLTPNSTISRQGTPVSPVAPVTFLYDSQRTAVRLSTTSHMRTREHNVPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAEIQADDDVVSVNIPENVTGDVAGNKNLASNVLQVRHYSIPIISSVISIFATAAFLLTCFAAGLLTMSTASLQSVGAFSRPSLSLSSDPARILFRSACHIQVFALSRWLAVTLPVEYYELARSLEWSIPYFSLPWETGHIQPVMMGSSPSDGSTSFFSRAYDWEISNSFQPKQEEFKVAANVYGLPLSAMEYRSFFENQSMKPEADYILDKLHSNGWRDFDRSLFWLAVIGGSLVLLHVFLYFILKCKRRDFEKQGSYGALIFPRFEIFLVILALPCICQASAALVAGGTPSGVVVGILLLGVVAFVLLSLLLFLSVGITLGKLLQYKEVHREGQQFHWYQDIIRVTLGPGKRGQWTWKKKANSVHLTMFGPLFEDLRGPPKYMVSQISGDNPSRQGDRIIASDDETEDAEAPFIQKLFGILRIYYTLLESVKRVSLGVLAGAYL--NNWLSKTPVVILLCITSFQLFFLVLKKPFIKKKVQLVEIISLSCEVGMFATCFVLLEKEFSAGGETKIGIFMLMLFLFGFLAQMITEWYALYEQTKQIDTARNSFLTGLKIASIGFLLYFIPQKLMKSFESNFPAFQRGGEVTADTGVPSDRMRSTSGSRSSGTPEKPWPKQLREMAKASFSKDGSKVPTDP 1040          

HSP 2 Score: 168.703 bits (426), Expect = 4.299e-39
Identity = 87/114 (76.32%), Postives = 99/114 (86.84%), Query Frame = 2
Query:  305 MGFFNMSCLIXXXXXXXXXXXKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 646
            MG   +SC++LLSLVFS LSFKGNCD S+F++KF +APH  SHL+SAKFVF+VLG  N TCSDCSITCKLD GSASDCG RKILYSGL DGNH+FGVC+NGSQGA C+SYNWTV
Sbjct:    1 MGLLKVSCVLLLSLVFSALSFKGNCDGSEFSVKFLRAPHALSHLSSAKFVFEVLGGGNGTCSDCSITCKLDYGSASDCGARKILYSGLPDGNHTFGVCINGSQGAGCSSYNWTV 114          
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: A0A0D2RPV1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G296700 PE=4 SV=1)

HSP 1 Score: 1269.22 bits (3283), Expect = 0.000e+0
Identity = 723/726 (99.59%), Postives = 725/726 (99.86%), Query Frame = 1
Query:  682 TVPPTAYITSSTPFTNALNVSVNISFTEXXXXXXXXXXXXVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAG 2859
            TVPPTAYITSSTPFTNALNVSVNISFTESCSGGGGFRCSSVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPILNSSTEILSSLSISKGTLLPITGENHGNRRFGFMVANISNIAIITISFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPVISSVISIFVTAIFLLTCFTAGLLTMSTASLQSVGAFSRPSSSLSSDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARS+EWSIPYFSLPWETGHVQP+MMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSLILLHAFLFFILKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPSGVVVGILLLGVVAFLLLSLFLFLSVGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILA 
Sbjct:  116 TVPPTAYITSSTPFTNALNVSVNISFTESCSGGGGFRCSSVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPILNSSTEILSSLSISKGTLLPITGENHGNRRFGFMVANISNIAIITISFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPVISSVISIFVTAIFLLTCFTAGLLTMSTASLQSVGAFSRPSSSLSSDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSIEWSIPYFSLPWETGHVQPIMMGSSPTGTSNSFLSRTYDRVISRSFQPNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSLILLHAFLFFILKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPSGVVVGILLLGVVAFLLLSLFLFLSVGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAA 841          

HSP 2 Score: 218.009 bits (554), Expect = 2.924e-55
Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 2
Query:  305 MGFFNMSCLIXXXXXXXXXXXKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 646
            MGFFNMSCLILLSLVFSVLSFKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV
Sbjct:    1 MGFFNMSCLILLSLVFSVLSFKGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 114          
