g.barbadense_cottongen_reftransV1_0092022, g.barbadense_cottongen_reftransV1_0092022 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092022
Unique Nameg.barbadense_cottongen_reftransV1_0092022
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2863
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
At11chromosomeg.barbadense_cottongen_reftransV1_0092022:1..2863 .
At11:88801099..88804621 +
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy Swiss-Prot
Match: POLX_TOBAC (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 9.325e-49
Identity = 99/292 (33.90%), Postives = 160/292 (54.79%), Query Frame = 3
Query: 1998 NTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQ-QGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDG--IFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLY-LTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            + VC+  KSLYGLKQA RQW +K    + S  + ++  D  ++ K+    N ++LL+YVDD++I G D+ LI +LKG L+++F MKDLG  +  LG++I+R +    ++L+Q KY   ++    +  AK  +TPL  + KL+       +  EEK +     K  Y   +G L+Y +  TRPDI +AV  +S+F+++P   H      ++RY++ + G  +    S    L  + D+D A    +RKS TG+         SW+ K Q  VA S+ E +Y +   T  E++W
Sbjct:  951 HMVCKLNKSLYGLKQAPRQWYMKFDSFMKSQTYLKTYSDPCVYFKRFSENNFIILLLYVDDMLIVGKDKGLIAKLKGDLSKSFDMKDLGPAQQILGMKIVRERTSRKLWLSQEKYIERVLERFNMKNAKPVSTPLAGHLKLSKKMCPTTV--EEKGN---MAKVPYSSAVGSLMYAMVCTRPDIAHAVGVVSRFLENPGKEHWEAVKWILRYLRGTTGDCLCFGGSDPI-LKGYTDADMAGDIDNRKSSTGYLFTFSGGAISWQSKLQKCVALSTTEAEYIAATETGKEMIW 1236          

HSP 2 Score: 77.0258 bits (188), Expect = 9.325e-49
Identity = 47/119 (39.50%), Postives = 75/119 (63.03%), Query Frame = 2
Query: 1589 EPKSYSEAVQNPA*---IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            EP+S  E + +P     +KAM+EE+ +L+ N T+ +V LP  K  + CK+  K+K     ++ R+KARLV KG+ QK+G+ + + FSPV K+ ++R +L+LA      + Q+DV  AFL
Sbjct:  810 EPESLKEVLSHPEKNQLMKAMQEEMESLQKNGTYKLVELPKGKRPLKCKWVFKLKKDGDCKLVRYKARLVVKGFEQKKGIDFDEIFSPVVKMTSIRTILSLAASLDLEVEQLDVKTAFL 928          

HSP 3 Score: 26.1794 bits (56), Expect = 9.325e-49
Identity = 10/14 (71.43%), Postives = 11/14 (78.57%), Query Frame = 1
Query: 1942 DLCEEVYMELPTGF 1983
            DL EE+YME P GF
Sbjct:  931 DLEEEIYMEQPEGF 944          

HSP 4 Score: 105.145 bits (261), Expect = 1.355e-41
Identity = 57/140 (40.71%), Postives = 79/140 (56.43%), Query Frame = 2
Query:  788 GIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYA-TQTPYKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHES 1204
            GI H+     TPQ NGV ER +R ++E  +++   +K+   FWGE V+TACYLIN  PS  L  + P  +  N + + SHLKVFGC  +A      + K   K IP +F+GY   + GY L++   K    +RDV F ES
Sbjct:  568 GIRHEKTVPGTPQHNGVAERMNRTIVEKVRSMLRMAKLPKSFWGEAVQTACYLINRSPSVPLAFEIPERVWTNKEVSYSHLKVFGCRAFAHVPKEQRTKLDDKSIPCIFIGYGDEEFGYRLWDPVKKKVIRSRDVVFRES 707          

HSP 5 Score: 88.9669 bits (219), Expect = 1.355e-41
Identity = 44/133 (33.08%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  357 SLWYARLGHVPSSKLHHVPFLQSFSF-DDNLIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKF 752
             LW+ R+GH+    L  +      S+     +  C  C   +Q R  F  S  R     DLV+ D+ GP  I +  G++YF+T +DD SR  WVY+LK K +     ++F  LV+ +    +K  RSDNG ++
Sbjct:  423 DLWHKRMGHMSEKGLQILAKKSLISYAKGTTVKPCDYCLFGKQHRVSFQTSSERKLNILDLVYSDVCGPMEIESMGGNKYFVTFIDDASRKLWVYILKTKDQVFQVFQKFHALVERETGRKLKRLRSDNGGEY 555          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy Swiss-Prot
Match: M810_ARATH (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.245e-44
Identity = 87/227 (38.33%), Postives = 136/227 (59.91%), Query Frame = 3
Query: 2187 TGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPL--EQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            TG+   L+  L   L+  F MKDLG + YFLG++I     G+FL+Q KYA +++ ++G+   K  +TPL  + N+ ++  +Y               D + ++ ++G L YLT TRPDI+YAV+ + Q M  P ++  +   RV+RY+K +   G+ +  +S   +  FCDSD A C  +R+S TGFC  LG ++ SW  K+Q TV+RSS ET+YR++A TA+E+ W
Sbjct:   13 TGSSNTLLNMLIFQLSSTFSMKDLGPVHYFLGIQIKTHPSGLFLSQTKYAEQILNNAGMLDCKPMSTPLPLKLNSSVSTAKY--------------PDPSDFRSIVGALQYLTLTRPDISYAVNIVCQRMHEPTLADFDLLKRVLRYVKGTIFHGLYIHKNSKLNVQAFCDSDWAGCTSTRRSTTGFCTFLGCNIISWSAKRQPTVSRSSTETEYRALALTAAELTW 225          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy Swiss-Prot
Match: COPIA_DROME (Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3)

HSP 1 Score: 127.102 bits (318), Expect = 1.706e-42
Identity = 89/296 (30.07%), Postives = 148/296 (50.00%), Query Frame = 3
Query: 1995 GNTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGG---NXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTH-TRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQ--LITFCDSDCASCPMSRKSVTGFCIKLGN-SLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
             + VC+  K++YGLKQA+R W     QAL    F  S  D  ++   +G    N+ +LL   D ++ TG D   +   K  L + F+M DL E+K+F+G+ I   +D I+L+Q  Y  ++++   +    + +TPL        +  D+               T  + LIG L+Y+   TRPD+T AV+ LS++             RV+RY+K +    ++   + + +  +I + DSD A   + RKS TG+  K+ + +L  W  K+QN+VA SS E +Y ++     E +W
Sbjct: 1028 SDNVCKLNKAIYGLKQAARCWFEVFEQALKECEFVNSSVDRCIYILDKGNINENIYVLLYVDDVVIATG-DMTRMNNFKRYLMEKFRMTDLNEIKHFIGIRIEMQEDKIYLSQSAYVKKILSKFNMENCNAVSTPLPSKINYELLNSDEDCN------------TPCRSLIGCLMYIMLCTRPDLTTAVNILSRYSSKNNSELWQNLKRVLRYLKGTIDMKLIFKKNLAFENKIIGYVDSDWAGSEIDRKSTTGYLFKMFDFNLICWNTKRQNSVAASSTEAEYMALFEAVREALW 1310          

HSP 2 Score: 68.5514 bits (166), Expect = 1.706e-42
Identity = 37/101 (36.63%), Postives = 62/101 (61.39%), Query Frame = 2
Query: 1634 KAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            +A+  E++  + NNTWT+   P  K+ +  ++   +KY       R+KARLVA+G++QK  + Y +TF+PVA++ + R +L+L   +   + QMDV  AFL
Sbjct:  908 EAINTELNAHKINNTWTITKRPENKNIVDSRWVFSVKYNELGNPIRYKARLVARGFTQKYQIDYEETFAPVARISSFRFILSLVIQYNLKVHQMDVKTAFL 1008          

HSP 3 Score: 21.9422 bits (45), Expect = 1.706e-42
Identity = 8/12 (66.67%), Postives = 9/12 (75.00%), Query Frame = 1
Query: 1945 LCEEVYMELPTG 1980
            L EE+YM LP G
Sbjct: 1012 LKEEIYMRLPQG 1023          

HSP 4 Score: 97.4413 bits (241), Expect = 2.193e-34
Identity = 60/167 (35.93%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  788 GIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVL--HNKFPFEILYNIQPNLSHLKVFGCLCYATQTPYKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPFHFAPIDSSVFFPPQLQILDSDF 1282
            GI +     HTPQ NGV+ER  R + E A+ +   +K+   FWGE V TA YLIN +PS  L   +K P+E+ +N +P L HL+VFG   Y      + KF  K   S+F+GY     G+ L++   + F V RDV   E+      A    +VF     +  + +F
Sbjct:  568 GISYHLTVPHTPQLNGVSERMIRTITEKARTMVSGAKLDKSFWGEAVLTATYLINRIPSRALVDSSKTPYEMWHNKKPYLKHLRVFGATVYVHIKNKQGKFDDKSFKSIFVGYEPN--GFKLWDAVNEKFIVARDVVVDETNMVNSRAVKFETVFLKDSKESENKNF 732          

