g.barbadense_cottongen_reftransV1_0092162, g.barbadense_cottongen_reftransV1_0092162 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092162
Unique Nameg.barbadense_cottongen_reftransV1_0092162
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length1901
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
At13chromosomeg.barbadense_cottongen_reftransV1_0092162:1..1901 .
At13:49157042..49164260 -
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GUX4_ARATH (Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 OS=Arabidopsis thaliana GN=GUX4 PE=3 SV=1)

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 260/489 (53.17%), Postives = 349/489 (71.37%), Query Frame = -2
Query:  173 KKEIKIGLVNINSNEEIQYQLPGSVV-STVHVRFDRVSKKRKWEDFFPFRIDENQQNCPEIPMPALEKYQ-DLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNL 1633
            +K I++G +NI+  E   Y+  G +V   +HV  D + K   W+  +P  I+E    CPEIP+P  E    ++DV+VA++PC GWS   G+RDVF LQVNL  AN+ V+SG  T  V +AVY VF+GSCGPM EIF C++ + +VED+ VYKP L RLKQ +LMP GSCQ+A  + + G+EAWR    D+   K +     + + AY TVLH+SE YVCGA+ALAQSI ++ S +D+ILLHD  IT +SL+GL AAGW+ RLI+ IRSPF+ KDS+NEWN+S LR+W +T YDK+VFIDAD ++   +D LF +PQLSA+ NDK LFN G+MV+EPS CMF+DLM K  +++SYNG  QG+LNE+F+WWHRL  +VN +K F+ E+  R+  + + +  LH+LGLKPW+CYRDYDCNWD    + FASD  HEKWW+VYD+M E L+ YCGL ++M  R++KWR IA++   PD HW+I V DPR+ NL
Sbjct:   69 EKRIQVGFLNIDEKERESYEARGPLVLKNIHVPLDHIPKNVTWKSLYPEWINEEASTCPEIPLPQPEGSDANVDVIVARVPCDGWSANKGLRDVFRLQVNLAAANLAVQSGLRT--VNQAVYVVFIGSCGPMHEIFPCDERVMRVEDYWVYKPYLPRLKQKLLMPVGSCQIAPSFAQFGQEAWRPKHEDNLASKAVTALPRRLRVAYVTVLHSSEAYVCGAIALAQSIRQSGSHKDMILLHDHTITNKSLIGLSAAGWNLRLIDRIRSPFSQKDSYNEWNYSKLRVWQVTDYDKLVFIDADFIILKKLDHLFYYPQLSASGNDKVLFNSGIMVLEPSACMFKDLMEKSFKIESYNGGDQGFLNEIFVWWHRLSKRVNTMKYFD-EKNHRRHDLPENVEGLHYLGLKPWVCYRDYDCNWDISERRVFASDSVHEKWWKVYDKMSEQLKGYCGLNKNMEKRIEKWRRIAKNNSLPDRHWEIEVRDPRKTNL 554          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GUX5_ARATH (Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 OS=Arabidopsis thaliana GN=GUX5 PE=2 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 8.742e-171
Identity = 258/507 (50.89%), Postives = 356/507 (70.22%), Query Frame = -2
Query:  176 LDLLQEEINSKKEIKIGLVNINSNEEIQYQLPG-SVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQ----NCPEIPMPALEKYQ-DLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAW---RYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGR--RQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYN 1663
            L L++  +  +K+I++GL+NI  NE   Y+  G S++  VHV  D +     W   FP  IDE+      +CPE+P+P +E  + D+DVVV K+PC G+S K G+RDVF LQVNL  AN++VESG     V R VY VF+GSCGPM EIFRC++ +++V D+ VY+P+L RLKQ +LMPPGSCQ+A P G+   EAW   +  +   E+  +  ++A  Q+ AY T+LH+SE YVCGA+ALAQSI ++ ST+D+ILLHD++IT  SL+GL  AGW  R +  IRSPF+ K S+NEWN+S LR+W +T YDK+VFIDAD ++  NID+LF +PQLSAA N+K LFN GVMV+EPS C+FEDLM+K  ++ SYNG  QG+LNE F+WWHRL  ++N +K F G+E R  +   + + +  +H+LGLKPW CYRDYDCNWD +  + +AS+  H +WW+VYD+MP+ L+ YCGL   M   ++KWR +A+    P+ HWKI + DPR+ N
Sbjct:   64 LRLIRNYLPDEKKIRVGLLNIAENERESYEASGTSILENVHVSLDPLPNNLTWTSLFPVWIDEDHTWHIPSCPEVPLPKMEGSEADVDVVVVKVPCDGFSEKRGLRDVFRLQVNLAAANLVVESG--RRNVDRTVYVVFIGSCGPMHEIFRCDERVKRVGDYWVYRPDLTRLKQKLLMPPGSCQIA-PLGQG--EAWIQDKNRNLTSEKTTLSSFTA--QRVAYVTLLHSSEVYVCGAIALAQSIRQSGSTKDMILLHDDSITNISLIGLSLAGWKLRRVERIRSPFSKKRSYNEWNYSKLRVWQVTDYDKLVFIDADFIIVKNIDYLFSYPQLSAAGNNKVLFNSGVMVLEPSACLFEDLMLKSFKIGSYNGGDQGFLNEYFVWWHRLSKRLNTMKYF-GDESRHDKARNLPENLEGIHYLGLKPWRCYRDYDCNWDLKTRRVYASESVHARWWKVYDKMPKKLKGYCGLNLKMEKNVEKWRKMAKLNGFPENHWKIRIKDPRKKN 562          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GUX2_ARATH (UDP-glucuronate:xylan alpha-glucuronosyltransferase 2 OS=Arabidopsis thaliana GN=GUX2 PE=2 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 2.413e-141
Identity = 239/524 (45.61%), Postives = 325/524 (62.02%), Query Frame = -2
Query:  182 SNQRFRNLDLLQEEINSKK--EIKIGLVNINSNEEIQYQLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQ----NCPEIPMPALEKYQDLDVVVAKLPC----KGWSGKSGMRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSAD--HERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILD-------EISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTE----HMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQ 1684