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: B9RB00_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1510330 PE=4 SV=1)

HSP 1 Score: 1123.61 bits (2905), Expect = 0.000e+0
Identity = 638/940 (67.87%), Postives = 759/940 (80.74%), Query Frame = 1
Query:  670 FIIYTVPPTAYITSSTPFTNALNVSVNISFTEXXXXXXXXXXXXVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQ----PNKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQ-GSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFST---TI-GIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENKFFTGLKIASVGFLLYFVPQKLMKSFESTFPVFGLC-------MDTST---TGLPCDRNSSSS-------ERAWPRQLREMAKASFSKDGSKAPTDP 3411
            + + TVPPTAYIT+ST FTNA NVSVNISFTE C+GGGGF CSSVNDCNLLVYGAGQV+ SSLT VEP+L+Y LLV +S   +YGR++LVMD NFCTD AGN F R+ NSSFYVH+D+R+VFVD R H+PEKLLQL ++TRT+QATN+Y+ L+VYLYFS P++NSS +IL SL+IS+G LLPI GEN GNRRFGF VAN+S IAIITI  +++S ISR GT +SP+APVTFLYDSQR AV LST    RT+EH+IP+SI FMKPVFGFNSS +SISGG LQSFHEISRS Y A I AD D++SV+VPENVTGDVAGN NL SN+L+VRHY++P ISSVIS   TA+FL  C  +GLLT+STASLQSVGAFSR +S L+SDPTRIL R AC+IQ+FALSRWL VTLPVEYYEFAR ++WSIPYFSLPWETG + P+M+GS+ +  S+S++S  +D   S S Q     + IA+AVYG PLTP+EYRSFFESQ++ PEAEYI D  +SNGWR F+RSMFWLA++GGS +LLHA L FILKY+K+ SEKQ G+YGALI PRFEIFL+I+ALPCI +A+AAL+ GGTPSG VVGILLLGVV FL+L+LF+FLSVGITFGKLLQYKEVH+EGQ FHWYQ++IR++LGPGKRGQWTWKN+  S YLTMFG LFEDLRGPPKYM+SQIS    S+Q   IIASDDETEDAEAP IQKLFG+LRIYYT+LE+ +R +LGI+AGA+L  NN S KTP +ILLC+TSFQLFFLVLKKPFIKKKVQLVEII++S +V +FA CFVLL+K+ +T   TI GIF++ LFLIGFLA M  E YALY QTK+LD +E  F TGLK AS+GFLL+F PQK+  +         +C        D  T   +G   DRN SS        ++ W +QLREMAKASFS + S AP DP
Sbjct:  113 WTVDTVPPTAYITASTSFTNARNVSVNISFTEPCTGGGGFGCSSVNDCNLLVYGAGQVISSSLTTVEPDLRYSLLVDLSPTVQYGRVILVMDRNFCTDTAGNSFTRAANSSFYVHFDRRSVFVDQRIHIPEKLLQLDNQTRTVQATNDYDKLRVYLYFSQPVVNSSAQILDSLNISEGELLPINGENLGNRRFGFQVANVSTIAIITIGLNSSSIISRSGTSISPIAPVTFLYDSQRPAVGLSTMSTSRTKEHSIPVSINFMKPVFGFNSSSLSISGGHLQSFHEISRSKYIAQIHADGDIISVNVPENVTGDVAGNNNLPSNILQVRHYSVPTISSVISGIATAVFLAACLASGLLTVSTASLQSVGAFSRSTSLLTSDPTRILVRIACYIQVFALSRWLAVTLPVEYYEFARGLQWSIPYFSLPWETGGIHPIMLGSNSSTASHSYISYIHDSEESPSAQLEEVHSDIASAVYGLPLTPMEYRSFFESQNMKPEAEYIYDPQYSNGWRVFERSMFWLAIVGGSFLLLHALLLFILKYRKKSSEKQRGAYGALILPRFEIFLIILALPCISEASAALVRGGTPSGTVVGILLLGVVGFLVLALFMFLSVGITFGKLLQYKEVHQEGQIFHWYQDIIRISLGPGKRGQWTWKNQTKSFYLTMFGALFEDLRGPPKYMLSQISRGTSSKQRDQIIASDDETEDAEAPCIQKLFGVLRIYYTLLETVKRVSLGIVAGAFL--NNWSCKTPSLILLCITSFQLFFLVLKKPFIKKKVQLVEIIAISTQVGVFAACFVLLEKDLTTRDETIAGIFLIVLFLIGFLALMVNEWYALYRQTKRLDPTEQSFSTGLKTASIGFLLFFTPQKMSGNL--------VCRLSQNPQQDRETGGESGSSADRNKSSGSGTSSTPDKPWQKQLREMAKASFSTENSGAPIDP 1042          

HSP 2 Score: 129.798 bits (325), Expect = 4.687e-27
Identity = 58/94 (61.70%), Postives = 74/94 (78.72%), Query Frame = 2
Query:  368 KGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANV-TCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 646
            +  C D++ ++KF KAPH FSHLN+AKFVF+VL   N  +C +CSI+CKLDDG+ASDCG R++LY+ LQDGNH+F VC NGSQG  C +Y WTV
Sbjct:   22 RALCYDTEISVKFLKAPHAFSHLNTAKFVFEVLVGGNENSCPNCSISCKLDDGNASDCGTREVLYTDLQDGNHTFEVCNNGSQGFGCATYKWTV 115          
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: A0A067K7R9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_11454 PE=4 SV=1)

HSP 1 Score: 1123.23 bits (2904), Expect = 0.000e+0