HSP 5 Score: 72.4034 bits (176), Expect = 2.193e-34
Identity = 46/157 (29.30%), Postives = 71/157 (45.22%), Query Frame = 3
Query:  315 HSIDCMHSVLDNNTSLWYARLGHVPSSKLHHVPFLQSFS---FDDNLIHSCAVCPL---ARQTRQPFSN--SVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKFFNS 761
            +SI+  H    NN  LW+ R GH+   KL  +     FS     +NL  SC +C      +Q R PF      T   +P  +VH D+ GP    T     YF+  VD  +     YL+K+KS+     + F+   +  F+  + Y   DNG ++ ++
Sbjct:  405 YSINAKHK---NNFRLWHERFGHISDGKLLEIKRKNMFSDQSLLNNLELSCEICEPCLNGKQARLPFKQLKDKTHIKRPLFVVHSDVCGPITPVTLDDKNYFVIFVDQFTHYCVTYLIKYKSDVFSMFQDFVAKSEAHFNLKVVYLYIDNGREYLSN 558          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy Swiss-Prot
Match: YCH4_YEAST (Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 5.184e-23
Identity = 86/296 (29.05%), Postives = 142/296 (47.97%), Query Frame = 3
Query: 1980 FLQSRG-NTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDG-IFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHT-RPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKK-QNTVARSSAETKYRSMAATASEI 2855
            F+  R  + V      +YGLKQA   WN  +   L    F + + ++ L+ +      + + +YVDDL++      +   +K  L + + MKDLG++  FLGL I +  +G I L+ + Y  +  ++S I   K   TPL  +  L            E     L+D T YQ ++G+LL+  +T RPDI+Y V  LS+F++ P+  HL +A RV+RY+  +    +   S S   L  +CD+   +      S  G+   L  +  +W  KK +  +   S E +Y + + T  EI
Sbjct:   24 FVNERNPDYVWELYGGMYGLKQAPLLWNEHINNTLKKIGFCRHEGEHGLYFRSTSDGPIYIAVYVDDLLVAAPSPKIYDRVKQELTKLYSMKDLGKVDKFLGLNIHQSSNGDITLSLQDYIAKAASESEINTFKLTQTPLCNSKPLF-----------ETTSPHLKDITPYQSIVGQLLFCANTGRPDISYPVSLLSRFLREPRAIHLESARRVLRYLYTTRSMCLKYRSGSQLALTVYCDASHGAIHDLPHSTGGYVTLLAGAPVTWSSKKLKGVIPVPSTEAEYITASETVMEI 308          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy Swiss-Prot
Match: M240_ARATH (Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.885e-16
Identity = 39/79 (49.37%), Postives = 55/79 (69.62%), Query Frame = 3
Query: 2508 LYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFC 2744
            +YLT TRPD+T+AV+ LSQF    + + +    +V+ Y+K + GQG+  S++S  QL  F DSD ASCP +R+SVTGFC
Sbjct:    1 MYLTITRPDLTFAVNRLSQFSSASRTAQMQAVYKVLHYVKGTVGQGLFYSATSDLQLKAFADSDWASCPDTRRSVTGFC 79          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy Swiss-Prot
Match: M820_ARATH (Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.323e-15
Identity = 43/105 (40.95%), Postives = 70/105 (66.67%), Query Frame = 2
Query: 1571 STSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALA 1885
            +T+   EPKS   A+++P   +AM+EE+  L  N TW +VP P+ ++ + CK+  K K  +   ++R KARLVAKG+ Q+EG+ +V+T+SPV +  T+R +L +A
Sbjct:   21 TTTIKKEPKSVIFALKDPGWCQAMQEELDALSRNKTWILVPPPVNQNILGCKWVFKTKLHSDGTLDRLKARLVAKGFHQEEGIYFVETYSPVVRTATIRTILNVA 125          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: Q0PY40_SOLLC (Putative polyprotein OS=Solanum lycopersicum PE=4 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 0.000e+0
Identity = 179/411 (43.55%), Postives = 249/411 (60.58%), Query Frame = 2
Query:  752 LQFNCSSLFTDLGIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYATQTPYKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPF-------------HFAPIDSSVFFPPQLQILDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGCSSFPHDPLCCFSRIFKPPNWLHDXXXXXXXXXXXXXXXNHIFYSHLPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFLQVI 1945
            L   C  LF  LGI+HQS C HTPQQNGV ERKHRH+L +A+A++FQ+ + ++FWG C++ A YL+N LPSS   NK  +E+LY  QP+L HLKV GCLCYAT  P  DKFS +   ++ +GYS  QKGY+L ++ +    VNRDV FHE +FPF             H +P++ +     + +I +S  +H   S        +   + +    S   +    S +     S     +   SR  K P W+ D+  +   SS++  +++++ Y  L    + FLS  S   EPK++ +A Q+   I+AM++EI  LE NNTW VV LP    ++  K+  K+KYKA+ E+ERFKARLVAKGYSQ+EG+ Y DTFSPVAK+VTVR V+ALA    W L+QMDV+NAFLQ +
Sbjct:  633 LNSQCKDLFNHLGILHQSSCPHTPQQNGVVERKHRHILNIARAIRFQAHLPIRFWGYCIRAAVYLMNRLPSSANSNKSAYELLYCKQPSLFHLKVIGCLCYATTVPKGDKFSARASAAILLGYSELQKGYVLLDIHSTKVHVNRDVVFHEEIFPFAKERSQLDPLGDVHGSPLEKAENQTIEAEIDNS--VHAETSMVHEDSQGNETESYSENQMSRPSTTEEVSENTHAIPSHVDSYVRRSSRNIKEPMWMKDYTITKGHSSTKHPMASYLNYEKLKPECRSFLSKLSEYTEPKNFKQASQDERWIQAMKQEIKALEENNTWQVVELPEGMHAVGSKWIYKVKYKANGEIERFKARLVAKGYSQQEGLDYHDTFSPVAKMVTVRCVIALAVSKGWTLYQMDVYNAFLQGV 1041          

HSP 2 Score: 298.516 bits (763), Expect = 0.000e+0
Identity = 161/294 (54.76%), Postives = 211/294 (71.77%), Query Frame = 3
Query: 1980 FLQSRGNTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            F +   N VC+  KSLYGLKQASRQWNLKLT+ L +  F QS +DYSLFT ++G ++V++L+YVDDL+ITG++  LI E+K  L++ FK+KDLGELK+FLG+E+LR   GI LNQRKY LELIA++G+ GAK AT P+E N +LT++E+DQ  G    +D +L D T YQRLIG+L+Y+T TRPDI+YAV  LSQFMQ PK SH+  A RV+RY+K S GQG+ L S  +  +  +CDSD A+CP +R+S+TG+ IK G                SSAE +YRSMA+  SEI W
Sbjct: 1054 FAKPGENKVCKLLKSLYGLKQASRQWNLKLTKVLQATGFSQSAHDYSLFTLKRGEDIVIVLVYVDDLLITGSNMQLIAEVKACLHKQFKLKDLGELKFFLGIEVLRSSGGIILNQRKYILELIAEAGLTGAKPATAPMESNLRLTSVEHDQANGY--NKDDVLHDITSYQRLIGKLIYVTITRPDISYAVQTLSQFMQSPKKSHIEAATRVIRYLKGSVGQGVWLHSEPTNIITCWCDSDWAACPNTRRSITGYVIKFG---------------ESSAEAEYRSMASAVSEITW 1330          

HSP 3 Score: 149.443 bits (376), Expect = 0.000e+0
Identity = 78/195 (40.00%), Postives = 115/195 (58.97%), Query Frame = 3
Query:  192 LFDGKMKGIGKESRGLYXXXXXXXXXXXXXXXXXXXXXXNIHSIDCMHSVLD-----NNTSLWYARLGHVPSSKLHHVPFLQSFSFDDNLIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKFFNS 761
            L  G++KGIG+E  GLY F ++  +                  I C   ++D      +T +W+ RLGH PS ++  +  + S S  D +   C VCPLA+QTR  F  S TR++  FD+VH+D+WGPY+  T +   YFLTIVDD+SR  WV+LL+ KSE ++ +K F  ++  QF++ +K  RSDNG++F NS
Sbjct:  455 LCSGRVKGIGREEGGLYSFKANFSSKQK-------------EEIKCAQEIVDAGVVRQDTEIWHRRLGH-PSQQILKLLKIDSSSKGDGIPAHCPVCPLAKQTRLTFPVSTTRTSMMFDVVHMDLWGPYKTPTLNRKHYFLTIVDDYSRFVWVHLLQLKSETIVAIKNFFSMINTQFNSHVKVVRSDNGTEFLNS 635          