            SNQ         EEI ++   + KIG+VN+   +   ++  G    TVH+ F+RVSK  KW+D FP  IDE ++     CPEIPMP  E  + LD+VV KLPC    +GW      R+V  LQVNLV AN+  + G      K  V  +F   C PM EIFRC+DL ++  D  +Y+PE+ RL+Q + +P GSC LA P        W     D  ++  K+   +   ++EAY TVLH+SE YVCGA+ LAQS+++TN+ RDLILLHD++I+   L  L AAGW  R I  IR+P A+KDS+NE+N+S  R+W LT YDKV+FIDAD++V  N+D LF FPQ+SA  ND  ++N G+MVIEPS C F  +M +  E+ SYNG  QG+LNE+F+WWHRLP +VNFLK+F     + +    +       ++  +H+LG KPW+CYRDYDCN+D +    +ASD AH +WW+V+D M + LQ +C LT+     +NW  +K    AR     D HWKI VTDPR+
Sbjct:   87 SNQTKLEAPSFMEEILTRGLGKTKIGMVNMEECDLTNWKRYGE---TVHIHFERVSKLFKWQDLFPEWIDEEEETEVPTCPEIPMPDFESLEKLDLVVVKLPCNYPEEGWR-----REVLRLQVNLVAANLAAKKGKTDWRWKSKV--LFWSKCQPMIEIFRCDDLEKREADWWLYRPEVVRLQQRLSLPVGSCNLALPL-------WAPQGVDKVYDLTKIEAETKRPKREAYVTVLHSSESYVCGAITLAQSLLQTNTKRDLILLHDDSISITKLRALAAAGWKLRRIIRIRNPLAEKDSYNEYNYSKFRLWQLTDYDKVIFIDADIIVLRNLDLLFHFPQMSATGNDVWIYNSGIMVIEPSNCTFTTIMSQRSEIVSYNGGDQGYLNEIFVWWHRLPRRVNFLKNFWSNTTKERNIKNNLFAAEPPQVYAVHYLGWKPWLCYRDYDCNYDVDEQLVYASDAAHVRWWKVHDSMDDALQKFCRLTKKRRTEINWERRK----ARLRGSTDYHWKINVTDPRR 589          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GUX1_ARATH (UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 OS=Arabidopsis thaliana GN=GUX1 PE=2 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 4.186e-117
Identity = 212/523 (40.54%), Postives = 303/523 (57.93%), Query Frame = -2
Query:  185 FRNLDLLQEEI-----NSKKEIKIGLVNINSNEEIQYQL------PGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQN----CPEIPMPALEKYQDLDVVVAKLPCK---GWSGKSGMRDVFMLQVNLVVANILVE-SGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDF----EGEEGRRQEKILDE----ISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPR 1672
            F +LD+  +++     N ++   IG++N +SNE  +++        G     V +  D   K   W+  +P  IDE Q+     CP IP   +   + LD++V KLPC+    WS     RDV  L + L  A +     G+    V       FV  C P+  +FRC+DL+ +  D  +YKP L  L+  + +P GSC+L+ P G   + +                    ++EAYAT+LH++  YVCGA+A AQSI ++ STRDL++L D+NI+     GL+AAGW  R I  IR+P A+KD++NEWN+S  R+W LT YDK++FIDAD+L+  NID+LF  P++SA  N+ TLFN GVMVIEP  C F+ LM  + E++SYNG  QG+LNEVF WWHR+P  +NFLK F    E +  R++ ++       + VLH+LG+KPW+CYRDYDCN++ +    FA+D AH KWW V+D MP+ L  +C L      +L+  R  A +    D HWKI V DPR
Sbjct:  116 FSDLDINWDDVTKTLENIEEGRTIGVLNFDSNEIQRWREVSKSKDNGDEEKVVVLNLDYADKNVTWDALYPEWIDEEQETEVPVCPNIPNIKVPTRR-LDLIVVKLPCRKEGNWS-----RDVGRLHLQLAAATVAASAKGFFRGHV------FFVSRCFPIPNLFRCKDLVSRRGDVWLYKPNLDTLRDKLQLPVGSCELSLPLGIQDRPSL----------------GNPKREAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWIGDEDDAKRKKTELFGAEPPVLYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHWKIRVKDPR 610          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GUX3_ARATH (Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 3 OS=Arabidopsis thaliana GN=GUX3 PE=2 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 1.599e-116
Identity = 205/507 (40.43%), Postives = 302/507 (59.57%), Query Frame = -2
Query:  185 DLLQEEINSKKEIK-IGLVNINSNEEIQY-QLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQ----NCPEIPMPALEKYQDLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDF-EGEE---GRRQEKILDE----ISVLHFLGL-KPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPR 1660
            +L+++ +  + E + IGL+N+N NE  ++ ++  S    V +  D  +K   WE  +P  IDE ++     CP +P+  +     +D+V+AKLPC   SGK   RDV  L + L  A +   S  +       V+ + V  C P+  +F  ++L+ +  +  +YKP L +L+Q + +P GSC+L+ P                 + K   YSA  +KEAYAT+LH+++ YVCGA+A AQSI  + STRDL++L DE I+     GL AAGW  ++   IR+P A  +++NEWN+S  R+W LT Y K++FIDAD+L+  NID+LF FP++SA  N+ TLFN G+MV+EPS   F+ LM  + E+ SYNG  QG+LNE+F WWHR+P  +NFLK F EG+E    + +  +       + VLH+LG  KPW+C+RDYDCNW+ +  Q FASD+AH+ WW+V+D MPE L  +C L      +L+  R  A      D HWKI + D R
Sbjct:   91 NLVEKHVFGRSEYQGIGLINLNDNEIDRFKEVTKSDCDHVALHLDYAAKNITWESLYPEWIDEVEEFEVPTCPSLPLIQIPGKPRIDLVIAKLPCDK-SGKWS-RDVARLHLQLAAARVAASSKGL-----HNVHVILVSDCFPIPNLFTGQELVARQGNIWLYKPNLHQLRQKLQLPVGSCELSVPL----------------QAKDNFYSAGAKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDETISEYHKSGLVAAGWKIQMFQRIRNPNAVPNAYNEWNYSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEISATGNNATLFNSGLMVVEPSNSTFQLLMDNINEVVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKKMKTSLFGADPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHWKIKIKDKR 574          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GUX6_ARATH (Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana GN=IPUT1 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.201e-19