Identity = 630/921 (68.40%), Postives = 750/921 (81.43%), Query Frame = 1
Query:  682 TVPPTAYITSSTPFTNALNVSVNISFTEXXXXXXXXXXXXVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQPNK----IAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFS----TTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENKFFTGLKIASVGFLLYFVPQKLMKSFESTFPVFGLCMDTSTTGLPCDRNSSSSERA---WPRQLREMAKASFSKDGSKAPTDP 3411
            TVPPTAYITSST FTNALNV+VNISFTE+CSGGGGFRCSSVN CNLLVYGAGQV+PSSL +++PNLKY LLV +S+   YGR++LVMD NFCTD AGN F R+ NSSF+VH+D+++VFVDLR H+PEKLLQL ++TRT+QATN+Y+ LK YLYFS PILNSS +IL S++IS+G LLPI+GE  GNRRFGF + N+S+IAIITISF +NS ISR GT +SP+AP +FLYDSQR AV+LSTT   RT+EH+I ISIKFMKPVFGFNSS +SISGG LQSF EISRS Y A I ADD+++S+++P N+TGDVAGNKNL SN L+VRHY +P ISSV S F TAIFL T F AGLLT+STASL+SVGAFSR +S L+S+PTR LFR AC+IQ+FA SRWL V LPVEYYEFAR+++WSIPYFSLPWETG V PVM+G + T   +S++S  YD  IS+  Q  +    IAA+VYG PLTP+EYR FFESQ++ PEAEYI D  +SNGWR FDRSMFWLA++GGSLILLH  LFFILK +K+D EK  +YGAL FPRFEIFL+I+ALPCIC+A+A+L+ GGT  GVV+G+LLLG V F +L+LFLFLSVGI+ GKLLQYKE+H+EGQ FHWYQ++IRV+LGPGKRGQWTWKN+ NSVYL M GPLFEDLRGPPKYM+SQIS ++  +Q   IIASDDETEDAEAPFIQKLFGILRIYYT+LE+ +R TLGIL GAYL  ++ SSKTP I+L C+TSFQLFFLVLKKPFIKKKVQLVEIISLS  V +F TCFVLL+K+ +    T +GIFM+ LFLIGFL QM  E YALY QTKQLD +E  F  GLK  S+GFLL+F PQK+ +  E   P      D  T G       SS+ERA   WP+QLRE+A+ASF+ D + +P DP
Sbjct:  116 TVPPTAYITSSTSFTNALNVTVNISFTETCSGGGGFRCSSVNSCNLLVYGAGQVIPSSLVILQPNLKYSLLVGLSTTVLYGRVILVMDKNFCTDIAGNRFTRTANSSFFVHFDRKSVFVDLRIHIPEKLLQLDNQTRTVQATNDYDKLKAYLYFSEPILNSSADILDSINISEGALLPISGEKLGNRRFGFQLVNVSSIAIITISFYSNSIISRSGTSISPIAPSSFLYDSQRPAVKLSTTSNSRTKEHSILISIKFMKPVFGFNSSFLSISGGHLQSFQEISRSKYIAQIHADDEIISINIPANITGDVAGNKNLPSNTLQVRHYCVPTISSVTSAFATAIFLATSFAAGLLTVSTASLRSVGAFSRSTSLLTSEPTRNLFRIACYIQVFAFSRWLAVGLPVEYYEFARNLQWSIPYFSLPWETGGVHPVMLGPNSTTAPHSYISSVYDSEISKKKQLEEQNLAIAASVYGLPLTPLEYRIFFESQNMTPEAEYILDPQYSNGWRVFDRSMFWLALVGGSLILLHGLLFFILKLRKKDLEKPRNYGALTFPRFEIFLMILALPCICEASASLVRGGTQLGVVIGVLLLGFVGFSVLTLFLFLSVGISLGKLLQYKEIHQEGQIFHWYQDIIRVSLGPGKRGQWTWKNQTNSVYLIMLGPLFEDLRGPPKYMLSQISKADPKKQRDNIIASDDETEDAEAPFIQKLFGILRIYYTLLETVKRVTLGILVGAYL--DDWSSKTPTIMLFCITSFQLFFLVLKKPFIKKKVQLVEIISLSSHVGIFTTCFVLLEKKLTASDETKVGIFMIVLFLIGFLGQMINEWYALYIQTKQLDPAEKSFSVGLKAGSIGFLLFFTPQKMSRYLECKLPQ-NQQQDRGTGG----ETISSAERADKPWPKQLRELAQASFTADRNGSPNDP 1029          

HSP 2 Score: 128.257 bits (321), Expect = 1.333e-26
Identity = 56/94 (59.57%), Postives = 70/94 (74.47%), Query Frame = 2
Query:  368 KGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVL-GAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 646
            +  CDD++  +KF KAPH FSHLN+A F FQVL G    +C++C+  CKLDDG ASDCG R++LY  LQDGNH+F VC NGSQG  C +Y+WTV
Sbjct:   21 RALCDDAEVFVKFLKAPHAFSHLNTATFEFQVLVGGNERSCTNCTTNCKLDDGIASDCGSRRVLYEALQDGNHTFEVCFNGSQGVGCATYDWTV 114          
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: F6GSM2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_17s0000g08680 PE=4 SV=1)

HSP 1 Score: 1115.14 bits (2883), Expect = 0.000e+0
Identity = 631/944 (66.84%), Postives = 756/944 (80.08%), Query Frame = 1