HSP 4 Score: 41.2022 bits (95), Expect = 0.000e+0
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 2
Query:   32 NIAGISHCLSVSEDSPSWILDTGATDHMISDSQSLISPIS-CASGSGFVHLPNG 190
            N+AGI+ CL  +     WI+D+GAT H+I++ Q L +      S    VHLP G
Sbjct:  376 NMAGITTCLMTNPAIQDWIVDSGATHHIIANKQLLTTRHELTKSQMNQVHLPTG 429          

HSP 5 Score: 24.6386 bits (52), Expect = 0.000e+0
Identity = 9/13 (69.23%), Postives = 11/13 (84.62%), Query Frame = 1
Query: 1945 LCEEVYMELPTGF 1983
            L EEVYM++P GF
Sbjct: 1042 LGEEVYMKMPEGF 1054          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: M1ANG9_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400010287 PE=4 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 6.877e-160
Identity = 169/406 (41.63%), Postives = 233/406 (57.39%), Query Frame = 2
Query:  761 NCSSLFTDLGIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYAT-QTPYKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPFHFAPIDSSVFFPPQLQILDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGC--SSFPHDPLCCF-SRIFKPPNWLHDXXX---XXXXXXXXXXXXNHIFYSH-------LPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
              ++   + GIIH+  C +TPQQNGV ERKH++LLE A+AL FQSK+ LK+WGECV  A Y+IN LP+S +  K P+E+LYN +P  SH++ FGCLCY T   P++DKF  +  P +F+GY    KGY + +L TK   ++RDV F ES+FPF+  P  SS  FP  L  +   F+ I   +          +       +   ++P+  T  P    SS P   + C  SR  K P +LHD++     T    +     N +F  H       L   +Q  + + S+  EP SY EA  NPA   AM +E   L +N+TW +V LP  K +I C++  K+K KA   +ERFKARLV KGY+Q+ G+ Y +TFSPV K+ TVR +LA A    W +FQ+DV NAFL
Sbjct:   98 ETTAFLKNKGIIHEKTCPYTPQQNGVVERKHKYLLETARALLFQSKLPLKYWGECVLCATYIINRLPTSHMKGKCPYELLYNTKPVYSHMRTFGCLCYPTLPKPHRDKFQARTTPHIFLGYPFGSKGYKVLSLATKKIHISRDVVFKESIFPFNVLPDVSS--FPSVLHSV--PFIDIVHPNIESQLVQHVENTVIDASDTLPHTSPNHVTDSPTTIHSSNPEPTVSCRPSRPHKLPTYLHDYVLPRPMTKPLQNSNISLNSVFSKHQHIPPEVLALESQSLVRNVSNDDEPSSYGEAAMNPAWQHAMTQEFEALHTNHTWDLVNLPNGKKAIGCRWVYKVKPKADGTIERFKARLVVKGYTQEAGVDYTETFSPVIKMTTVRALLATAVKKGWNIFQLDVNNAFL 499          

HSP 2 Score: 246.899 bits (629), Expect = 6.877e-160
Identity = 132/290 (45.52%), Postives = 188/290 (64.83%), Query Frame = 3
Query: 1992 RGNTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            +   VC+  KSLYGLKQASRQW  KLT+AL S  +  S  DYSLF K+   + + + +YVDD+++TG  +  I+ELK  L+  FK+KDLG L YFLG+E+L  +DG+ ++QRK+ L+L+ D  +    S  +PL+   KL A           KE + L +   Y++L+G+L +LT+TR DI+Y+V  LSQFMQ P+  HL  A  ++RY+K  P  GI +S   S  +  +CDSD A+CP +RKSV+G+ + LGNS  SWK KKQ T++ SSAE +YR++   A E+VW
Sbjct:  519 KPGMVCKLNKSLYGLKQASRQWYAKLTEALYSKGYTHSLNDYSLFHKKSENSSIFVAVYVDDVILTGTSDSEIEELKIFLHDKFKIKDLGRLHYFLGMEVLYKEDGLIISQRKFVLDLLKDYKVASMSSCNSPLDPAVKLHA-----------KEGAPLSEPLFYRKLVGKLNFLTNTRMDISYSVQHLSQFMQDPREPHLQAAFHILRYLKADPTLGIFMSQDQSYNVKAYCDSDWAACPDTRKSVSGYIVLLGNSPLSWKSKKQETISLSSAEAEYRALRKVAGELVW 797          

HSP 3 Score: 103.605 bits (257), Expect = 6.877e-160
Identity = 44/97 (45.36%), Postives = 66/97 (68.04%), Query Frame = 3
Query:  471 LARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKFFNS 761
            +ARQ R PF +S   S + F L+H+D+WGPY + TH  +RYF+T+VDD+SR TW  LL  KS  L  +K F+ +++ QF+  ++  R+DNG +F N+
Sbjct:    1 MARQERLPFPHSTHTSTRIFQLLHIDLWGPYHMVTHDNYRYFITLVDDYSRCTWTQLLTCKSNTLEVIKNFLSMIQTQFNTCVQTIRTDNGLEFVNT 97          

HSP 4 Score: 24.6386 bits (52), Expect = 6.877e-160
Identity = 10/18 (55.56%), Postives = 12/18 (66.67%), Query Frame = 1
Query: 1942 DLCEEVYMELPTGFCSQE 1995
            DL EEVYME+P G    +
Sbjct:  502 DLHEEVYMEVPPGLVVHK 519          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: M4CW55_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis GN=Bra008452 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.615e-155
Identity = 162/391 (41.43%), Postives = 229/391 (58.57%), Query Frame = 2
Query:  770 SLFTDLGIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYATQTPY-KDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPF-HFAPIDSSVFFPPQLQILDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGCSSFPHDPLCCFSRIFKPPNWLHDXXXXXXXXXXXXXXXNHIFYSHLPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            +L+ + GII    C  TP+QN V ERKH+HLL VA+AL FQS V L  WG+C+ TA +LIN  PS V+ NK PFE+L +  P+ S+LK FGCLCYA+ +P  + KF  +    VF+GY S  KGY L ++++ + F++R+V FHE++FPF H  P      F PQL   DSD                                     +VP  ++   DP     R+ KPP  L D+  +++ S ++  ISN + Y  L     +F+++ +S+ EP+++ +A +      AM  EI+ LE NNTW V  LP  K ++ CK+  K+K  A   +ER+KARLVAKGY+Q+EG+ YV+TFSPVAKL TV+++LA+A    W L Q+DV NAFL
Sbjct:  476 ALYKEKGIIPYHSCPETPEQNSVVERKHQHLLNVARALLFQSGVPLSHWGDCILTAVFLINRTPSQVIGNKTPFEMLTSKLPDYSNLKTFGCLCYASTSPKGRHKFQDRARACVFLGYPSGYKGYKLLDIQSHAVFISRNVVFHENLFPFLHSTPTAGQAEFFPQLHT-DSD----------------------------------TPDTVPAPTTGT-DPQPSTRRVSKPPRHLQDYDCNSINSCTEHPISNFLSYDGLSDPYLIFINAVNSIPEPRNFDQACKLKEWCDAMGIEITALEENNTWLVCSLPEGKRAVGCKWVFKVKLNADGTLERYKARLVAKGYTQQEGIDYVETFSPVAKLSTVKLLLAVAAAKNWSLSQLDVSNAFL 830          

HSP 2 Score: 226.868 bits (577), Expect = 3.615e-155
Identity = 130/288 (45.14%), Postives = 192/288 (66.67%), Query Frame = 3
Query: 1998 NTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            N VC+ +KSLYGLKQASRQW LK ++ L+   F+ S  D++LF K  G   + +L+YVDD++I  + +   + LK  L+ +FK++DLG L+YFLGLEI R   GI + QRKY L+L+ D+G+ G K ++ P++ + KL+  + D           LL +  +Y+RLIG+LLYLT TRPDIT+AVH L QF   P+  HL  A +V+ Y+K + G G+  S++S  +L  F D+D  SCP +R+SV+G C+ +G SL +WK  KQ+TV+ SSAE++YR+M+    E++W
Sbjct:  857 NAVCKLKKSLYGLKQASRQWFLKFSETLLQMGFKVSSGDHTLFLKHSGKAYMAVLVYVDDIIIASSCDKATELLKAALHASFKLRDLGTLRYFLGLEIARSSAGISVCQRKYILDLLTDTGLLGCKPSSIPMDPSVKLSTEDGD-----------LLPNAEMYRRLIGKLLYLTFTRPDITFAVHKLCQFTSSPRAPHLQAAYKVLHYLKGTVGLGLFYSANSDMKLSAFADADWGSCPDTRQSVSGLCVFVGPSLIAWKSNKQDTVSSSSAESEYRAMSEAVKEMIW 1133          