Identity = 58/170 (34.12%), Postives = 93/170 (54.71%), Query Frame = -2
Query:  542 KYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVF 1051
             + +   K AY T+L+  ++++ G   L +SI  T ST+D++ L  + ++  S   LKA GW    I+ + +P     +     ++ L+I+ +T Y KVV++DAD +V  NI+ LF   +  A        N GVMV+EPS  +F D+M KV  + SY G  QG+LN  +
Sbjct:   23 SFGSESSKVAYVTLLY-GDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSDYSKKLLKADGWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCSKFCANLKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSYTGGDQGFLNSYY 191          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GLYG2_HUMAN (Glycogenin-2 OS=Homo sapiens GN=GYG2 PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 2.799e-19
Identity = 83/257 (32.30%), Postives = 118/257 (45.91%), Query Frame = -2
Query:  323 EAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSP------FADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPND--KTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWW-----HR-LPFQVNFLKDFEGEEGRRQEKILDEISVLHFLG-LKPWMCYRDYDCNWDKEGM--QRFASDKAHEK-----WWQVY 1027
            +A+ T L T++ Y  GA+ L QS+ R   TR L++L    ++    V L     +   +N I S       F  +        + L  W LT Y K VF+DAD LV +N+D LF   + SAAP+      FN GV V +PSL   + L+   +E  S++G+ QG LN  F  W     H+ LPF  N   +         ++      V+HFLG +KPW    +Y  N     +  Q  AS   H+      WW VY
Sbjct:   37 QAFVT-LATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELG-LTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPW----NYKYNPQSGSVLEQGSASSSQHQAAFLHLWWTVY 287          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GYG1_CAEEL (Glycogenin-1 OS=Caenorhabditis elegans GN=gyg-1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.045e-16
Identity = 65/213 (30.52%), Postives = 94/213 (44.13%), Query Frame = -2
Query:  416 VLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEW-----NFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPND--KTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWW------HRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLG-LKPW 1012
             L T+++Y  GA+ L  S+    +TR +  L    ++      L+    D  +++   S  +D     E       F+ L  W LT Y K VF+DAD LV  N D LF  P  SAA +      FN GV V  P+   +  L+   +   SY+G  QG LN+ F  W      HRLPF  N             ++      ++HF+G +KPW
Sbjct:    7 TLATNDNYAQGALVLVHSLRTAGTTRKIHCLISNEVSAPVRKQLEEHFDDVSIVDVFNSNDSDNLRLIERPDLGVTFTKLHCWRLTQYTKCVFLDADTLVLRNADELFTRPDFSAASDIGWPDSFNSGVFVYVPNNETYRQLVDFAVTHGSYDGGDQGLLNDFFSNWRDLPSEHRLPFIYNMTAGAFYTYAAAYKRYGANTKIVHFIGSVKPW 219          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GOLS6_ARATH (Galactinol synthase 6 OS=Arabidopsis thaliana GN=GOLS6 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.533e-16
Identity = 79/283 (27.92%), Postives = 125/283 (44.17%), Query Frame = -2
Query:  317 KEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEW----NFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQL--------------SAAPNDK-----------------------TLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFI-WWHRLPFQVNFLKDFEGEEGRRQEKI-LDEISVLHFL--GLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDE 1030
            K AY T L  ++DY  G V LA+ + +  S   L++    ++  E    L A G   R I  +  P  +K  ++      N+S LRIW    Y+K++++D D+ VF+NID LF  P+               S  P  K                         FN G++V EP+L  +EDL+  V        + Q +LNE F   +  +P   N +        R  E I LD+ISV+H+   G KPW  + + + + D+E ++        +KWW +Y++
Sbjct:   24 KRAYVTFLAGNKDYWMGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRQILLAQGCIIREIEPVYPP-ENKTGYSMAYYVINYSKLRIWEFVEYEKMIYLDGDIQVFSNIDHLFDTPRGYLYAVKDCFCEISWSKTPQFKIGYCQQCPEKVTWPVESLGSPPPVYFNAGMLVFEPNLLTYEDLLRVVQITTPTYFAEQDFLNEYFTDIYKPIPSTYNLVM---AMLWRHPEHIDLDQISVIHYCANGSKPWR-FDETEEHMDREDIKMLV-----KKWWDIYED 296          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Match: GLYG_MOUSE (Glycogenin-1 OS=Mus musculus GN=Gyg1 PE=1 SV=3)

HSP 1 Score: 82.8037 bits (203), Expect = 6.565e-16
Identity = 67/218 (30.73%), Postives = 101/218 (46.33%), Query Frame = -2
Query:  416 EAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNE-----WNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDK--TLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWW------HRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLG-LKPW 1027