Query:  670 FIIYTVPPTAYITSSTPFTNALNVSVNISFTEXXXXXXXXXXXXVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQS------------FHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQPNKI----AAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEF----STTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENKFFTGLKIASVGFLLYFVPQKLMKS---FESTFPVFGLCMDTSTTGLPCDRNSSS-------SERAWPRQLREMAKASFSKDGSKAPTDP 3411
            + + TVPPTAY+T+ST FTNALN SVNISF+E C+ GG F CSSVN CNLLVYGAGQV+PS+  V++PNLK+ +LV +S +  YGR++LVMD +FC D+A N F R++NSS  VH+D R+VFV+LR HVPEKLL+L SETRT+QATNNY NLKVYLYFS P+LNSSTE+LSSL+ S+G LLP  G + GNRRFGF+V N+S++AI+TISFD+++ ISRQGT VSP+APVTFLYDSQR  VRLSTT  MRTREH IPI IKF+KPVFGFNSS ISISGG+LQ             F+ ISRSIY A I+AD DVVSV+VPEN+TGDVAGN+NLASN+L+VRHY++P+ S VIS F TA F+ T   AG LT+STASLQSVGAF RP S L SDP R LFR A HIQ+FALSRWLPVTLPVEYYEFAR ++WSIPYFSLPWETGH+ P+M+GSS    S+ + SR +D     + QP +     AA+VYG PLTP+EYR+FFE+ +  PEAEYISD  +SNG R+F+RSMFWLAVIGGSLILLHA L  +LK +K+ SEKQGSYGAL+FPRFEIFL+I+ LPCIC+A+A+L+ GGT S VVVGILL GVVAF+LL+LFLFLSVGI+FGKLL YKEVHREGQQFHWYQ+++RVTLGPGKRGQWTWKN++NSVYLTMFGPLFEDLRGPPKYM+SQI+G N  +    IIASDDETEDAEAPFIQ++FGILRIYYT+LES +R TLGI+AGAY  +    SK PII LLC+TSFQLFFLVLKKPFIKKKVQLVEIIS+S EVA+FA+C VLL+ EF       I IFML LFL+G++AQM  E YALY Q K+LD +E+ F +GLK A +GFLL+F+P K+++    F    P  G   D +++    DR+ SS       S+R W +QLRE+AKASFSK+GS  PTDP
Sbjct:  113 WTVDTVPPTAYVTASTSFTNALNFSVNISFSEPCTVGGSFGCSSVNACNLLVYGAGQVIPSTFNVLQPNLKFSVLVGLSYSVPYGRVILVMDKSFCADSARNKFMRTENSSLLVHFDIRSVFVNLRTHVPEKLLELNSETRTVQATNNYKNLKVYLYFSEPVLNSSTEVLSSLNTSQGVLLPNGGRSLGNRRFGFLVENVSSVAIVTISFDSSAIISRQGTPVSPIAPVTFLYDSQRPIVRLSTTSNMRTREHTIPILIKFLKPVFGFNSSHISISGGQLQRQVISCSQTQAYIFNAISRSIYTAEIKADHDVVSVNVPENITGDVAGNQNLASNILQVRHYSVPITSCVISTFTTASFVATSLAAGWLTVSTASLQSVGAFLRPRSYLVSDPARNLFRIASHIQVFALSRWLPVTLPVEYYEFARGIQWSIPYFSLPWETGHIHPIMVGSSSPTLSHLYASRIHDSGFFETVQPEEDNLDRAASVYGLPLTPMEYRTFFENHNFKPEAEYISDPQNSNGRRDFNRSMFWLAVIGGSLILLHALLVLVLKIRKKSSEKQGSYGALVFPRFEIFLIILVLPCICEASASLVKGGTTSAVVVGILLFGVVAFVLLALFLFLSVGISFGKLLLYKEVHREGQQFHWYQDIVRVTLGPGKRGQWTWKNQSNSVYLTMFGPLFEDLRGPPKYMLSQIAGGNSRKPSDHIIASDDETEDAEAPFIQRVFGILRIYYTLLESMKRVTLGIVAGAY--SEQWYSKAPIIFLLCITSFQLFFLVLKKPFIKKKVQLVEIISVSTEVAIFASCLVLLEMEFPAGAEKKIAIFMLLLFLVGYVAQMINEWYALYRQAKRLDPAESSFLSGLKTALIGFLLFFIPLKIIEKLGWFPVNQPGDGETGDATSSA---DRSKSSGSGTVRTSDRPWLKQLRELAKASFSKEGSGVPTDP 1051          

HSP 2 Score: 111.309 bits (277), Expect = 2.514e-21
Identity = 52/94 (55.32%), Postives = 64/94 (68.09%), Query Frame = 2
Query:  368 KGNCDDSQFTLKFFKAPHPFSHLNSAKFVFQVL-GAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 646
            +  CD S+ ++ F  AP  FS LNSA FVF+VL G  N  C+DC   CKLD+G+ SDC  +K+ Y+GL DGNH+F VC NGSQG  C SY WTV
Sbjct:   22 RSGCDGSEVSVNFLTAPLAFSRLNSATFVFEVLVGGNNDPCNDCIFNCKLDNGTPSDCQAKKVSYTGLLDGNHTFEVCTNGSQGVGCASYGWTV 115          
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: V4TT56_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10018615mg PE=4 SV=1)

HSP 1 Score: 1100.5 bits (2845), Expect = 0.000e+0
Identity = 620/934 (66.38%), Postives = 742/934 (79.44%), Query Frame = 1
Query:  670 FIIYTVPPTAYITSSTPFTNALNVSVNISFTEXXXXXXXXXXXXVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQP----NKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFS----TTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENKFFTGLKIASVGFLLYFVPQKLMKSFESTFPVFGLCMDTSTTGLPCDRNSSS------------SERAWPRQLREMAKASFSKDGSKAPTDP 3411