HSP 3 Score: 113.235 bits (282), Expect = 3.615e-155
Identity = 55/136 (40.44%), Postives = 83/136 (61.03%), Query Frame = 3
Query:  351 NTSLWYARLGHVPSSKLHHVPFLQSFSFDDN--LIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKF 752
            + S+W+ R GH    ++  +  +  FS   N  L+H C VC  A+Q +  +       + PF+L+H+D+WGP+   T  G++YFLTIVDDH+R+TWVYLLK KS+ L    +FI +V+ Q+ A IK  R+DN  + 
Sbjct:  338 DASVWHQRFGHSSFERIERLSDVLGFSKTKNKGLMH-CDVCHRAKQKKLSYHLHPKLCSMPFELLHIDVWGPFSEPTQEGYKYFLTIVDDHTRVTWVYLLKLKSDVLTIFPEFIRMVETQYDAHIKSVRADNAPEL 472          

HSP 4 Score: 28.1054 bits (61), Expect = 3.615e-155
Identity = 11/22 (50.00%), Postives = 15/22 (68.18%), Query Frame = 1
Query: 1942 DLCEEVYMELPTGFCSQEGTLF 2007
            DL EE+YM LP G+  ++G  F
Sbjct:  833 DLDEEIYMSLPPGYSPRQGESF 854          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: A5B7R0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_010420 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 9.598e-155
Identity = 136/288 (47.22%), Postives = 185/288 (64.24%), Query Frame = 3
Query: 1998 NTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            N VC   KSLYGLKQASRQW  K + A++   F QS  D+SLF K   G  +  L+YVDD++I  N++  I +LK  LN+ FK+KDLG++KYFLGLEI +   GI ++QRKY L+L++D G  G K+A+TP+E N KL+    D+G+         L D ++Y+RL                     SQF+  PK+ HL+ A R++RY+K +PG G+   S+S  +L+ + DSD A CP SR+SVTGFC+ LGNSL SWK KKQ+ V+RSSAE +YR+MA T+ EI W
Sbjct:  936 NXVCLLHKSLYGLKQASRQWFSKFSTAIMGLGFSQSPSDHSLFIKNVDGLFIAXLVYVDDVIIASNNQGAIADLKSELNKLFKLKDLGDVKYFLGLEIAKSSTGICVSQRKYVLDLLSDFGYLGCKAASTPMEANVKLSM---DEGVD--------LPDVSLYRRL---------------------SQFISRPKLPHLHAAQRILRYLKGNPGMGLFFPSNSELRLMAYTDSDWARCPDSRRSVTGFCVFLGNSLVSWKSKKQHIVSRSSAEAEYRAMANTSCEITW 1191          

HSP 2 Score: 228.024 bits (580), Expect = 9.598e-155
Identity = 155/401 (38.65%), Postives = 221/401 (55.11%), Query Frame = 2
Query:  767 SSLFTDLGIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCY-ATQTPYKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPFHFAPIDSSVFFPPQLQILDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGCSSFP---HDPLCCFSRIFKPPNWLHDX--XXXXXXXXXXXXXXNH-----IFYSHLPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            S+ +  LG+IH   CV TPQQN V ERKH+H+L VA+AL F S + + +W +C+ TA YLIN  PS  L+NK PFEIL++  P+ SHL+VFGCLCY +T    + KFSP+   +VF+GY    KGY L ++ET      R +    +  P     I S +F    L  + +D                               N  +S+ +P   S P     P    +R+ K P++L D+        +  +   ++H     + Y  L    +LF  S S + EP S+++A + P    AM+ E+  LE N T ++V LP+ K  + CK+  K K+K    +ER+KARLVAKGY+Q+EG+ YVDTFSPVAKLVTV+++LA+A +  W L Q+DV NAFL
Sbjct:  547 SNFYHSLGVIHYRSCVETPQQNSVVERKHQHILNVARALLFXSSLPVCYWSDCILTAVYLINRTPSPFLNNKTPFEILHDKLPDYSHLRVFGCLCYVSTLKANRTKFSPRAKAAVFLGYPFGFKGYKLLDIET------RSISISRNTNPCSSPDISSDLFHDRVLPCIAAD-------------------------------NDQSSSVLPRVVSQPPLQVAPSSRPTRVSKQPSYLKDYHCSLINSVAHVETHSTSHPIQHFLSYDKLSPSYKLFSLSVSIISEPSSFAKAAEIPEWRAAMDCELEALEENKTXSIVSLPVGKHPVGCKWVYKXKHKXDGTIERYKARLVAKGYTQREGIDYVDTFSPVAKLVTVKLLLAIAAVKGWHLSQLDVNNAFL 910          

HSP 3 Score: 128.257 bits (321), Expect = 9.598e-155
Identity = 64/138 (46.38%), Postives = 88/138 (63.77%), Query Frame = 3
Query:  348 NNTSLWYARLGHVPSSKLHHVPFLQSF--SFDDNLIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKFF 755
            N  SLW++RLGH   S+L  +  +  F  SFD   +  C VCPLA+Q   P+ +   R +  FDL+HLDIWGP+ + +  G+++FLTIVDD+SR+TWVY+LK+KSE   Y+  F   VK QF   +K  RSDN  + F
Sbjct:  411 NILSLWHSRLGHPSFSRLKGLQSVLDFDSSFD---LTPCNVCPLAKQRCLPYISLNKRCSSTFDLLHLDIWGPFSVGSVEGYKFFLTIVDDYSRVTWVYMLKNKSEVQKYIPDFFAFVKKQFGKEVKAIRSDNAPELF 545          

HSP 4 Score: 26.5646 bits (57), Expect = 9.598e-155
Identity = 10/14 (71.43%), Postives = 12/14 (85.71%), Query Frame = 1
Query: 1942 DLCEEVYMELPTGF 1983
            DL EEVYM+LP G+
Sbjct:  913 DLNEEVYMKLPPGY 926          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: Q9FJV3_ARATH (Retroelement pol polyprotein-like OS=Arabidopsis thaliana PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.523e-153
Identity = 150/393 (38.17%), Postives = 218/393 (55.47%), Query Frame = 2
Query:  770 SLFTDLGIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYATQTP-YKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPFHFAPIDSSVFFPPQLQILDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGCSSFPHDPLCCFSRIFKPPNWLHD---XXXXXXXXXXXXXXXNHIFYSHLPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            +L+   GII    C  TPQQN V ERKH+H+L VA+AL F++ + L+FWG+C+ +A +LIN LP+ +L NK PFE+L+   P+ + LKVFGCLCY + +P  + KF+P+    VF+GY S  KGY L +LET +  ++R V F+E+VFPF     D ++       ++D    +I                                      S+    P     R  +PP +L D        V    ++ ++ +I Y+ L      ++ + +   EP +Y++A +    + AME EI  LES NTW+V  LP  K  I CK+  K+K  A   +ERFKARLVAKGY+Q+EG+ Y DTFSPVAK+ TV+ +L++A I  W L Q+D+ NAFL
Sbjct:  720 ALYQAKGIISYHSCPETPQQNSVVERKHQHILNVARALMFEANMPLEFWGDCILSAVFLINRLPTPLLSNKSPFELLHLKVPDYTSLKVFGCLCYESTSPQQRHKFAPRARACVFLGYPSGYKGYKLLDLETNTIHISRHVVFYETVFPF----TDKTIIPRDVFDLVDPVHENIENPP----------------------------------STSESAPKVSSKRESRPPGYLQDYFCNAVPDVTKDVRYPLNAYINYTQLSEEFTAYICAVNKYPEPCTYAQAKKIKEWLDAMEIEIDALESTNTWSVCSLPQGKKPIGCKWVFKVKLNADGSLERFKARLVAKGYTQREGLDYYDTFSPVAKMTTVKTLLSVAAIKEWSLHQLDISNAFL 1074          

HSP 2 Score: 236.884 bits (603), Expect = 1.523e-153
Identity = 139/288 (48.26%), Postives = 194/288 (67.36%), Query Frame = 3
Query: 1998 NTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            N V + QKSLYGLKQASRQW LK +  L    F++S  D++LFT+  G   + LL+YVDD+VI GN++  I+ELK  L + FK++DLG +KYFLGLEI R K+GI + QRKY +EL+ D+G+ G + +T P+E + KL+          +  ++ ++ +  VY+RL+G+L+YLT TRPDITYA++ L QF   PK SHL  A +VV Y+K + G G+  SS S   L  + D+D  SC  SR+S +G C+ LG+SL SWK KKQN  + SSAE++YR+MA  + EI W
Sbjct: 1101 NPVLKLQKSLYGLKQASRQWYLKFSSTLKKLGFKKSHADHTLFTRISGKAYIALLVYVDDIVIAGNNDENIEELKKDLAKAFKLRDLGPMKYFLGLEIARTKEGISVCQRKYTMELLEDTGLLGCRPSTIPMEPSLKLS----------QHNDEHVIDNPEVYRRLVGKLMYLTITRPDITYAINRLCQFSSSPKNSHLKAAQKVVHYLKGTIGLGLFYSSKSDLCLKAYTDADWGSCVDSRRSTSGICMFLGDSLISWKSKKQNMASSSSAESEYRAMAMGSREIAW 1378          