            +A+ T L T++ Y  GA+ L  S+ +  +TR +++L    ++      L+    D  +++ + S  +   +  +        + L  W LT Y K VF+DAD LV +NID LF   +LSAAP+      FN GV V +PS+  +  L+    E  S++G  QG LN  F  W        LPF  N             +       V+HFLG  KPW
Sbjct:    4 QAFVT-LTTNDAYAKGALVLGSSLKQHRTTRRMVVLTSPQVSDSMRKVLETVFDDVIMVDVLDSGDSAHLTLMKRPELGITLTKLHCWSLTQYSKCVFMDADTLVLSNIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSIETYNQLLHLASEQGSFDGGDQGLLNTYFSGWATTDITKHLPFVYNLSSISIYSYLPAFKAFGKNAKVVHFLGRTKPW 220          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: A0A0D2SCU2_GOSRA (Hexosyltransferase OS=Gossypium raimondii GN=B456_013G123900 PE=3 SV=1)

HSP 1 Score: 1078.93 bits (2789), Expect = 0.000e+0
Identity = 539/553 (97.47%), Postives = 546/553 (98.73%), Query Frame = -2
Query:  167 MASKSFHCNQKXXXXXXXXXXXXXXXXXXXXXSNYNIIDAFKHNPPPSNQRFRNLDLLQEEINSKKEIKIGLVNINSNEEIQYQLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQNCPEIPMPALEKYQDLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNLGA 1825
            MASK FHCNQ SFTLSITLLSLSLIIF++FSRSNYNIIDAFKHNPPPSNQRFRNLDLLQEEIN KKEIK+GLVNINSNEEIQYQLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQNCPEIPMPALEKYQDLDVVVAKLPCKGWSGKSGMRDVF+LQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQ+EAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFN GVMVIEPSLC+FEDLMVKVLEMDSYNGSYQGWLNEVF WWHRLP QVNFLKDFEGE+GRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGM RFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNLGA
Sbjct:    1 MASKPFHCNQISFTLSITLLSLSLIIFLVFSRSNYNIIDAFKHNPPPSNQRFRNLDLLQEEINGKKEIKMGLVNINSNEEIQYQLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQNCPEIPMPALEKYQDLDVVVAKLPCKGWSGKSGMRDVFLLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQREAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNSGVMVIEPSLCVFEDLMVKVLEMDSYNGSYQGWLNEVFTWWHRLPSQVNFLKDFEGEDGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMLRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNLGA 553          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: A0A061F2R6_THECC (Hexosyltransferase OS=Theobroma cacao GN=TCM_026564 PE=3 SV=1)

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 381/559 (68.16%), Postives = 451/559 (80.68%), Query Frame = -2
Query:  173 MASKSFHCNQKXXXXXXXXXXXXXXXXXXXXXSNYNIIDAFKHNPPPSNQRF---RNLDLLQEEINSKKEIKIGLVNINSNEEIQYQLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQN----CPEIPMPALEKYQDLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVT-PEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNL 1825
            MA+K  + NQK F LS+ +LSLS+II V F  S YNI D  K  P    Q F   R LDL++EEI+ KK IK+GLVN   +EE  Y++ GS V+TVHVRFDRVS+  KW DFFP  IDE+Q++    CPEIPMP LE Y DLDVVVAK+PC GW+GKSG++DVF LQVNLVVAN+LV SGWV  P+VKRAVYAVF+G+CGPM EIFRC+DL RK  DH VYKPELRRLKQ ++MP GSCQ+AQPYG TGKEAWRY+S   E+ K LKYS F Q+EAY T+LH+SE YVCGA+ALAQSII +NSTRDL+LLHDENI+P+SL GL+AAGW TR I+ IRSPFA K S+NEWN+S LRIW+LTWYDKVVFIDAD+LV  N+D LF++P LSAA ND+TLFN G+MV+EPSLCMFEDLMVK  ++DSYNG  QG+LNEVF WWHRLP +VNFLK F+    R  E I D++S +H+LGLKPWMCYRDYDCNWD +  Q FASD+AHEKWW+VYD MPE LQ YCGLTE+M+WR+KKWR IA++L+ PDEHW+I VTDPRQYNL
Sbjct:    1 MAAKFLNSNQKLFILSLIVLSLSVIILVAFFGSKYNIFDTVK--PQIERQVFTYPRWLDLIKEEIDGKK-IKVGLVNF-GDEEAAYRVHGSGVNTVHVRFDRVSEASKWVDFFPEWIDEDQKSGPPTCPEIPMPPLEDYWDLDVVVAKVPCDGWTGKSGLKDVFRLQVNLVVANLLVRSGWVMEPDVKRAVYAVFIGNCGPMPEIFRCDDLSRKAGDHWVYKPELRRLKQKVVMPLGSCQIAQPYGITGKEAWRYYSLPKEKRKKLKYSTFNQREAYVTILHSSEAYVCGAIALAQSIILSNSTRDLLLLHDENISPKSLTGLRAAGWKTRQIDRIRSPFAQKGSYNEWNYSKLRIWLLTWYDKVVFIDADILVLKNMDSLFIYPPLSAAGNDQTLFNSGIMVVEPSLCMFEDLMVKSFKVDSYNGGDQGFLNEVFTWWHRLPSKVNFLKIFQRNGSR--EDIPDDLSAIHYLGLKPWMCYRDYDCNWDMKERQIFASDQAHEKWWRVYDAMPENLQHYCGLTENMDWRIKKWRKIAKNLRLPDEHWRISVTDPRQYNL 553          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: A0A061F3T4_THECC (Hexosyltransferase OS=Theobroma cacao GN=TCM_026565 PE=3 SV=1)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 354/517 (68.47%), Postives = 414/517 (80.08%), Query Frame = -2
Query:  173 RNLDLLQEEINSKKEIKIGLVNINSNEEIQYQLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQN----CPEIPMPALEKYQDLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVT-PEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRD------------LILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPN-DKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNL 1669