            +I+ TVPPTAYIT+S+ FTNA NVSVNISFTE C   GGF CSSVN CNLLVYGAGQV+PSSL  V+ +L+Y LLVS+SS  +YGR++LVMD +FCTD AGN F+R++NSSFYVH+D+R++FVDLR+HVPEKLLQL ++TRT+QATN+   LKVYLYFS  +LNSS EIL+SL+ S+GTL+PI G+N GN RFGFMVANIS+IAIIT+S  +NS ISR GT VSP+ PVTFLYDSQR AVRLSTT   RTR+ +IPI IKF+KPVFGFNSSLISISGG LQSF EI RSIY   IQA+ D VSV+VPENVTGDVAGNKNL SNVL+V+HY++P ISS IS FVTA F+ T   AGLLT++T+SL SVGAF +P  SL SDP R LFR+ACHIQ+FALSRWL  TLPVEYYEFAR ++WSIPYF+LPWETG   PVM+GSS     +S++S+     I +S QP    +   AAVYGSPLTP+EY SFFESQ+I PEA+Y+ D  H NGWR FDRSMFWLAVIGGSLILLH  L  I+K++K++SEKQ  YGA+ FPRFEIFL+I+ALPCIC+A+AAL+ GG  SG+++GILLL VV+FLLLSL LFLSVGIT GKLLQYKEVH+EGQ+FHWYQE++RVTLGPGKRGQWTWKN+ +S YLT+ GPLFEDLRGPPKYM+SQISG N  ++   IIASDDETEDAEAPFIQKLFGILRIYYT+LES +R +LGILAG Y   ++ SSKTP ++LLC+TSFQLFF+VLKKPFIKKK+QLVEIIS+SC+V +F  C V ++KEFS    T +GI ML LFL+G+ AQM  E YALY Q KQLD +     +GLK+AS G LL   PQKL ++ ES FP     +D    G+  D  S+             +++ W +QLREMAK+SFSK+ S    DP
Sbjct:  111 WIVDTVPPTAYITASSSFTNAKNVSVNISFTEPCCSRGGFGCSSVNACNLLVYGAGQVIPSSLITVQRSLEYSLLVSLSSNVQYGRVILVMDKSFCTDTAGNIFSRAENSSFYVHFDRRSLFVDLRSHVPEKLLQLNNKTRTVQATNDDEKLKVYLYFSEAVLNSSAEILNSLNSSQGTLVPINGKNRGNHRFGFMVANISSIAIITVSLKSNSIISRYGTPVSPIDPVTFLYDSQRPAVRLSTTSSTRTRQDSIPILIKFLKPVFGFNSSLISISGGHLQSFQEIRRSIYILEIQANADTVSVNVPENVTGDVAGNKNLPSNVLQVKHYSVPTISSTISTFVTAAFVATSVAAGLLTVATSSLLSVGAFLKPPYSLVSDPARNLFRTACHIQVFALSRWLVDTLPVEYYEFARGIQWSIPYFNLPWETGQSHPVMVGSSSPDGPHSYISKFNHLAIFQSEQPVAGNSNTDAAVYGSPLTPMEYESFFESQNIKPEADYL-DSNHMNGWREFDRSMFWLAVIGGSLILLHILLVLIVKFRKKNSEKQRGYGAVTFPRFEIFLIILALPCICKASAALVEGGARSGLILGILLLAVVSFLLLSLLLFLSVGITLGKLLQYKEVHQEGQRFHWYQEIVRVTLGPGKRGQWTWKNQPDSSYLTILGPLFEDLRGPPKYMLSQISGGNPHKERDRIIASDDETEDAEAPFIQKLFGILRIYYTLLESVKRVSLGILAGVY--TDDWSSKTPTVVLLCITSFQLFFMVLKKPFIKKKIQLVEIISISCQVGLFTLCLVFIEKEFSSGGETKVGISMLALFLVGYFAQMINEWYALYRQVKQLDPTTKSLLSGLKVASFGVLLLVFPQKLTRNLESKFP-----LDRCGEGVAVDTGSADRIRSSGSRSSGSTDKPWLKQLREMAKSSFSKERSGTINDP 1036          

HSP 2 Score: 117.087 bits (292), Expect = 4.232e-23
Identity = 54/88 (61.36%), Postives = 65/88 (73.86%), Query Frame = 2
Query:  383 DSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 646
            DS  ++KF KAP  FS LNSA F+FQVL A N  C+DC I+CKLDDG ASDCG  ++ Y+GL DGNH+F VC  GSQG  C+S+NW V
Sbjct:   26 DSVVSVKFLKAPKLFSRLNSATFLFQVLVAGNYNCTDCRISCKLDDGIASDCGTWEVSYTGLHDGNHTFEVCSYGSQGVGCSSHNWIV 113          
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Match: A0A067G1L2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g001432mg PE=4 SV=1)

HSP 1 Score: 1095.11 bits (2831), Expect = 0.000e+0
Identity = 618/934 (66.17%), Postives = 740/934 (79.23%), Query Frame = 1
Query:  670 FIIYTVPPTAYITSSTPFTNALNVSVNISFTEXXXXXXXXXXXXVNDCNLLVYGAGQVVPSSLTVVEPNLKYLLLVSISSASRYGRLVLVMDTNFCTDAAGNPFARSQNSSFYVHYDQRNVFVDLRAHVPEKLLQLRSETRTIQATNNYNNLKVYLYFSAPXXXXXXXXXXXXXXXKGTLLPITGENHGNRRFGFMVXXXXXXXXXXXXFDANSTISRQGTLVSPVAPVTFLYDSQRTAVRLSTTCRMRTREHNIPISIKFMKPVFGFNSSLISISGGRLQSFHEISRSIYAAAIQADDDVVSVSVPENVTGDVAGNKNLASNVLRVRHYTIPXXXXXXXXXXTAIFLLTCFTAGLLTMSTASLQSVGAFXXXXXXXXXDPTRILFRSACHIQIFALSRWLPVTLPVEYYEFARSMEWSIPYFSLPWETGHVQPVMMGSSPTGTSNSFLSRTYDRVISRSFQP----NKIAAAVYGSPLTPVEYRSFFESQSIIPEAEYISDGLHSNGWRNFDRSMFWLAVIGGSXXXXXXXXXXXXKYKKRDSEKQGSYGALIFPRFEIFLVIVALPCICQAAAALIAGGTPXXXXXXXXXXXXXXXXXXXXXXXXXXGITFGKLLQYKEVHREGQQFHWYQELIRVTLGPGKRGQWTWKNEANSVYLTMFGPLFEDLRGPPKYMVSQISGSNLSRQGGPIIASDDETEDAEAPFIQKLFGILRIYYTMLESARRATLGILAGAYLNNNNTSSKTPIIILLCLTSFQLFFLVLKKPFIKKKVQLVEIISLSCEVAMFATCFVLLDKEFS----TTIGIFMLTLFLIGFLAQMSAEGYALYEQTKQLDTSENKFFTGLKIASVGFLLYFVPQKLMKSFESTFPVFGLCMDTSTTGLPCDRNSSS------------SERAWPRQLREMAKASFSKDGSKAPTDP 3411