HSP 3 Score: 114.005 bits (284), Expect = 1.523e-153
Identity = 56/137 (40.88%), Postives = 83/137 (60.58%), Query Frame = 3
Query:  351 NTSLWYARLGHVPSSK---LHHVPFLQSFSFDDNLIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKF 752
            +++LW++RLGH    K   LH V  L   + +D L+H C++C  A+Q    F +    S   FDL+H+D WGP+   T  G++YFLTIVDD+SR TWVYL+K K++ L     F+ +V+ Q+   +K  RSDN  + 
Sbjct:  582 DSALWHSRLGHPSYEKNDVLHDVLGLPKRNKED-LVH-CSICQKAKQKHLSFPSKNNMSENKFDLIHIDTWGPFATPTTEGYKYFLTIVDDYSRATWVYLMKAKNDVLQIFPDFLKMVETQYGTLVKAVRSDNAPEL 716          

HSP 4 Score: 27.335 bits (59), Expect = 1.523e-153
Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 1
Query: 1942 DLCEEVYMELPTGFCSQEG 1998
            DL EE+YM LP G+  ++G
Sbjct: 1077 DLKEEIYMTLPPGYSMKQG 1095          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: Q9XII7_ARATH (Putative retroelement pol polyprotein OS=Arabidopsis thaliana GN=At2g16000 PE=4 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 6.648e-153
Identity = 151/397 (38.04%), Postives = 226/397 (56.93%), Query Frame = 2
Query:  767 SSLFTDLGIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYATQTP-YKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPFHFAPIDSSV--FFPPQLQI---LDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPG-CSSFPHDPLCCFSRIFKPPNWLHDXXXXXXXXXXXXXXXNHIFYSHLPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            +S + + GI+    C  TP+QN V ERKH+H+L VA+AL FQS+V L  WG+CV TA +LIN  PS +L NK P+EIL    P    L+ FGCLCY++ +P  + KF P+    +F+GY S  KGY L +LE+ + F++R+V+FHE VFP    P   S    F P + +   + SD  H                               + +S+P   S  P  P     R+ KPP  L+D+  +T+ S  ++ IS+ I YS +   +  ++++ + +  P +Y+EA       +A++ EI  +E  NTW +  LP  K ++ CK+   +K+ A   +ER+KARLVAKGY+QKEG+ Y DTFSPVAK+ T++++L ++   +W L Q+DV NAFL
Sbjct:  691 TSFYAEKGIVSFHSCPETPEQNSVVERKHQHILNVARALMFQSQVPLSLWGDCVLTAVFLINRTPSQLLMNKTPYEILTGTAPVYEQLRTFGCLCYSSTSPKQRHKFQPRSRACLFLGYPSGYKGYKLMDLESNTVFISRNVQFHEEVFPLAKNPGSESSLKLFTPMVPVSSGIISDTTH-------------------------------SPSSLPSQISDLP--PQISSQRVRKPPAHLNDYHCNTMQSDHKYPISSTISYSKISPSHMCYINNITKIPIPTNYAEAQDTKEWCEAVDAEIGAMEKTNTWEITTLPKGKKAVGCKWVFTLKFLADGNLERYKARLVAKGYTQKEGLDYTDTFSPVAKMTTIKLLLKVSASKKWFLKQLDVSNAFL 1054          

HSP 2 Score: 234.958 bits (598), Expect = 6.648e-153
Identity = 133/289 (46.02%), Postives = 190/289 (65.74%), Query Frame = 3
Query: 1995 GNTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
             N V R ++S+YGLKQASRQW  K + +L+S  F+++  D++LF K   G  V++L+YVDD+VI    E    +L   L+Q FK++DLG+LKYFLGLE+ R   GI + QRKYALEL+  +G+   K  + P+  N K+            + +  L++D   Y+R++G+L+YLT TRPDIT+AV+ L QF   P+ +HL  A RV++YIK + GQG+  S+SS   L  F DSD ASC  SR+S T F + +G+SL SW+ KKQ+TV+RSSAE +YR++A    E+VW
Sbjct: 1080 SNVVLRLKRSIYGLKQASRQWFKKFSSSLLSLGFKKTHGDHTLFLKMYDGEFVIVLVYVDDIVIASTSEAAAAQLTEELDQRFKLRDLGDLKYFLGLEVARTTAGISICQRKYALELLQSTGMLACKPVSVPMIPNLKM-----------RKDDGDLIEDIEQYRRIVGKLMYLTITRPDITFAVNKLCQFSSAPRTTHLTAAYRVLQYIKGTVGQGLFYSASSDLTLKGFADSDWASCQDSRRSTTSFTMFVGDSLISWRSKKQHTVSRSSAEAEYRALALATCEMVW 1357          

HSP 3 Score: 115.161 bits (287), Expect = 6.648e-153
Identity = 59/142 (41.55%), Postives = 84/142 (59.15%), Query Frame = 3
Query:  330 MHSVLDNNTSLWYARLGHVPSSKLHHV-PFLQSFSFDDNLIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKF 752
            +++V+D   S+W+ RLGH    +L  +   L +    +     C VC LA+Q +  F  S     + FDL+H+D+WGP+ + T  G++YFLTIVDDHSR TW+YLLK KSE L     FI  V+NQ+   +K  RSDN  + 
Sbjct:  549 VNAVVD--ISMWHRRLGHASLQRLDAISDSLGTTRHKNKGSDFCHVCHLAKQRKLSFPTSNKVCKEIFDLLHIDVWGPFSVETVEGYKYFLTIVDDHSRATWMYLLKTKSEVLTVFPAFIQQVENQYKVKVKAVRSDNAPEL 688          

HSP 4 Score: 24.2534 bits (51), Expect = 6.648e-153
Identity = 7/22 (31.82%), Postives = 16/22 (72.73%), Query Frame = 1
Query: 1942 DLCEEVYMELPTGFCSQEGTLF 2007
            +L EE++M++P G+  ++G + 
Sbjct: 1057 ELEEEIFMKIPEGYAERKGIVL 1078          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: O04543_ARATH (F20P5.25 protein OS=Arabidopsis thaliana GN=F20P5.25 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 8.610e-152
Identity = 157/402 (39.05%), Postives = 220/402 (54.73%), Query Frame = 2
Query:  755 QFNCSSLFTDLGIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYATQTPY-KDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPFHFAPI--DSSVFFP-----PQLQILDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGCSSFPHDPLCCFSRIFKPPNWLHDXXXXXXXXXXXXXXXNHIFYSHLPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            + N +  +   GI+    C  TPQQN V ERKH+H+L VA++L FQS + + +WG+C+ TA YLIN LP+ +L +K PFE+L    P   H+KVFGCLCYA+ +P  + KFSP+     F+GY S  KGY L +LET S  V+R V FHE +FPF  + +  +   FFP     P +Q   SD ++                       S S S+     S    ++ P   +    R  K P +L D+   +V SS+   I   + Y  +      FL+      EP +Y+EA +      AM  E   LE  +TW V  LP  K  I C++  KIKY +   VER+KARLVA+GY+QKEG+ Y +TFSPVAKL +V+++L +A  F+  L Q+D+ NAFL
Sbjct:  536 ELNFTQFYHSKGIVPYHSCPETPQQNSVVERKHQHILNVARSLFFQSHIPISYWGDCILTAVYLINRLPAPILEDKCPFEVLTKTVPTYDHIKVFGCLCYASTSPKDRHKFSPRAKACAFIGYPSGFKGYKLLDLETHSIIVSRHVVFHEELFPFLGSDLSQEEQNFFPDLNPTPPMQRQSSDHVN----------------------PSDSSSSVEILPSANPTNNVPEPSVQTSHRKAKKPAYLQDYYCHSVVSSTPHEIRKFLSYDRINDPYLTFLACLDKTKEPSNYTEAEKLQVWRDAMGAEFDFLEGTHTWEVCSLPADKRCIGCRWIFKIKYNSDGSVERYKARLVAQGYTQKEGIDYNETFSPVAKLNSVKLLLGVAARFKLSLTQLDISNAFL 915          

HSP 2 Score: 228.024 bits (580), Expect = 8.610e-152
Identity = 127/288 (44.10%), Postives = 188/288 (65.28%), Query Frame = 3
Query: 1998 NTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            N VCR +KSLYGLKQASRQW LK +  L+   F QS  D++ F K   G  + +L+Y+DD++I  N++  +  LK  +   FK++DLGELKYFLGLEI+R   GI ++QRKYAL+L+ ++G  G K ++ P++ +       +D G    E           Y+RLIGRL+YL  TRPDIT+AV+ L+QF   P+ +HL    ++++YIK + GQG+  S++S  QL  + ++D  SC  SR+S +G+C+ LG+SL  WK +KQ+ V++SSAE +YRS++    E+VW
Sbjct:  942 NAVCRLKKSLYGLKQASRQWYLKFSSTLLGLGFIQSYCDHTCFLKISDGIFLCVLVYIDDIIIASNNDAAVDILKSQMKSFFKLRDLGELKYFLGLEIVRSDKGIHISQRKYALDLLDETGQLGCKPSSIPMDPSM---VFAHDSGGDFVEVGP--------YRRLIGRLMYLNITRPDITFAVNKLAQFSMAPRKAHLQAVYKILQYIKGTIGQGLFYSATSELQLKVYANADYNSCRDSRRSTSGYCMFLGDSLICWKSRKQDVVSKSSAEAEYRSLSVATDELVW 1218          