            R  DL++EEI+ KK IK+GLVN + +EE  Y++PGSVVSTVHVRFD VSK  KW DFFP  IDE+Q+     CP IPMP LE Y+DLDVVVA++PC GW+GKSG+RDVF LQVNLVVAN+LVESGWV  P+VKR VYAVFVGSCGPM EIFRC+DLLRK  DH VYKPELRRLKQ +LM  GSCQ+AQPY +TGKE WRY+ A+ +++K  +YS F QKEAY T+LH+SE YVCGA+ALAQSII +NSTRD            L+LLHDENI+P+SL GL+AAGW TR I  IRSPFA K S+NEWN+S LRIW+LTWYDKV+FIDAD+LV  N+D LFV+P LSAA N DKTLFN G+MV+EPSLCMFEDLM+K  E+ S+NG  QG+LNEVF WWHRLP +VNFLK F+   G RQ  I D++S +H+LGLKPWMCYRDYDCNWD +  Q FASDKAHEKWWQVYD MPE LQ YCGLTE+M+  +KKWR IA  L+ PDEHW+I V DPRQYNL
Sbjct:   55 RWFDLVREEIDGKK-IKVGLVNFD-DEEPAYKMPGSVVSTVHVRFDHVSKAIKWGDFFPEWIDEDQKFSLPLCPAIPMPRLEDYRDLDVVVARVPCDGWTGKSGLRDVFRLQVNLVVANLLVESGWVMEPDVKRVVYAVFVGSCGPMSEIFRCDDLLRKAGDHWVYKPELRRLKQKVLMTLGSCQIAQPYAKTGKEVWRYYLAE-DKVKKQEYSVFHQKEAYVTILHSSEAYVCGAIALAQSIILSNSTRDPFFNLLSNSTRDLLLLHDENISPKSLTGLRAAGWKTRQIERIRSPFAKKGSYNEWNYSKLRIWLLTWYDKVIFIDADILVLKNMDDLFVYPPLSAAGNYDKTLFNSGIMVVEPSLCMFEDLMMKSFEVGSHNGGDQGFLNEVFTWWHRLPSKVNFLKIFQ-RNGSRQN-IRDDLSAIHYLGLKPWMCYRDYDCNWDVKEKQIFASDKAHEKWWQVYDAMPENLQQYCGLTENMDCTIKKWRKIASYLRLPDEHWRIDVKDPRQYNL 566          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: A0A0D2ST33_GOSRA (Hexosyltransferase OS=Gossypium raimondii GN=B456_007G296600 PE=3 SV=1)

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 360/561 (64.17%), Postives = 431/561 (76.83%), Query Frame = -2
Query:  173 MASKSFHCNQKXXXXXXXXXXXXXXXXXXXXXSNYNIIDAFKHNPPPSNQRFRN---LDLLQEEINSKKEIKIGLVNINSNEEIQYQLPG--SVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQ----NCPEIPMPALEKYQDLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVT-PEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNL 1825
            MA K+ H NQK FTLS+ LLSLSL IF +F  S  NI++ FK      NQ F N    DL+QEE N  K+IK+GLVN N  E  QY++ G  S+V TV V F+ VSK R+W+DFFP  I+E+       CPEIP+P LE+Y DL+VVVAK+PC GW+ ++GMRDVF LQVNLVVAN+LV SGW   P+VK  VYAVF+G CGPM EIFRC+DLLRK  DH VYKPEL+RLKQ +LMPPG+CQ+A P+G+T          D+ R   LK   F  +EAY TVLH+SE YVCGA+ALAQSIIRTNST+DL+LLHDE+++P SL GL+ AGW TR I  IRSPFA+K S+NEWN+S LRIWMLTWY KVVFID+D LVF N+DW+F +PQ+SAA ND+TLFN G+MVIEPSLC FEDLM+K  ++ SYNG  QG+LNE+F WWHRLP +VNFLK F+G     +EKI D++S +H+LGLKPWMCYRDYDCNWD +  Q FASDKAHEKWWQVYDEMPE L+ YCGL+ HMNWR+KKWR +A+ L  PDEHWKIGVTDPRQYNL
Sbjct:    1 MAHKTLHSNQKLFTLSLILLSLSLSIFFIFFGSKNNIVNRFKVETDQPNQLFTNPRWFDLIQEESNGDKKIKVGLVNFNDEEASQYEVHGYGSLVDTVRVHFNCVSKVREWKDFFPVWINEDSNLHPPTCPEIPVPRLEEYWDLNVVVAKVPCDGWTTEAGMRDVFRLQVNLVVANLLVRSGWAKGPDVKWEVYAVFIGHCGPMPEIFRCDDLLRKEGDHWVYKPELKRLKQKVLMPPGTCQIAYPFGKT----------DNARQSKLKNRQFNHREAYVTVLHSSEAYVCGAIALAQSIIRTNSTKDLLLLHDEHVSPRSLTGLRTAGWKTRQIERIRSPFAEKGSYNEWNYSKLRIWMLTWYRKVVFIDSDFLVFKNMDWVFHYPQISAAGNDRTLFNSGIMVIEPSLCTFEDLMLKSFKVGSYNGGDQGFLNEMFTWWHRLPKEVNFLKYFDGNHSLNREKIPDDLSAIHYLGLKPWMCYRDYDCNWDIKERQVFASDKAHEKWWQVYDEMPERLKQYCGLSPHMNWRIKKWRRVAKKLSLPDEHWKIGVTDPRQYNL 551          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: V4TAB3_9ROSI (Hexosyltransferase OS=Citrus clementina GN=CICLE_v10000664mg PE=3 SV=1)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 295/504 (58.53%), Postives = 377/504 (74.80%), Query Frame = -2
Query:  173 LDLLQEEINSKKEIKIGLVNINSNEEIQY-QLPGSV-VSTVHVRFDRVSKKRKWEDFFPFRIDENQQ----NCPEIPMPALEKYQDLDVVVAKLPCKG-WSGKSGMRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNL 1663
            LD++++ IN  K IK+GLVNIN +++  Y  + G + V TVHVRFD V + +KWEDFFP  IDE+ +     CPEIPMPA + Y  LDV+VA++PC+G      GMRDVF LQVNLVVAN+ VESGW+ P+V R VY VFVGSCG M E+FRC+DL+    D+ VYKP+LRRLK  +LMP GSCQ+A  + +TGKE WRY  +   RL  L Y+ + Q+EAY TVLH+SE YVCGA+ALAQSII+ NSTRDL+LLHD++I+ +SL GL+AAGW T+ I+ IRSPFA KDS+NEWN+S LR+W L  YDK++FID+D+LV  NID  F +P+LSAA NDK LFN GVMVIEPSLC FED+M+K  ++ SYNG  QG+LNEVF WWHRLP ++N LK F  ++  ++ ++ D +  +H+LGLKPWMCY+DYDCNWD      FASD AH +WWQVYD MP+ LQ YC LT+H++ R+KKWR IA +    + HWKI   DPRQY++
Sbjct:   87 LDIVEKHINGHK-IKVGLVNINDDDDDDYNSVRGDLHVETVHVRFDHVGEDKKWEDFFPEWIDEDHKWAPPACPEIPMPA-QDYPYLDVIVARVPCRGDGDAGGGMRDVFRLQVNLVVANLAVESGWLKPDVDRPVYVVFVGSCGAMVEMFRCDDLVEHAGDYWVYKPDLRRLKHKVLMPVGSCQIASAFAQTGKEIWRYFMS-QARLAKLNYTTYHQREAYVTVLHSSEAYVCGAIALAQSIIQKNSTRDLVLLHDKSISGKSLRGLRAAGWKTKWISRIRSPFAKKDSYNEWNYSKLRVWQLIEYDKIIFIDSDLLVLKNIDEFFFYPELSAAGNDKVLFNSGVMVIEPSLCKFEDMMLKSFKVSSYNGGDQGFLNEVFTWWHRLPKKINHLKVFSKQDD-KEHQVGDGLYAIHYLGLKPWMCYKDYDCNWDMVSRHIFASDSAHNEWWQVYDAMPKKLQQYCALTKHIDKRIKKWRRIAENANLANGHWKIKPKDPRQYHI 586          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: V4SFV9_9ROSI (Hexosyltransferase OS=Citrus clementina GN=CICLE_v10004021mg PE=3 SV=1)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 298/517 (57.64%), Postives = 384/517 (74.27%), Query Frame = -2