            +I+ TVPPTAYIT+S+ FTNA NVSVNISFTE C   GGF CSSVN CNLLVYGAGQV+PSSL  V+ +L+Y LLVS+SS  +YGR++LVMD +FCTD AGN F+R++NSSFYVH+D+R++FVDLR+HVPEKLLQL ++TRT+QATN+   LKVYLYFS  +LNSS EIL+SL+ S+GTL+PI G+N GN RFGFMVANIS+IAIIT+S  +NS ISR GT V P+ PVTFLYDSQR AVRLSTT   RTR+ +IPI IKF+KPVFGFNSSLISISGG LQSF EI RSIY   IQA+ D VSV+VPENVTGDVAGNKNL SNVL+V+HY++P ISS IS FVTA F+ T   AGLLT++T+SL SVGAF +P  SL SDP R LFR+ACHIQ+FALSRWL  TLPVEYYEFAR ++WSIPYF+LPWETG   PVM+GSS     +S++S+     I +S QP    +   AAVYGSPLTP+EY SFFESQ+I PEA+Y+ D  H NGWR FDRSMFWLAVIGGSLILLH  L  I+K++K++SEKQ  YGA+ FPRFEIFL+I+ALPCIC+ +AAL+ GG  SG+++GILLL VV+FLLLSL LFLSVGIT GKLLQYKEVH+EGQ+FHWYQE++RVTLGPGKRGQWTWKN+ +S YLT+ GPLFEDLRGPPKYM+SQISG N  ++   IIASDDETEDAEAPFIQKLFGILRIYYT+LES +R +LGILAG Y   ++ SSKTP ++LLC+TSFQLFF+VLKKPFIKKK+QLVEIIS+SC+V +F  C V ++KEFS    T +GI ML LFL+G+ AQM  E YALY Q KQLD +     +GLK+AS G LL   PQKL ++ ES FP     +D    G+  D  S+             +++ W +QLREMAK+SFSK+ S    DP
Sbjct:  111 WIVDTVPPTAYITASSSFTNAKNVSVNISFTEPCCSRGGFGCSSVNACNLLVYGAGQVIPSSLITVQRSLEYSLLVSLSSNVQYGRVILVMDKSFCTDTAGNIFSRAENSSFYVHFDRRSLFVDLRSHVPEKLLQLNNKTRTVQATNDDEKLKVYLYFSEAVLNSSAEILNSLNSSQGTLVPINGKNRGNHRFGFMVANISSIAIITVSLKSNSIISRYGTPVLPIDPVTFLYDSQRPAVRLSTTSSTRTRQDSIPILIKFLKPVFGFNSSLISISGGHLQSFQEIRRSIYILEIQANADTVSVNVPENVTGDVAGNKNLPSNVLQVKHYSVPTISSTISTFVTAAFVATSVAAGLLTVATSSLLSVGAFLKPPYSLVSDPARNLFRTACHIQVFALSRWLVDTLPVEYYEFARGIQWSIPYFNLPWETGQSHPVMVGSSSPDGPHSYISKFNHLAIFQSEQPVAGNSNTDAAVYGSPLTPMEYESFFESQNIKPEADYL-DSNHMNGWREFDRSMFWLAVIGGSLILLHILLVLIVKFRKKNSEKQRGYGAVTFPRFEIFLIILALPCICKDSAALVEGGARSGLILGILLLAVVSFLLLSLLLFLSVGITLGKLLQYKEVHQEGQRFHWYQEIVRVTLGPGKRGQWTWKNQPDSSYLTILGPLFEDLRGPPKYMLSQISGGNPHKERDRIIASDDETEDAEAPFIQKLFGILRIYYTLLESVKRVSLGILAGVY--TDDWSSKTPTVVLLCITSFQLFFMVLKKPFIKKKIQLVEIISISCQVGLFTLCLVFIEKEFSSGGETKVGISMLALFLVGYFAQMINEWYALYRQVKQLDPTTKSLLSGLKVASFGVLLLVFPQKLTRNLESKFP-----LDRCGEGVAVDTGSADRIRSSGSRSSGSTDKPWLKQLREMAKSSFSKERSGTINDP 1036          

HSP 2 Score: 117.087 bits (292), Expect = 4.305e-23
Identity = 54/88 (61.36%), Postives = 65/88 (73.86%), Query Frame = 2
Query:  383 DSQFTLKFFKAPHPFSHLNSAKFVFQVLGAANVTCSDCSITCKLDDGSASDCGGRKILYSGLQDGNHSFGVCVNGSQGAACTSYNWTV 646
            DS  ++KF KAP  FS LNSA F+FQVL A N  C+DC I+CKLDDG ASDCG  ++ Y+GL DGNH+F VC  GSQG  C+S+NW V
Sbjct:   26 DSVVSVKFLKAPKLFSRLNSATFLFQVLVAGNYNCTDCRISCKLDDGIASDCGTWEVSYTGLHDGNHTFEVCSYGSQGVGCSSHNWIV 113          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092163 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2UC52_GOSRA1.056e-5499.58Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2T9D0_GOSRA9.093e-5595.10Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MKZ5_GOSAR0.000e+098.74Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A061FUM2_THECC4.299e-3981.31Uncharacterized protein OS=Theobroma cacao GN=TCM_... [more]
A0A0D2RPV1_GOSRA2.924e-5599.59Uncharacterized protein OS=Gossypium raimondii GN=... [more]
B9RB00_RICCO4.687e-2767.87Putative uncharacterized protein OS=Ricinus commun... [more]
A0A067K7R9_JATCU1.333e-2668.40Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
F6GSM2_VITVI2.514e-2166.84Putative uncharacterized protein OS=Vitis vinifera... [more]
V4TT56_9ROSI4.232e-2366.38Uncharacterized protein OS=Citrus clementina GN=CI... [more]
A0A067G1L2_CITSI4.305e-2366.17Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR34677FAMILY NOT NAMEDcoord: 14..972
NoneNo IPR availablePANTHERPTHR34677:SF1SUBFAMILY NOT NAMEDcoord: 14..972
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..348
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 622..722
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 376..394
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 847..864
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 565..587
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 349..375
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 395..412
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 523..544
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 808..826
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 783..802
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 545..564
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 827..846
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 803..807
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 865..975
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 755..771
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 744..754
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 588..592
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 413..522
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 723..743
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 772..782
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 593..621
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.456
NoneNo IPR availableTMHMMTMhelixcoord: 847..864
NoneNo IPR availableTMHMMTMhelixcoord: 565..587
NoneNo IPR availableTMHMMTMhelixcoord: 592..614
NoneNo IPR availableTMHMMTMhelixcoord: 345..367
NoneNo IPR availableTMHMMTMhelixcoord: 522..544
NoneNo IPR availableTMHMMTMhelixcoord: 809..827
NoneNo IPR availableTMHMMTMhelixcoord: 780..802
NoneNo IPR availableTMHMMTMhelixcoord: 753..770

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092163 ID=g.barbadense_cottongen_reftransV1_0092163|Name=g.barbadense_cottongen_reftransV1_0092163|organism=Gossypium barbadense|type=contig|length=3688bp
GGGGAATCTCTCTTATCTCACGAAACACGACCTGACCTAGAGTGTCAGGT
TCATGGCATTGTGCTTAATCTGGGAAATTTATTAACCACTACAATCACTC
ACTTTCTAAAATCTCTTTCTTCTCTTTTCCTTGTATCTCCACCACATTTT
TCCCACCCTTATTATCTATGATTAGTGCATTCATTTCTTTGTTTTAACGT
TGTAGTTAGACCCCACCACAATGCCTCTTTTTTTCTAATGAAATCTAACC
TCTACTGTACGTGTTTGAGACTTCAGTCTGGAGACTCTGGAGTCCCCCTC
TGCAATGGGTTTCTTCAACATGTCATGTCTGATTTTGCTTTCTTTGGTAT
TTTCTGTTTTGAGTTTCAAAGGGAACTGTGATGATTCTCAGTTCACTTTA
AAGTTCTTTAAGGCTCCTCATCCATTTTCACACCTCAACTCAGCCAAATT
TGTATTTCAAGTTCTTGGAGCTGCCAATGTCACTTGCTCTGATTGTAGCA
TCACTTGCAAGTTGGATGACGGCTCTGCTTCAGATTGTGGAGGTAGAAAG
ATATTGTACTCAGGCTTGCAAGATGGAAACCACTCATTTGGGGTCTGCGT
TAATGGCTCTCAAGGAGCTGCCTGCACTAGCTATAATTGGACTGTTGGTT
AAGAAACCTTCCTTTATTCTTTATAATTTACACAGTCCCTCCCACTGCAT
ATATAACCTCATCAACACCTTTCACAAATGCTCTAAATGTTTCTGTAAAT
ATTTCTTTCACTGAATCTTGTTCAGGTGGCGGAGGTTTTAGATGTTCATC
TGTCAATGATTGCAATTTGCTTGTTTATGGTGCTGGCCAAGTTGTACCAT
CATCGCTCACCGTTGTGGAGCCAAACCTCAAGTATTTGCTTCTTGTGAGC
ATATCATCTGCTTCTCGGTATGGAAGACTGGTATTGGTAATGGATACGAA
TTTTTGCACTGATGCTGCTGGGAACCCTTTTGCTAGATCACAAAATTCTA
GTTTCTATGTGCACTATGATCAAAGAAATGTATTTGTTGATCTGAGGGCT
CATGTTCCTGAGAAATTGCTTCAACTAAGAAGTGAAACTAGAACAATTCA
GGCAACTAATAATTATAATAACCTTAAGGTGTACCTATACTTCTCAGCTC
CTATTCTCAATTCATCAACAGAGATTCTAAGTTCTCTGAGCATTAGTAAG
GGTACACTTCTTCCTATTACGGGAGAAAACCACGGGAATCGTAGATTCGG
CTTTATGGTTGCTAATATATCCAATATTGCTATAATAACAATAAGCTTCG
ATGCAAACTCTACAATAAGCAGACAAGGGACCCTGGTTTCTCCAGTTGCA
CCTGTTACTTTCCTTTACGATTCTCAGAGGACTGCTGTGAGATTAAGCAC
AACATGTCGTATGAGGACACGAGAACACAACATACCAATTTCGATAAAGT
TCATGAAGCCTGTTTTTGGATTTAATTCATCATTGATATCCATCTCCGGA
GGTCGATTGCAGAGCTTCCATGAAATTAGTAGAAGCATATATGCAGCAGC
AATACAAGCAGATGATGATGTTGTTTCTGTCAGTGTCCCTGAGAATGTAA
CTGGGGATGTTGCTGGAAATAAAAATTTGGCATCTAATGTTCTTCGAGTC
AGGCACTATACTATACCTGTAATTTCTTCTGTGATATCCATATTTGTAAC
TGCCATTTTTTTGCTGACCTGTTTCACCGCTGGGCTTCTGACCATGTCAA
CTGCAAGCCTTCAATCGGTTGGGGCATTTTCAAGACCATCTTCATCTTTG
TCTTCTGACCCTACAAGGATTCTCTTTAGAAGTGCATGCCACATTCAGAT
TTTTGCACTGTCTAGGTGGTTACCAGTAACATTGCCGGTGGAATATTATG
AATTTGCAAGGAGTATGGAGTGGAGCATTCCTTATTTTAGTCTCCCATGG
GAAACTGGGCATGTTCAGCCAGTCATGATGGGTTCAAGCCCCACCGGAAC
TTCAAATTCTTTCCTTTCCCGAACTTATGATAGGGTAATCTCCCGTAGTT
TTCAACCGAACAAAATAGCAGCTGCAGTATATGGTTCACCACTTACTCCA
GTAGAGTACAGATCATTTTTTGAGAGCCAAAGCATTATACCAGAAGCAGA
ATATATTTCGGATGGACTGCATTCAAATGGGTGGAGGAACTTTGATAGAA
GCATGTTCTGGTTAGCTGTAATTGGTGGTAGTTTGATACTGTTGCATGCT
TTTCTCTTTTTCATTCTCAAATACAAGAAGAGAGATTCCGAAAAGCAAGG
GAGTTATGGAGCACTCATATTTCCTAGATTCGAGATATTTCTCGTAATTG
TTGCACTACCTTGTATCTGCCAGGCTGCTGCTGCTCTAATTGCAGGAGGA
ACACCATCAGGAGTTGTAGTTGGCATTTTGTTACTTGGTGTTGTGGCTTT
CCTACTGCTGTCATTATTCTTGTTCCTGTCGGTCGGAATTACATTTGGAA
AGCTGCTTCAATACAAGGAAGTCCATCGAGAAGGTCAGCAATTTCACTGG
TATCAAGAACTCATCCGAGTGACTCTTGGTCCTGGGAAAAGAGGCCAGTG
GACTTGGAAAAATGAAGCCAACTCTGTTTATCTAACCATGTTTGGCCCTC
TATTCGAAGATTTAAGAGGTCCTCCGAAATATATGGTCTCACAAATATCC
GGTAGCAATCTCAGCAGGCAAGGTGGTCCTATCATTGCTTCAGATGATGA
AACAGAAGATGCTGAAGCACCTTTTATTCAGAAATTGTTTGGAATACTCA
GAATATACTACACCATGTTAGAATCTGCAAGAAGAGCTACACTGGGAATT
TTAGCAGGTGCCTACTTGAATAATAATAACACCTCATCTAAGACTCCAAT
AATTATCTTGCTATGCCTTACCTCTTTTCAGCTATTCTTCCTTGTTCTGA
AGAAGCCTTTCATAAAGAAAAAGGTACAGTTAGTTGAGATCATCTCTCTT
TCGTGTGAGGTGGCCATGTTTGCTACTTGTTTCGTTCTGTTGGACAAGGA
ATTTTCGACTACAATCGGTATCTTTATGCTTACTTTATTCCTGATTGGGT
TCTTAGCACAAATGAGTGCTGAAGGGTATGCTTTGTATGAACAAACAAAG
CAACTAGACACCAGTGAGAACAAGTTCTTCACAGGTTTGAAAATAGCATC
AGTCGGGTTTCTCCTATATTTCGTCCCTCAGAAACTGATGAAAAGCTTTG
AGAGCACATTCCCAGTATTTGGATTATGCATGGATACAAGTACAACAGGT
TTACCATGTGATAGGAACAGCAGCAGTTCAGAGAGAGCATGGCCAAGACA
ACTAAGGGAAATGGCAAAGGCTAGCTTTAGTAAAGATGGAAGCAAAGCTC
CAACAGATCCTTCAAGCAGCAAAAGCAAATGGAGTGGATTGTGGGGAACA
AAAAGGAGTGGCAGCTCTTCTTTAGATTCCTCTTTAGATTACAAGTCAAA
GTCCAAATCAAAAGGGTTGTACAAAGACTTGGAAGCCATTTTTGCGTCCA
ACCCAAGAATGTAACCACATGACCTTTTATATTTATATATATTGTATAGC
TGAGACAACCCCATTCTTCGAACTCTTTTACTGTTTATTTGATAACTTAA
ATGGGAATTTTTTTCCGATATGTCTCATTGAAGGGAAC
back to top