HSP 3 Score: 132.109 bits (331), Expect = 8.610e-152
Identity = 62/132 (46.97%), Postives = 86/132 (65.15%), Query Frame = 3
Query:  360 LWYARLGHVPSSKLHHVPFLQSFSFD-DNLIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKF 752
            LW+ RLGH    KL  +  L SF    +N    C VC +++Q   PF +   +S++PFDL+H+D WGP+ + TH G+RYFLTIVDD+SR TWVYLL++KS+ L  +  F+ +V+NQF   IK  RSDN  + 
Sbjct:  406 LWHKRLGHPSVQKLQPMSSLLSFPKQKNNTDFHCRVCHISKQKHLPFVSHNNKSSRPFDLIHIDTWGPFSVQTHDGYRYFLTIVDDYSRATWVYLLRNKSDVLTVIPTFVTMVENQFETTIKGVRSDNAPEL 537          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: A0A0B2NXW1_GLYSO (Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) OS=Glycine soja GN=glysoja_034513 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 1.708e-151
Identity = 146/286 (51.05%), Postives = 195/286 (68.18%), Query Frame = 3
Query: 2004 VCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            VCR Q+SLY LKQASRQW  KL+  L+S  F++S  D+SLF +  G  +  LL+YVDD+++TGN E  I+++  +L+Q FK+KDLG LKYFLG+EI R   GI L QRKY L++++DSG+ G +   TP++ +TKL A     G     +  S       Y+RLIGRL+YLT+TRPDITYAV  LSQ+M +P   H   A R++RY+K + G GI LS++ + QL  F DSD A C  SRKS TGF I LG+S  SW+ KKQ+TV+RSS+E +YR+MA T  E+ W
Sbjct:  946 VCRLQRSLYELKQASRQWFTKLSGLLISLGFEKSHSDHSLFLRFTGSIITALLVYVDDIILTGNSESEIQDVIKLLDQAFKIKDLGNLKYFLGMEIARSSSGIHLCQRKYTLDILSDSGMLGCQPNVTPMDYSTKLQATA---GTPLSTEASS------SYRRLIGRLIYLTNTRPDITYAVQQLSQYMSNPTSVHQQAAYRILRYLKGTSGSGIFLSATGTPQLRAFSDSDWAGCQDSRKSTTGFVIYLGSSPVSWQSKKQSTVSRSSSEAEYRAMATTTCELQW 1222          

HSP 2 Score: 227.254 bits (578), Expect = 1.708e-151
Identity = 155/425 (36.47%), Postives = 224/425 (52.71%), Query Frame = 2
Query:  755 QFNCSSLFTDLGIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYA-TQTPYKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHE-----------------SVFP--FHFAPIDSSVFFPPQ-----------LQILDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGCSSFPHDPLCCFSRIFKPPNWLHDXXXXXXXXXXXXXXXNHIFYSHLPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            +F   S +   GI+HQ+ CV TP+QNG+ ERKH+HLL V +AL FQ+ +   FW   +  A YL+N +P+  LHN  P+E L+   P +SHL+VFGCLCYA T    + K  P+  P +F+G+ ++ KGY+++NL   S   +R+V F+E                 ++ P  F+ +P D  +  PPQ           LQ+  +D    S  +      ++   +  +       S  S  T V   S +P   +  +SR+                             SH   H  + +SST   VEP SY+EA Q    IKAME E+  L+SNNTW +  LP  K++I C++  KIK++A   +ER+KARLVAKGY+Q EG+ Y+  FSPVAKL  VR++LA+    +W L Q+DV NAFL
Sbjct:  530 EFLMPSFYASKGIMHQTTCVETPEQNGIAERKHQHLLNVTRALLFQANLPSNFWCYALLHATYLVNCIPTPFLHNVSPYEKLHGHLPEISHLRVFGCLCYASTLKANRKKLDPRAHPCIFIGFKASTKGYLVYNLHLHSIITSRNVVFYEDHFSQIPETQSSHPESSTILPKSFNISPHDPIIEKPPQPVIQETTDHTPLQLTSTDESAFSQRTKHEPRRSTRPKHAPTYLQDYHHSLSSHDTKVSTSSRYPLSSVLSYSRL-----------------------------SHTHKHFVMSISST---VEPSSYAEASQYDCWIKAMEAELQALQSNNTWKLTLLPPHKTAIGCRWVYKIKHRADGSIERYKARLVAKGYTQMEGLDYLYAFSPVAKLTIVRLLLAMVAFNQWHLRQLDVNNAFL 922          

HSP 3 Score: 107.071 bits (266), Expect = 1.708e-151
Identity = 56/136 (41.18%), Postives = 82/136 (60.29%), Query Frame = 3
Query:  360 LWYARLGHVPSSKLH----HVPFLQSFSFDDNLIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKFF 755
            LW+ R+GH+ + +L     H P L++   D   +  C  C  A+  + PFS+S + ++  F L+H+DIWGP    +  GH+YFLTIVDDHSR TWV+L+  K+E    +  FI  V+ Q++  IK  RSDNG +F 
Sbjct:  402 LWHFRMGHLSTERLQCMKPHYPILRN---DKTFV--CNTCHYAKHKKLPFSSSTSHASHIFYLLHVDIWGPCSKPSMHGHKYFLTIVDDHSRFTWVHLMHTKAETRDIIVNFIASVETQYNKKIKKIRSDNGYEFL 532          

HSP 4 Score: 22.3274 bits (46), Expect = 1.708e-151
Identity = 8/14 (57.14%), Postives = 11/14 (78.57%), Query Frame = 1
Query: 1942 DLCEEVYMELPTGF 1983
            +L EEVYM++P G 
Sbjct:  925 ELDEEVYMQVPPGL 938          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: Q9FX79_ARATH (Putative retroelement polyprotein OS=Arabidopsis thaliana GN=F19K19.5 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 5.084e-150
Identity = 157/392 (40.05%), Postives = 227/392 (57.91%), Query Frame = 2
Query:  773 LFTDLGIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYATQTP-YKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPFHFAPID---SSVFFPPQLQILDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGCSSFPHDPLCCFSRIFKPPNWLHDXXXXXXXXXXXXXXXNHIFYSHLPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            L+   GI+    C  TP+QN V ERKH+H+L VA+AL FQS++ L +WG+C+ TA ++IN  PS V+ NK  FE+L    P+ +HLK FGCLCYA+ +P  + KF  +     F+GY S  KGY L +LE+ + F++R+V F+E +FPF   P +   SSVFF P + +  +D                            S  +          S+ P +     SR+ +PP +L D+  ++V SS+   IS  + YS L     +F+++ + + EP +Y++A Q      AM  EI+ LE N TW V  LP+ K ++ CK+  KIK  A   +ER+KARLVAKGY+Q EG+ YVDTFSPVAKL TV++++A+A    W L Q+D+ NAFL
Sbjct:  669 LYRRKGIVAYHSCPETPEQNSVVERKHQHILNVARALLFQSQIPLSYWGDCILTAVFIINRTPSPVISNKTLFEMLTKKVPDYTHLKSFGCLCYASTSPKQRHKFEDRARTCAFLGYPSGYKGYKLLDLESHTIFISRNVVFYEDLFPFKTKPAENEESSVFF-PHIYVDRND----------------------------SHPSQPLPVQETSASNVPAEKQN--SRVSRPPAYLKDYHCNSVTSSTDHPISEVLSYSSLSDPYMIFINAVNKIPEPHTYAQARQIKEWCDAMGMEITALEDNGTWVVCSLPVGKKAVGCKWVYKIKLNADGSLERYKARLVAKGYTQTEGLDYVDTFSPVAKLTTVKLLIAVAAAKGWSLSQLDISNAFL 1029          

HSP 2 Score: 230.72 bits (587), Expect = 5.084e-150
Identity = 133/288 (46.18%), Postives = 195/288 (67.71%), Query Frame = 3
Query: 1998 NTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSLLQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            N VCR +KSLYGLKQASRQW LK +++L +  F QS  D++LFT++   + + +L+YVDD++I  + +   + L+  L ++ K++DLG L+YFLGLEI R  DGI + QRKY LEL+A++G+ G KS++ P+E N KL+         QE+ E  L+ D   Y++L+G+L+YLT TRPDITYAVH L QF   P+V HL    +++ Y+K + GQG+  S++   +L  F DSD +SC  SRK  TG+C+ LG SL +WK KKQ  ++ SSAE +Y++M+    E++W
Sbjct: 1056 NAVCRLKKSLYGLKQASRQWYLKFSESLKALGFTQSSGDHTLFTRKSKNSYMAVLVYVDDIIIASSCDRETELLRDALQRSSKLRDLGTLRYFLGLEIARNTDGISICQRKYTLELLAETGLLGCKSSSVPMEPNQKLS---------QEDGE--LIDDAEHYRKLVGKLMYLTFTRPDITYAVHRLCQFTSAPRVPHLKAVYKIIYYLKGTVGQGLFYSANVDLKLSGFADSDFSSCSDSRKLTTGYCMFLGTSLVAWKSKKQEVISMSSAEAEYKAMSMAVREMMW 1332          