Query:  173 KHNPPPSNQRFRNLDLLQEEINSKKEIKIGLVNINSNEEIQY-QLPGSV-VSTVHVRFDRVSKKRKWEDFFPFRIDENQQ----NCPEIPMPALEKYQDLDVVVAKLPCKGWSGKSG-MRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNL 1702
            K+N      R + LD++++ IN  K IK+GLVNIN +++  Y  + G + V TVHVRFD V + +KWEDFFP  IDE+ +     CP+IPMPA + Y+ LDV+VA++PC G     G MRDVF LQVNLVVAN+ VESGW+ P+V RAVY VFVGSCG M E+FRC+DL+    D+ VYKP+LRRLK  +LMP GSCQ+A  + +TGKE WRY  +   RL  L Y+ + Q+EAY TVLH+SE YVCGA+ALAQSII+ NSTRDL+LLHD++I+ +SL GL+AAGW T+ I+ IRSPFA KDS+NEWN+S LR+W L  YDKV+FID+D+L+  N D  F +P+LSAA NDK LFN GVMVIEPSLC FED+M+K  ++ SYNG  QG+LN+VF WWHRLP ++N LK F  ++  ++ ++ D +  +H+LGLKPWMCY+DYDCNWD   +  FASD AH+KWWQVYD MP+ LQ YC LT+HM+ R+KKWR IA +    + HWKI   DPRQY++
Sbjct:   54 KYNTNHLLHRPKWLDIVEKHINGHK-IKVGLVNINDDDDDDYNSVRGDMHVETVHVRFDHVGEDKKWEDFFPEWIDEDHKWAPPACPDIPMPA-QDYRYLDVIVARIPCGGDGEGGGGMRDVFRLQVNLVVANLAVESGWLKPDVDRAVYVVFVGSCGAMVEMFRCDDLVEHAGDYWVYKPDLRRLKHKVLMPVGSCQIAPTFAQTGKEIWRYFMS-QARLAKLNYTTYHQREAYVTVLHSSEAYVCGAIALAQSIIQKNSTRDLVLLHDKSISGKSLRGLRAAGWKTKWISRIRSPFAKKDSYNEWNYSKLRVWQLIEYDKVIFIDSDLLILKNTDEFFFYPELSAAGNDKVLFNSGVMVIEPSLCKFEDMMLKSFKVSSYNGGDQGFLNKVFTWWHRLPKRINNLKVFSKQDD-KEHQVGDGLYAIHYLGLKPWMCYKDYDCNWDMVSLHVFASDSAHKKWWQVYDAMPKKLQQYCALTKHMDKRIKKWRRIAENASLANGHWKIKPKDPRQYHI 566          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: A0A058ZSV4_EUCGR (Hexosyltransferase (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_L01540 PE=3 SV=1)

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 268/484 (55.37%), Postives = 350/484 (72.31%), Query Frame = -2
Query:  203 KEIKIGLVNINSNEEIQYQLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQ----NCPEIPMPALEKYQDLDVVVAKLPCK-GWSGKSGMRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEK---ILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKI 1630
            K++++G VNI+   + ++ + G +   V V FDRV     W +FFP  I+E+ +    +CP+IPMP  E Y+DLDV+VAK+PC+ G   + G+RDVF LQVNLVVAN+ V +G +  ++ R +YAVF+GSCGPM EIFRC+DL+R V D+ VYKPE  RLKQ +LMP GSCQ+A  Y E GKE WR + +   + K    + ++ +EAYATVLH+SE YVCGA++LAQSI RT ST+DL+LL D++IT +SL GL+AAGW  R I+ IRSP A K ++NEWNFS LR+W LT YDKV+FIDAD++V  N+D  FV+PQLSA PN+  LFN G+MVIEPS C+FEDLM K  ++DSYNG  QG+LNE F WWHR P ++N+LK F     RR++K   + D +  +HFLGLKPWMCYRDYDCNWDKE    FASD  +  WW+VYD MP  LQ +CGLTE M++R++KWR IA+     + HWKI
Sbjct:    4 KKVRVGFVNIDDITDPEFAMKG-LAKAVKVTFDRVPGNLTWVNFFPSWINEDPKGRKPSCPDIPMPKFEDYRDLDVIVAKVPCEDGGDRRRGLRDVFRLQVNLVVANLAVGTGRINLDMNRKIYAVFLGSCGPMVEIFRCDDLVRHVGDYWVYKPEQGRLKQKVLMPVGSCQIAPAYAENGKERWRGYLSRSSQRKA-NGTKYRPREAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHIHRIRSPNAKKGAYNEWNFSKLRVWQLTQYDKVIFIDADLIVLRNLDEFFVYPQLSAVPNNGVLFNSGIMVIEPSNCVFEDLMSKSFKLDSYNGGDQGFLNEFFTWWHRWPSRLNYLKIF----ARRKDKEHTVPDNLYTMHFLGLKPWMCYRDYDCNWDKESYHAFASDSVNRLWWEVYDSMPRKLQSFCGLTEKMDFRIRKWRGIAKKANLANGHWKI 481          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: I1NBZ7_SOYBN (Hexosyltransferase OS=Glycine max PE=3 SV=2)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 284/502 (56.57%), Postives = 344/502 (68.53%), Query Frame = -2
Query:  176 INSKKEIKIGLVNINSNEEI----QYQLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDEN----QQNCPEIPMPALEKYQDLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVTP--EVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNST---RDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYN 1642
            IN+KK+IK+GLVNI++  +     Q     S V T+ + FD V K  KWED FP  IDEN    Q  CP +PMPAL+ Y DL+VVVAK+PC       G+RDVF LQVNLVVAN+ VESGWVT      R V+ VFVGSCGPM EIFRC+DLL    ++ VY+P+LRRLK   LMP GSCQ+A  Y ETGKEAWR   A     K+          AY TVLH+SE YVCGA+ALAQSI+ T +     DL+LL D +I P+S  GLKAAGW  + I  I SPFA K ++N+WN+S LR+W LT YDK++FID+D+LV  +I  LFV PQLSAAPN+KTLFN G+MVIEPS CMF  +M    ++ SYNG  QG+LNE+F WWHRLP +VN LK F    G    ++ D++  +H+LGLKPWMCYRDYDCNWD +    FASD AH +WWQVYD MP+ LQ YCGLTE MN R+ KWR IAR+    D HWKI V DPR+ N
Sbjct:   66 INNKKKIKVGLVNIDARVDGSIFEQLDTLDSQVDTISIDFDHVDKNLKWEDIFPEWIDENGKWGQPKCPNLPMPALQNYGDLNVVVAKVPC-------GIRDVFRLQVNLVVANLAVESGWVTKMESDHRKVHVVFVGSCGPMVEIFRCDDLLMHRPEYWVYRPDLRRLKHQTLMPLGSCQIAPGYAETGKEAWRIDVALTRVPKL----------AYVTVLHSSEAYVCGAIALAQSILGTQTMFIETDLVLLADNSIGPQSTTGLKAAGWKIKRIQRILSPFAKKGAYNQWNYSKLRMWQLTTYDKIIFIDSDLLVLRSIHHLFVLPQLSAAPNEKTLFNSGLMVIEPSQCMFRKMMNVTSKVRSYNGGDQGFLNEIFTWWHRLPAKVNQLKTFP-SSGHGMHELPDDVYAVHYLGLKPWMCYRDYDCNWDMQDRHVFASDSAHRRWWQVYDAMPKELQAYCGLTEKMNERIVKWRRIARNASFSDGHWKIKVQDPRRGN 549          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: U5GDP2_POPTR (Hexosyltransferase OS=Populus trichocarpa GN=POPTR_0005s03650g PE=3 SV=1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 280/503 (55.67%), Postives = 365/503 (72.56%), Query Frame = -2
Query:  173 DLLQEEINSKKEIKIGLVNINSNEEIQYQLPGSVVSTVHVRFDRVSKKRKWEDFFPFRIDENQQ----NCPEIPMPALEKYQDLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPY-GETGK-EAWRYHSADHERLKMLK-YSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNL 1660
            DL++ +I S++ IKIG VN++ N +  Y      V TV+V F  VSK+ KWE FFP  IDE+ +    +CPE+PMP LE Y+DLDV+VA++PC     K G+RDVF LQVNLVVAN++V +G       R V  +F+GSCGPMQEIFRC+DL+  + ++ VYKPELRRL+Q + MP GSCQ+A  +  +TG  E  RY +A++   + L  ++ + Q+ AYATVLH+SE YVCGA+ALAQSII+ NST DL+LLHD +++ +SL GL+ AGW T+ I  IRSPFA K+S+NEWN+S LR+W LT YDKV+FIDAD+++  NID  F +PQLSAAPNDK LFN G+MVIEPS C+FED+M K   + SYNG  QG+LNEVF WWHRLP ++N+LK  + ++    E +      +HFLGLKPW CY+DYDCNWD      FASD AH++WW+VYD MP+ LQ YCGLT+HM+ R+KKWR  A++   PD HWKI V DPRQY+L
Sbjct:   66 DLIERKIFSQR-IKIGFVNVDDNVKHAYDHMHGEVETVNVDFRPVSKELKWEKFFPEWIDEDARWHEPSCPEVPMPRLEDYRDLDVIVARVPCGSGIEKQGIRDVFRLQVNLVVANLVVANGLTEGGDDRTVSVIFIGSCGPMQEIFRCDDLMTHLGEYWVYKPELRRLRQKVQMPVGSCQIAPLHRDQTGNMEIQRYKTAEYSTTRKLNDHNLYHQRVAYATVLHSSEAYVCGAIALAQSIIQNNSTNDLVLLHDSSLSQKSLQGLRDAGWKTKQIQPIRSPFARKNSYNEWNYSKLRLWQLTDYDKVIFIDADLIILKNIDKFFAYPQLSAAPNDKVLFNSGIMVIEPSTCLFEDMMSKSRRLMSYNGGDQGFLNEVFTWWHRLPGKLNYLKICKRQDNPNHE-MEKGTYTIHFLGLKPWACYKDYDCNWDMANRHIFASDSAHKRWWKVYDAMPKKLQQYCGLTKHMDARIKKWRGKAKNANLPDGHWKISVKDPRQYHL 566          
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Match: D7KQ11_ARALL (Hexosyltransferase OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_337776 PE=3 SV=1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 264/509 (51.87%), Postives = 363/509 (71.32%), Query Frame = -2
Query:  173 PPPSNQRFRNLDLLQEEINSKKEIKIGLVNINSNEEIQYQLPGS-VVSTVHVRFDRVSKKRKWEDFFPFRIDENQQNCPEIPMPALEKYQ-DLDVVVAKLPCKGWSGKSGMRDVFMLQVNLVVANILVESGWVTPEVKRAVYAVFVGSCGPMQEIFRCEDLLRKVEDHRVYKPELRRLKQTMLMPPGSCQLAQPYGETGKEAWRYHSADHERLKMLKYSAFQQKEAYATVLHTSEDYVCGAVALAQSIIRTNSTRDLILLHDENITPESLVGLKAAGWDTRLINGIRSPFADKDSFNEWNFSPLRIWMLTWYDKVVFIDADVLVFNNIDWLFVFPQLSAAPNDKTLFNYGVMVIEPSLCMFEDLMVKVLEMDSYNGSYQGWLNEVFIWWHRLPFQVNFLKDFEGEEGRRQEKILDEISVLHFLGLKPWMCYRDYDCNWDKEGMQRFASDKAHEKWWQVYDEMPETLQPYCGLTEHMNWRLKKWRWIARSLKQPDEHWKIGVTDPRQYNL 1693
            PP  N+  +   L++  +  +K I++G +NI+  E  +Y+  G  +V  +HV  D + K   W+  +P  I+E   NCPEIP+P  E    ++DV+VA++PC GWS   G+RDVF LQVNL VAN+ V+SG     V +AVY VF+GSCGPM EIF C++ +R+V+D+ VYKP L RLKQ +LMP GSC +A P+ + G+EAWR    D+   + +     + + AY TVLH+SE YVCGA+ALAQSI +T S +D+ILLHD  IT +SL+GL +AGW+ RLI  IRSPF+ KDS+NEWN+S LR+W +T YDK+VFIDAD+++   ID+LF +PQLSA+ NDK LFN G+MV+EPS CMF+DLM K  +++SYNG  QG+LNE+F+WWHRL  +VN +K F+ E+ +R+  + + +  LH+LGLKPW+CYRDYDCNWD    + FASD  HEKWW+VYD+M + L+ YCGL ++M  R++KWR IA++   PD HW+I V DPR+ NL
Sbjct:   53 PPQVNKNPKWFRLIRNYL-PEKRIQVGFLNIDQIERERYEARGPLIVKNIHVPLDPIPKNVTWKSLYPEWINEEVSNCPEIPLPQPEGSDANVDVIVARVPCDGWSENKGLRDVFRLQVNLAVANLAVQSG--LRRVDQAVYVVFIGSCGPMHEIFPCDERVRRVDDYWVYKPYLPRLKQKLLMPVGSCHIAPPFAQFGQEAWRPKHKDNLVSEAVTALPRRLRVAYVTVLHSSEAYVCGAIALAQSIRQTGSHKDMILLHDHTITNKSLIGLSSAGWNLRLIERIRSPFSQKDSYNEWNYSKLRVWQVTDYDKLVFIDADLIILKKIDYLFYYPQLSASGNDKVLFNSGIMVLEPSACMFKDLMEKSFKIESYNGGDQGFLNEIFVWWHRLSKRVNTMKYFD-EKSQRRHDLPENLEGLHYLGLKPWVCYRDYDCNWDMSERRVFASDSVHEKWWKVYDKMSDQLKGYCGLNKNMEKRIEKWRRIAKNNSLPDRHWEIEVRDPRKTNL 557          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
GUX4_ARATH0.000e+053.17Putative UDP-glucuronate:xylan alpha-glucuronosylt... [more]
GUX5_ARATH8.742e-17150.89Putative UDP-glucuronate:xylan alpha-glucuronosylt... [more]
GUX2_ARATH2.413e-14145.61UDP-glucuronate:xylan alpha-glucuronosyltransferas... [more]
GUX1_ARATH4.186e-11740.54UDP-glucuronate:xylan alpha-glucuronosyltransferas... [more]
GUX3_ARATH1.599e-11640.43Putative UDP-glucuronate:xylan alpha-glucuronosylt... [more]
GUX6_ARATH1.201e-1934.12Inositol phosphorylceramide glucuronosyltransferas... [more]
GLYG2_HUMAN2.799e-1932.30Glycogenin-2 OS=Homo sapiens GN=GYG2 PE=1 SV=2[more]
GYG1_CAEEL1.045e-1630.52Glycogenin-1 OS=Caenorhabditis elegans GN=gyg-1 PE... [more]
GOLS6_ARATH6.533e-1627.92Galactinol synthase 6 OS=Arabidopsis thaliana GN=G... [more]
GLYG_MOUSE6.565e-1630.73Glycogenin-1 OS=Mus musculus GN=Gyg1 PE=1 SV=3[more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092162 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2SCU2_GOSRA0.000e+097.47Hexosyltransferase OS=Gossypium raimondii GN=B456_... [more]
A0A061F2R6_THECC0.000e+068.16Hexosyltransferase OS=Theobroma cacao GN=TCM_02656... [more]
A0A061F3T4_THECC0.000e+068.47Hexosyltransferase OS=Theobroma cacao GN=TCM_02656... [more]
A0A0D2ST33_GOSRA0.000e+064.17Hexosyltransferase OS=Gossypium raimondii GN=B456_... [more]
V4TAB3_9ROSI0.000e+058.53Hexosyltransferase OS=Citrus clementina GN=CICLE_v... [more]
V4SFV9_9ROSI0.000e+057.64Hexosyltransferase OS=Citrus clementina GN=CICLE_v... [more]
A0A058ZSV4_EUCGR0.000e+055.37Hexosyltransferase (Fragment) OS=Eucalyptus grandi... [more]
I1NBZ7_SOYBN0.000e+056.57Hexosyltransferase OS=Glycine max PE=3 SV=2[more]
U5GDP2_POPTR0.000e+055.67Hexosyltransferase OS=Populus trichocarpa GN=POPTR... [more]
D7KQ11_ARALL0.000e+051.87Hexosyltransferase OS=Arabidopsis lyrata subsp. ly... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002495Glycosyl transferase, family 8PFAMPF01501Glyco_transf_8coord: 272..470
e-value: 4.3E-11
score: 42.7
IPR029044Nucleotide-diphospho-sugar transferasesGENE3D3.90.550.10coord: 265..510
e-value: 9.9E-64
score: 214.6
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILY53448Nucleotide-diphospho-sugar transferasescoord: 269..509
NoneNo IPR availablePANTHERPTHR11183GLYCOGENINcoord: 150..550
NoneNo IPR availablePANTHERPTHR11183:SF51UDP-GLUCURONATE:XYLAN ALPHA-GLUCURONOSYLTRANSFERASE 4-RELATEDcoord: 150..550
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 12..30
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 31..553
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..11
NoneNo IPR availableTMHMMTMhelixcoord: 12..31

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092162 ID=g.barbadense_cottongen_reftransV1_0092162|Name=g.barbadense_cottongen_reftransV1_0092162|organism=Gossypium barbadense|type=contig|length=1901bp
GAGGTTTGTGGCATAAGTTGAATCCTTGTTCCACACTTTCAAAATCTTAC
ATAAAATCTATAAAAAAAAAAACACCAAATACATACTATTTTGCATTAGA
AAGAAAAAATAAAGACATAAATTCTTCTGATTTTCCCTTCAAGAATTTGG
CACTTACCCTTTCTCAAGCACCAAGATTGTACTGTCGAGGATCTGTTACA
CCAATCTTCCAATGTTCATCAGGTTGTTTAAGGCTCCTAGCTATCCATCT
CCACTTCTTTAATCTCCAATTCATGTGCTCTGTTAGGCCACAATATGGTT
GCAGTGTCTCAGGCATTTCATCATACACTTGCCACCATTTCTCATGAGCT
TTATCACTTGCAAACCTCTGCATTCCTTCCTTATCCCAATTACAATCATA
ATCCCTGTAACACATCCATGGCTTCAACCCCAGAAAATGTAGGACCGAAA
TCTCATCCAGGATCTTTTCCTGACGCCGGCCTTCTTCCCCTTCGAAATCC
TTGAGGAAATTCACCTGAAAAGGCAACCTATGCCACCATATAAAGACTTC
ATTCAACCACCCTTGATAACTGCCATTGTATGAATCCATTTCCAAAACTT
TAACCATCAAATCTTCAAACATACACAATGATGGCTCTATCACCATCACC
CCATAATTAAACAAGGTTTTATCATTTGGAGCAGCTGATAGTTGAGGAAA
AACGAATAGCCAATCAATGTTGTTGAAAACTAGAACATCTGCATCAATGA
AAACAACTTTATCATACCAAGTTAGCATCCATATTCTAAGAGGACTAAAA
TTCCATTCATTGAATGAATCTTTGTCAGCAAAGGGGCTTCGGATTCCATT
GATTAACCGGGTGTCCCAACCAGCAGCTTTTAAACCCACTAAGGATTCGG
GGGTGATATTTTCATCATGAAGAAGAATTAAATCTCGGGTCGAATTGGTT
CGGATTATGCTTTGAGCCAAAGCAACGGCACCACAAACATAATCTTCGGA
TGTGTGAAGAACTGTTGCATAGGCTTCCTTTTGCTGGAACGCACTGTATT
TTAGCATTTTTAGCCTTTCATGATCTGCTGAATGGTATCTCCATGCTTCT
TTACCAGTTTCACCGTATGGCTGTGCAAGTTGGCAGGAGCCTGGAGGCAT
AAGCATGGTTTGTTTAAGCCTCCTTAGCTCAGGCTTATACACCCTATGAT
CCTCCACTTTCCTCAACAGATCTTCGCATCTGAATATCTCCTGCATCGGC
CCACAGCTCCCCACAAAGACTGCGTACACCGCCCGTTTTACCTCCGGCGT
CACCCACCCACTCTCTACCAATATATTCGCCACCACCAAATTCACTTGAA
GCATAAACACATCCCTCATCCCGCTTTTCCCGCTCCACCCTTTGCAAGGC
AGCTTCGCCACCACCACGTCCAGATCCTGGTACTTCTCCAGGGCTGGCAT
CGGAATCTCCGGACAATTCTGCTGGTTTTCATCGATCCGGAAGGGGAAAA
AATCCTCCCATTTTCTCTTCTTGGAAACACGATCGAAGCGAACGTGGACG
GTGCTAACAACTGAACCGGGTAGCTGATATTGGATTTCTTCATTGGAATT
GATATTAACTAAACCGATTTTAATCTCCTTCTTACTATTAATCTCTTCTT
GAAGAAGATCGAGGTTTCTGAAGCGTTGGTTGGAGGGAGGCGGATTGTGT
TTAAAAGCATCGATGATGTTGTAATTTGATCTGGAAAATAAAACGAAAAT
GATCAAGGATAAAGAGAGAAGTGTTATTGAGAGAGTGAAGGATTTTTGGT
TGCAATGGAAGGATTTGGAAGCCATTTTTGGAGTATTGATTCAATTTCTT
AGAACGTTGAATGGGAAGAACCGAAGAAGAGAGTTTGAAGGGAAATATAA
C
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002495Glyco_trans_8
IPR029044Nucleotide-diphossugar_trans
Vocabulary: Molecular Function
TermDefinition
GO:0016757transferase activity, transferring glycosyl groups