HSP 3 Score: 103.219 bits (256), Expect = 5.084e-150
Identity = 45/103 (43.69%), Postives = 66/103 (64.08%), Query Frame = 3
Query:  444 LIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNGSKF 752
            L+H C +C  A+Q +  + +       PFDL+H+D+WGP+   T  G+ YFLTIVDDH+R+TWVYL+K+KS+ L     FI +V+ Q+   +K  RSDN  + 
Sbjct:  563 LLH-CDICQRAKQKKLTYPSRHNICLAPFDLLHIDVWGPFSEPTQEGYHYFLTIVDDHTRVTWVYLMKYKSDVLTIFPDFITMVETQYDTKVKAVRSDNAPEL 664          

HSP 4 Score: 26.1794 bits (56), Expect = 5.084e-150
Identity = 10/21 (47.62%), Postives = 14/21 (66.67%), Query Frame = 1
Query: 1945 LCEEVYMELPTGFCSQEGTLF 2007
            L EE+YM LP G+  ++G  F
Sbjct: 1033 LDEEIYMTLPPGYSPRQGDSF 1053          
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Match: O23588_ARATH (Retrotransposon like protein OS=Arabidopsis thaliana GN=dl4760c PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 9.823e-137
Identity = 161/394 (40.86%), Postives = 219/394 (55.58%), Query Frame = 2
Query:  776 FTDL----GIIHQSLCVHTPQQNGVTERKHRHLLEVAKALKFQSKVLLKFWGECVKTACYLIN*LPSSVLHNKFPFEILYNIQPNLSHLKVFGCLCYATQTP-YKDKFSPKVIPSVFMGYSSTQKGYILFNLETKSFFVNRDVKFHESVFPFHFAPIDSSV--FFPPQLQILDSDFLHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGCSSFPHDPLCCFSRIFKPPNWLHDXXXXXXXXXXXXXXXNHIFYSHLPTHNQLFLSSTSSLVEPKSYSEAVQNPA*IKAMEEEISTLESNNTWTVVPLPLXXXXXXXXXXXXXXYKASSEVERFKARLVAKGYSQKEGMGYVDTFSPVAKLVTVRVVLALAFIFRWPLFQMDVFNAFL 1936
            FTDL    GI+    C  TP+QN V ERKH+H+L VA+AL FQS + L+FWG+CV TA +LIN LP+ VL+NK P+E L NI P    LK FGCLCY++ +P  + KF P+    VF+GY    KGY L ++ET +  ++R V FHE +FPF  + I   +  FFP       +D L +  +S     P    S+  +                      P DPL    R  KPP  L DF                  Y++       F+++ ++ V P+ YSEA    A   AM+EEI  +   NTW+VV LP  K +I CK+   IK+ A   +ER+KARLVAKGY+Q+EG+ Y +TFSPVAKL +VR++L LA   +W + Q+D+ NAFL
Sbjct:  676 FTDLFAAHGIVAYHSCPETPEQNSVVERKHQHILNVARALLFQSNIPLEFWGDCVLTAVFLINRLPTPVLNNKSPYEKLKNIPPAYESLKTFGCLCYSSTSPKQRHKFEPRARACVFLGYPLGYKGYKLLDIETHAVSISRHVIFHEDIFPFISSTIKDDIKDFFPLLQFPARTDDLPLEQTSIIDTHPHQDVSSSKAL--------------------VPFDPLS--KRQKKPPKHLQDFHC----------------YNNTTEPFHAFINNITNAVIPQRYSEAKDFKAWCDAMKEEIGAMVRTNTWSVVSLPPNKKAIGCKWVFTIKHNADGSIERYKARLVAKGYTQEEGLDYEETFSPVAKLTSVRMMLLLAAKMKWSVHQLDISNAFL 1031          

HSP 2 Score: 224.557 bits (571), Expect = 9.823e-137
Identity = 124/289 (42.91%), Postives = 182/289 (62.98%), Query Frame = 3
Query: 1998 NTVCRFQKSLYGLKQASRQWNLKLTQALVSARFQQSKYDYSLFTKQQGGNXXXXXXXXXXXXXTGNDEVLIKELKGILNQNFKMKDLGELKYFLGLEILRFKDGIFLNQRKYALELIADSGIGGAKSATTPLEQNTKLTAIEYDQGIGQEEKEDSL-LQDKTVYQRLIGRLLYLTHTRPDITYAVHCLSQFMQHPKVSHLNTALRVVRYIKNSPGQGIXXXXXXXCQLITFCDSDCASCPMSRKSVTGFCIKLGNSLTSWKVKKQNTVARSSAETKYRSMAATASEIVW 2861
            + +CR  KS+YGLKQASRQW LKL+  L    FQ+S  D++LF K   G ++ +L+YVDD++I  N +  + +    L   FK++DLG  KYFLG+EI R + GI + QRKY LEL++ +G  G+K ++ PL+ + KL             KED + L D T Y++L+G+L+YL  TRPDI YAV+ L QF   P   HL+   +V+RY+K + GQG+  S+     L  + DSD  SC  SR+ V  +C+ +G+ L SWK KKQ+TV+ S+AE ++R+M+    E++W
Sbjct: 1058 HAICRLHKSIYGLKQASRQWYLKLSNTLKGMGFQKSNADHTLFIKYANGVLMGVLVYVDDIMIVSNSDDAVAQFTAELKSYFKLRDLGAAKYFLGIEIARSEKGISICQRKYILELLSTTGFLGSKPSSIPLDPSVKLN------------KEDGVPLTDSTSYRKLVGKLMYLQITRPDIAYAVNTLCQFSHAPTSVHLSAVHKVLRYLKGTVGQGLFYSADDKFDLRGYTDSDFGSCTDSRRCVAAYCMFIGDYLVSWKSKKQDTVSMSTAEAEFRAMSQGTKEMIW 1334          

HSP 3 Score: 72.7886 bits (177), Expect = 9.823e-137
Identity = 45/133 (33.83%), Postives = 64/133 (48.12%), Query Frame = 3
Query:  363 WYARLGHVPSSK---LHHVPFLQSFSFDDN---LIHSCAVCPLARQTRQPFSNSVTRSAKPFDLVHLDIWGPYRISTHSGHRYFLTIVDDHSRMTWVYLLKHKSEALLYLKQFIHLVKNQFSAFIKYFRSDNG 743
            W+ RLGH   SK   L  V  L+    +     + H C VC L++Q    F +     +  FDLVH+D WGP+ + T+                TW+YLLK+KS+ L     FI++V  Q+   +K  RSDN 
Sbjct:  553 WHKRLGHPAYSKIDLLSDVLNLKVKKINKEHSPVCHVCHVCHLSKQKHLSFQSRQNMCSAAFDLVHIDTWGPFSVPTNDA--------------TWIYLLKNKSDVLHVFPAFINMVHTQYQTKLKSVRSDNA 671          

HSP 4 Score: 24.6386 bits (52), Expect = 9.823e-137
Identity = 9/19 (47.37%), Postives = 13/19 (68.42%), Query Frame = 1
Query: 1942 DLCEEVYMELPTGFCSQEG 1998
            DL EE+YM++P G+    G
Sbjct: 1034 DLDEEIYMKIPPGYADLVG 1052          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 6
Match NameE-valueIdentityDescription
POLX_TOBAC9.325e-4933.90Retrovirus-related Pol polyprotein from transposon... [more]
M810_ARATH1.245e-4438.33Uncharacterized mitochondrial protein AtMg00810 OS... [more]
COPIA_DROME1.706e-4230.07Copia protein OS=Drosophila melanogaster GN=GIP PE... [more]
YCH4_YEAST5.184e-2329.05Putative transposon Ty5-1 protein YCL074W OS=Sacch... [more]
M240_ARATH2.885e-1649.37Uncharacterized mitochondrial protein AtMg00240 OS... [more]
M820_ARATH2.323e-1540.95Uncharacterized mitochondrial protein AtMg00820 OS... [more]
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092022 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
Q0PY40_SOLLC0.000e+043.55Putative polyprotein OS=Solanum lycopersicum PE=4 ... [more]
M1ANG9_SOLTU6.877e-16041.63Uncharacterized protein OS=Solanum tuberosum GN=PG... [more]
M4CW55_BRARP3.615e-15541.43Uncharacterized protein OS=Brassica rapa subsp. pe... [more]
A5B7R0_VITVI9.598e-15547.22Putative uncharacterized protein OS=Vitis vinifera... [more]
Q9FJV3_ARATH1.523e-15338.17Retroelement pol polyprotein-like OS=Arabidopsis t... [more]
Q9XII7_ARATH6.648e-15338.04Putative retroelement pol polyprotein OS=Arabidops... [more]
O04543_ARATH8.610e-15239.05F20P5.25 protein OS=Arabidopsis thaliana GN=F20P5.... [more]
A0A0B2NXW1_GLYSO1.708e-15151.05Retrovirus-related Pol polyprotein from transposon... [more]
Q9FX79_ARATH5.084e-15040.05Putative retroelement polyprotein OS=Arabidopsis t... [more]
O23588_ARATH9.823e-13740.86Retrotransposon like protein OS=Arabidopsis thalia... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025724GAG-pre-integrase domainPFAMPF13976gag_pre-integrscoord: 24..106
e-value: 3.1E-7
score: 30.0
IPR001584Integrase, catalytic corePFAMPF00665rvecoord: 120..199
e-value: 2.0E-12
score: 47.3
IPR001584Integrase, catalytic corePROSITEPS50994INTEGRASEcoord: 117..260
score: 11.168
IPR012337Ribonuclease H-like domainGENE3D3.30.420.10coord: 117..201
e-value: 2.9E-14
score: 52.7
IPR012337Ribonuclease H-like domainSUPERFAMILY53098Ribonuclease H-likecoord: 117..211
NoneNo IPR availablePANTHERPTHR11439GAG-POL-RELATED RETROTRANSPOSONcoord: 17..28
NoneNo IPR availablePANTHERPTHR11439:SF185SUBFAMILY NOT NAMEDcoord: 17..28
NoneNo IPR availablePANTHERPTHR11439GAG-POL-RELATED RETROTRANSPOSONcoord: 64..200
NoneNo IPR availablePANTHERPTHR11439:SF185SUBFAMILY NOT NAMEDcoord: 64..200
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 218..260
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..195
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 196..217

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092022 ID=g.barbadense_cottongen_reftransV1_0092022|Name=g.barbadense_cottongen_reftransV1_0092022|organism=Gossypium barbadense|type=contig|length=2863bp
GAACAAGGTCTCCTCTGTTGATTCTTCTGCGAATATAGCAGGTATATCCC
ACTGTCTTTCTGTTTCTGAGGATTCTCCTAGTTGGATACTGGATACGGGG
GCCACAGATCACATGATATCTGATTCTCAGAGTTTAATATCTCCAATTTC
TTGTGCTAGTGGTTCTGGCTTTGTTCATCTTCCTAATGGGTCTCTTCGAT
GGAAAGATGAAGGGGATTGGTAAAGAATCTCGCGGGTTATATTTGTTTGA
TTCTTCAAGTCTAGCTTCTAGTTTGTCTTTTCCAGTTTCTTCTGGCTCTC
ATTCGTTTAATATTCATTCTATTGATTGTATGCACTCTGTGCTCGATAAT
AATACGAGTCTTTGGTATGCTCGTTTAGGGCATGTGCCTTCTTCTAAGTT
GCATCATGTTCCTTTTCTACAATCTTTCTCCTTTGATGATAATTTGATTC
ATTCTTGTGCTGTGTGTCCTTTAGCTAGACAAACTCGTCAACCTTTCTCT
AATAGTGTGACTAGGTCTGCTAAGCCTTTTGATCTAGTTCATCTTGATAT
TTGGGGCCCTTATAGAATATCAACTCATAGTGGCCATAGATATTTTCTAA
CTATTGTGGATGATCATTCTAGGATGACCTGGGTATATTTGTTGAAGCAT
AAAAGTGAAGCTCTTCTTTACCTAAAACAATTCATTCACCTAGTTAAAAA
TCAATTTTCTGCTTTTATAAAATACTTCAGAAGTGATAACGGTTCTAAAT
TCTTCAATTCAACTGTTCTTCCCTGTTTACTGATTTGGGGATTATACATC
AAAGCTTATGTGTTCACACCCCTCAGCAAAATGGGGTTACTGAGAGGAAA
CACAGGCATCTCCTTGAGGTTGCTAAAGCACTCAAGTTTCAGTCTAAAGT
ACTGCTTAAATTTTGGGGTGAGTGTGTCAAAACTGCATGTTATTTGATAA
ATTAATTACCTTCTTCTGTTCTTCATAATAAATTTCCTTTTGAGATTCTT
TACAATATACAACCAAATCTCTCTCATCTCAAAGTTTTTGGCTGTCTCTG
TTATGCCACACAAACTCCTTACAAAGACAAATTCTCTCCCAAAGTTATAC
CTTCAGTCTTTATGGGGTATTCATCCACTCAAAAGGGATACATTCTGTTC
AATCTTGAAACAAAATCTTTTTTTGTTAATAGGGATGTGAAGTTTCATGA
ATCTGTTTTCCCTTTTCATTTTGCGCCTATAGACAGTTCTGTGTTTTTTC
CACCACAGTTGCAAATCTTGGATTCTGATTTTTTACACATTTCTCCTTCA
TCTAACTCTCCTTTACCACCTACATCTCCAGCTTCTAATCCAGCCTCTAC
ACCTTCATCCACTTCACCTTCTAATCCTTCTGCTTCAACAAGTGTCCCAG
GTTGTTCTTCTTTTCCACATGATCCTCTTTGCTGTTTCTCTCGAATTTTT
AAGCCACCGAATTGGTTACATGATTTTATCACTTCTACTGTTTTTTCTTC
TAGTCAGTTTTCTATTTCAAATCATATTTTTTATTCCCATTTGCCTACCC
ATAACCAGTTGTTTTTGTCCTCCACTTCTTCTTTGGTTGAACCTAAGTCC
TACTCTGAGGCTGTTCAGAATCCAGCCTAGATCAAAGCCATGGAAGAGGA
GATTTCTACTTTAGAATCAAATAACACCTGGACTGTGGTTCCTCTGCCTC
TGAAAAAGTCCTCAATTAGTTGTAAATTTTTTTGTAAGATCAAGTACAAG
GCGTCTAGTGAGGTGGAAAGGTTTAAGGCTCGCCTTGTGGCCAAAGGTTA
TAGTCAGAAGGAAGGTATGGGCTATGTGGACACTTTCTCTCCTGTTGCTA
AACTGGTAACTGTGAGAGTTGTTTTGGCGTTAGCCTTTATTTTTCGCTGG
CCCTTATTTCAGATGGATGTGTTCAATGCCTTCCTCCAAGTGATTTGTGT
GAGGAGGTTTATATGGAGTTGCCTACTGGTTTTTGCAGTCAAGAGGGAAC
ACTGTTTGTAGATTTCAAAAGTCTCTTTATGGGTTGAAGCAGGCGTCCAG
GCAATGGAATCTGAAGTTGACACAAGCATTGGTTTCTGCTAGATTTCAGC
AAAGTAAGTATGATTACTCTTTGTTTACAAAACAACAAGGAGGTAATGTA
GTTTTGTTACTCATTTATGTTGATGATTTGGTCATAACTGGAAATGATGA
GGTTTTGATCAAAGAGTTAAAAGGGATCCTAAATCAGAATTTTAAAATGA
AAGATTTAGGTGAGTTGAAATATTTCTTAGGATTGGAAATTCTGAGATTT
AAGGATGGAATATTTCTGAATCAGAGAAAATATGCCTTAGAATTAATTGC
AGACAGTGGGATAGGGGGAGCTAAGTCTGCCACAACCCCTCTTGAGCAAA
ATACAAAACTTACAGCAATCGAGTATGATCAAGGAATAGGACAAGAAGAG
AAAGAAGATTCATTATTGCAAGACAAGACTGTTTACCAGAGGCTAATAGG
AAGATTGCTATATTTAACACACACAAGGCCGGATATAACATATGCTGTTC
ATTGCTTGAGTCAATTCATGCAACATCCTAAGGTCTCACATCTGAATACT
GCACTAAGGGTGGTCAGATATATTAAAAACAGTCCTGGGCAGGGAATTTT
ATTAAGTTCTTCAAGCTCTTGTCAACTTATTACTTTTTGTGACTCGGATT
GCGCCTCATGTCCTATGTCCCGAAAGTCGGTCACAGGTTTTTGCATAAAG
CTGGGAAATTCCTTGACTTCTTGGAAAGTAAAGAAACAAAATACAGTCGC
AAGATCATCTGCAGAAACAAAATATAGAAGTATGGCAGCTACAGCTTCAG
AAATTGTTTGGCT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR025724GAG-pre-integrase_dom
IPR001584Integrase_cat-core
IPR012337RNaseH-like_sf
Vocabulary: Biological Process
TermDefinition
GO:0015074DNA integration
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding