g.barbadense_cottongen_reftransV1_0092017, g.barbadense_cottongen_reftransV1_0092017 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092017
Unique Nameg.barbadense_cottongen_reftransV1_0092017
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length2863
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: A0A0D2SFI6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G169000 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.072e-65
Identity = 79/82 (96.34%), Postives = 81/82 (98.78%), Query Frame = 2
Query: 1100 TGLCHISQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQVE 1345
            +GLCHI+QVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQ E
Sbjct:   49 SGLCHIAQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQAE 130          

HSP 2 Score: 116.316 bits (290), Expect = 1.072e-65
Identity = 65/100 (65.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query: 1422 AERCRLSIGHSEVLTNDPNXXXXXXXXXXXXXXXW*LLDRIETLNQDICIFGFFFVSISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQVFRWSIAD 1721
            AERCRLSIGHSEVLTNDPNVVA                                 ++ISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQVFRWSIAD
Sbjct:  129 AERCRLSIGHSEVLTNDPNVVAA--------------------------------INISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQVFRWSIAD 196          
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: A0A0B0P7I3_GOSAR (Putative RNA-binding ylmH OS=Gossypium arboreum GN=F383_28730 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.206e-62
Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 2
Query: 1100 TGLCHISQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQVE 1345
            +GLCHISQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQ E
Sbjct:   49 SGLCHISQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQAE 130          

HSP 2 Score: 100.138 bits (248), Expect = 1.206e-62
Identity = 57/92 (61.96%), Postives = 59/92 (64.13%), Query Frame = 3
Query: 1422 AERCRLSIGHSEVLTNDPNXXXXXXXXXXXXXXXW*LLDRIETLNQDICIFGFFFVSISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 1697
            AERCRLSIGHSEVLTNDPNVVA                                 ++ISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ
Sbjct:  129 AERCRLSIGHSEVLTNDPNVVAA--------------------------------INISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 188          

HSP 3 Score: 204.912 bits (520), Expect = 2.777e-55
Identity = 102/110 (92.73%), Postives = 105/110 (95.45%), Query Frame = 2
Query: 2243 FVMCFLLQVANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNWATVTKNGTTLKTGDIISVSGKGRLKIGEINSTKKGKFSV 2572
            F+M  L +VANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNW TVTKNGTTLKTGDI+SVSGKGRLKIGEINS KKGKFSV
Sbjct:  204 FLMSTLDKVANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNWTTVTKNGTTLKTGDIVSVSGKGRLKIGEINSAKKGKFSV 313          
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: A0A0D2U2T4_GOSRA (Uncharacterized protein (Fragment) OS=Gossypium raimondii GN=B456_013G169000 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.304e-60
Identity = 79/82 (96.34%), Postives = 81/82 (98.78%), Query Frame = 2
Query: 1100 TGLCHISQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQVE 1345
            +GLCHI+QVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQ E
Sbjct:   49 SGLCHIAQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQAE 130          

HSP 2 Score: 99.3673 bits (246), Expect = 1.304e-60
Identity = 57/92 (61.96%), Postives = 59/92 (64.13%), Query Frame = 3
Query: 1422 AERCRLSIGHSEVLTNDPNXXXXXXXXXXXXXXXW*LLDRIETLNQDICIFGFFFVSISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 1697
            AERCRLSIGHSEVLTNDPNVVA                                 ++ISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ
Sbjct:  129 AERCRLSIGHSEVLTNDPNVVAA--------------------------------INISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 188          
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: A0A0D2U2W6_GOSRA (Uncharacterized protein (Fragment) OS=Gossypium raimondii GN=B456_013G1708002 PE=4 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.373e-60
Identity = 104/108 (96.30%), Postives = 107/108 (99.07%), Query Frame = 2
Query: 2267 VANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNWATVTKNGTTLKTGDIISVSGKGRLKIGEINSTKKGKFSVELIRYL 2590
            VANVSVSCTQIPLLALEYEPPRTQSFKT+EASLRVDALASAGFKISRSKLV+LISNGDVRVNW TVTKNGTTLKTGDI+SVSGKGRLKIGEINSTKKGKFSVELIRYL
Sbjct:    1 VANVSVSCTQIPLLALEYEPPRTQSFKTVEASLRVDALASAGFKISRSKLVNLISNGDVRVNWTTVTKNGTTLKTGDIVSVSGKGRLKIGEINSTKKGKFSVELIRYL 108          
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: A0A061F6L8_THECC (RNA-binding S4 domain-containing protein OS=Theobroma cacao GN=TCM_031522 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.425e-56
Identity = 72/82 (87.80%), Postives = 78/82 (95.12%), Query Frame = 2
Query: 1100 TGLCHISQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQVE 1345
            +GLCH++QVIKGDNDVLLKGVGDKSAIEEVKHIL+ ARRAATRREV HTDFLTPPV+KESM+VL KLADVKAVAQGGYPQ E
Sbjct:   49 SGLCHVAQVIKGDNDVLLKGVGDKSAIEEVKHILEMARRAATRREVLHTDFLTPPVIKESMLVLGKLADVKAVAQGGYPQAE 130          

HSP 2 Score: 90.8929 bits (224), Expect = 6.425e-56
Identity = 51/92 (55.43%), Postives = 55/92 (59.78%), Query Frame = 3
Query: 1422 AERCRLSIGHSEVLTNDPNXXXXXXXXXXXXXXXW*LLDRIETLNQDICIFGFFFVSISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 1697
            AERCR+SIGHSEVLT+DP                    D +  LN            I+GNF FQPCSHGDFLGAILG GIAREKLGDIILQ
Sbjct:  129 AERCRISIGHSEVLTSDP--------------------DVVAALN------------ITGNFGFQPCSHGDFLGAILGTGIAREKLGDIILQ 188          

HSP 3 Score: 206.068 bits (523), Expect = 9.360e-56
Identity = 100/116 (86.21%), Postives = 109/116 (93.97%), Query Frame = 2
Query: 2243 FVMCFLLQVANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNWATVTKNGTTLKTGDIISVSGKGRLKIGEINSTKKGKFSVELIRYL 2590
            F+M  L +V NVSVSC QIPLLALEYEPPRTQSFKT+EASLRVDALASAGFKISRSKLV+LISNGDVRVNW +VTKNGT LKTGDI+SVSGKGRLKIGEIN+T+KGKF+VELIRYL
Sbjct:  204 FLMSTLDKVGNVSVSCMQIPLLALEYEPPRTQSFKTVEASLRVDALASAGFKISRSKLVNLISNGDVRVNWTSVTKNGTILKTGDIVSVSGKGRLKIGEINTTRKGKFAVELIRYL 319          
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: A0A067F592_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g020729mg PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.664e-55
Identity = 97/116 (83.62%), Postives = 111/116 (95.69%), Query Frame = 2
Query: 2243 FVMCFLLQVANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNWATVTKNGTTLKTGDIISVSGKGRLKIGEINSTKKGKFSVELIRYL 2590
            +++  L +V NVSVSCT+IPLLALEYEPPRT+SFKTIEASLRVDALASAGFK+SRSKLV+LISNGDVRVNW TVTKNGTTL+TGDI+SVSGKGR+KIGEINST+KGKF+VELI+YL
Sbjct:  121 YLITSLEKVGNVSVSCTRIPLLALEYEPPRTKSFKTIEASLRVDALASAGFKLSRSKLVNLISNGDVRVNWTTVTKNGTTLRTGDIVSVSGKGRIKIGEINSTRKGKFAVELIQYL 236          

HSP 2 Score: 87.8113 bits (216), Expect = 1.016e-33
Identity = 38/46 (82.61%), Postives = 43/46 (93.48%), Query Frame = 2
Query: 1208 ARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQVE 1345
            ARRA++RREV H+DFLTPPVLKESM+ L+KLADVKAVAQGGYPQ E
Sbjct:    2 ARRASSRREVLHSDFLTPPVLKESMMALEKLADVKAVAQGGYPQAE 47          

HSP 3 Score: 85.8853 bits (211), Expect = 1.016e-33
Identity = 47/92 (51.09%), Postives = 55/92 (59.78%), Query Frame = 3
Query: 1422 AERCRLSIGHSEVLTNDPNXXXXXXXXXXXXXXXW*LLDRIETLNQDICIFGFFFVSISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 1697
            AERCRLS+GH E LT+DP++VA                                 +SI+GNF FQPCSHGDFLG+ILG GIAREK+GDIILQ
Sbjct:   46 AERCRLSVGHPEALTSDPDIVAA--------------------------------LSITGNFGFQPCSHGDFLGSILGTGIAREKIGDIILQ 105          
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: V4WES6_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10008924mg PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.935e-55
Identity = 97/116 (83.62%), Postives = 111/116 (95.69%), Query Frame = 2
Query: 2243 FVMCFLLQVANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNWATVTKNGTTLKTGDIISVSGKGRLKIGEINSTKKGKFSVELIRYL 2590
            +++  L +V NVSVSCT+IPLLALEYEPPRT+SFKTIEASLRVDALASAGFK+SRSKLV+LISNGDVRVNW TVTKNGTTL+TGDI+SVSGKGR+KIGEINST+KGKF+VELI+YL
Sbjct:  121 YLITSLEKVGNVSVSCTRIPLLALEYEPPRTKSFKTIEASLRVDALASAGFKLSRSKLVNLISNGDVRVNWTTVTKNGTTLRTGDIVSVSGKGRIKIGEINSTRKGKFAVELIQYL 236          

HSP 2 Score: 87.8113 bits (216), Expect = 8.467e-34
Identity = 38/46 (82.61%), Postives = 43/46 (93.48%), Query Frame = 2
Query: 1208 ARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQVE 1345
            ARRA++RREV H+DFLTPPVLKESM+ L+KLADVKAVAQGGYPQ E
Sbjct:    2 ARRASSRREVLHSDFLTPPVLKESMMALEKLADVKAVAQGGYPQAE 47          

HSP 3 Score: 86.2705 bits (212), Expect = 8.467e-34
Identity = 47/92 (51.09%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 1422 AERCRLSIGHSEVLTNDPNXXXXXXXXXXXXXXXW*LLDRIETLNQDICIFGFFFVSISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 1697
            AERCRLS+GH E+LT+DP++VA                                 +SI+GNF FQPCSHGDFLG+ILG GIAREK+GDIILQ
Sbjct:   46 AERCRLSVGHPELLTSDPDIVAA--------------------------------LSITGNFGFQPCSHGDFLGSILGTGIAREKIGDIILQ 105          
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: V4ULC7_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10008924mg PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.370e-54
Identity = 97/116 (83.62%), Postives = 111/116 (95.69%), Query Frame = 2
Query: 2243 FVMCFLLQVANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNWATVTKNGTTLKTGDIISVSGKGRLKIGEINSTKKGKFSVELIRYL 2590
            +++  L +V NVSVSCT+IPLLALEYEPPRT+SFKTIEASLRVDALASAGFK+SRSKLV+LISNGDVRVNW TVTKNGTTL+TGDI+SVSGKGR+KIGEINST+KGKF+VELI+YL
Sbjct:  185 YLITSLEKVGNVSVSCTRIPLLALEYEPPRTKSFKTIEASLRVDALASAGFKLSRSKLVNLISNGDVRVNWTTVTKNGTTLRTGDIVSVSGKGRIKIGEINSTRKGKFAVELIQYL 300          

HSP 2 Score: 85.5001 bits (210), Expect = 1.431e-31
Identity = 47/92 (51.09%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 1422 AERCRLSIGHSEVLTNDPNXXXXXXXXXXXXXXXW*LLDRIETLNQDICIFGFFFVSISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 1697
            AERCRLS+GH E+LT+DP++VA                                 +SI+GNF FQPCSHGDFLG+ILG GIAREK+GDIILQ
Sbjct:  110 AERCRLSVGHPELLTSDPDIVAA--------------------------------LSITGNFGFQPCSHGDFLGSILGTGIAREKIGDIILQ 169          

HSP 3 Score: 80.8777 bits (198), Expect = 1.431e-31
Identity = 43/82 (52.44%), Postives = 52/82 (63.41%), Query Frame = 2
Query: 1100 TGLCHISQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQVE 1345
            +G+ H+ Q +KG+ D LLKGVGDK+AIEEVKHIL+                       ESM+ L+KLADVKAVAQGGYPQ E
Sbjct:   52 SGIRHLIQAVKGNFDDLLKGVGDKNAIEEVKHILEM----------------------ESMMALEKLADVKAVAQGGYPQAE 111          
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: A0A067F8M8_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g020729mg PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.961e-54
Identity = 97/116 (83.62%), Postives = 111/116 (95.69%), Query Frame = 2
Query: 2243 FVMCFLLQVANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNWATVTKNGTTLKTGDIISVSGKGRLKIGEINSTKKGKFSVELIRYL 2590
            +++  L +V NVSVSCT+IPLLALEYEPPRT+SFKTIEASLRVDALASAGFK+SRSKLV+LISNGDVRVNW TVTKNGTTL+TGDI+SVSGKGR+KIGEINST+KGKF+VELI+YL
Sbjct:  207 YLITSLEKVGNVSVSCTRIPLLALEYEPPRTKSFKTIEASLRVDALASAGFKLSRSKLVNLISNGDVRVNWTTVTKNGTTLRTGDIVSVSGKGRIKIGEINSTRKGKFAVELIQYL 322          

HSP 2 Score: 134.42 bits (337), Expect = 1.911e-47
Identity = 61/82 (74.39%), Postives = 73/82 (89.02%), Query Frame = 2
Query: 1100 TGLCHISQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQVE 1345
            +G+ H+ Q +KG+ D LLKGVGDK+AIEEVKHIL+ ARRA++RREV H+DFLTPPVLKESM+ L+KLADVKAVAQGGYPQ E
Sbjct:   52 SGIRHLIQAVKGNFDDLLKGVGDKNAIEEVKHILEMARRASSRREVLHSDFLTPPVLKESMMALEKLADVKAVAQGGYPQAE 133          

HSP 3 Score: 85.1149 bits (209), Expect = 1.911e-47
Identity = 47/92 (51.09%), Postives = 55/92 (59.78%), Query Frame = 3
Query: 1422 AERCRLSIGHSEVLTNDPNXXXXXXXXXXXXXXXW*LLDRIETLNQDICIFGFFFVSISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 1697
            AERCRLS+GH E LT+DP++VA                                 +SI+GNF FQPCSHGDFLG+ILG GIAREK+GDIILQ
Sbjct:  132 AERCRLSVGHPEALTSDPDIVAA--------------------------------LSITGNFGFQPCSHGDFLGSILGTGIAREKIGDIILQ 191          
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Match: V4URF5_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10008924mg PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.082e-54
Identity = 97/116 (83.62%), Postives = 111/116 (95.69%), Query Frame = 2
Query: 2243 FVMCFLLQVANVSVSCTQIPLLALEYEPPRTQSFKTIEASLRVDALASAGFKISRSKLVDLISNGDVRVNWATVTKNGTTLKTGDIISVSGKGRLKIGEINSTKKGKFSVELIRYL 2590
            +++  L +V NVSVSCT+IPLLALEYEPPRT+SFKTIEASLRVDALASAGFK+SRSKLV+LISNGDVRVNW TVTKNGTTL+TGDI+SVSGKGR+KIGEINST+KGKF+VELI+YL
Sbjct:  207 YLITSLEKVGNVSVSCTRIPLLALEYEPPRTKSFKTIEASLRVDALASAGFKLSRSKLVNLISNGDVRVNWTTVTKNGTTLRTGDIVSVSGKGRIKIGEINSTRKGKFAVELIQYL 322          

HSP 2 Score: 134.42 bits (337), Expect = 1.633e-47
Identity = 61/82 (74.39%), Postives = 73/82 (89.02%), Query Frame = 2
Query: 1100 TGLCHISQVIKGDNDVLLKGVGDKSAIEEVKHILDTARRAATRREVFHTDFLTPPVLKESMIVLQKLADVKAVAQGGYPQVE 1345
            +G+ H+ Q +KG+ D LLKGVGDK+AIEEVKHIL+ ARRA++RREV H+DFLTPPVLKESM+ L+KLADVKAVAQGGYPQ E
Sbjct:   52 SGIRHLIQAVKGNFDDLLKGVGDKNAIEEVKHILEMARRASSRREVLHSDFLTPPVLKESMMALEKLADVKAVAQGGYPQAE 133          

HSP 3 Score: 85.5001 bits (210), Expect = 1.633e-47
Identity = 47/92 (51.09%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 1422 AERCRLSIGHSEVLTNDPNXXXXXXXXXXXXXXXW*LLDRIETLNQDICIFGFFFVSISGNFSFQPCSHGDFLGAILGKGIAREKLGDIILQ 1697
            AERCRLS+GH E+LT+DP++VA                                 +SI+GNF FQPCSHGDFLG+ILG GIAREK+GDIILQ
Sbjct:  132 AERCRLSVGHPELLTSDPDIVAA--------------------------------LSITGNFGFQPCSHGDFLGSILGTGIAREKIGDIILQ 191          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of g.barbadense_cottongen_reftransV1_0092017 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2SFI6_GOSRA1.072e-6596.34Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0P7I3_GOSAR1.206e-6297.56Putative RNA-binding ylmH OS=Gossypium arboreum GN... [more]
A0A0D2U2T4_GOSRA1.304e-6096.34Uncharacterized protein (Fragment) OS=Gossypium ra... [more]
A0A0D2U2W6_GOSRA1.373e-6096.30Uncharacterized protein (Fragment) OS=Gossypium ra... [more]
A0A061F6L8_THECC6.425e-5687.80RNA-binding S4 domain-containing protein OS=Theobr... [more]
A0A067F592_CITSI1.664e-5583.62Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
V4WES6_9ROSI1.935e-5583.62Uncharacterized protein OS=Citrus clementina GN=CI... [more]
V4ULC7_9ROSI1.370e-5483.62Uncharacterized protein OS=Citrus clementina GN=CI... [more]
A0A067F8M8_CITSI1.961e-5483.62Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
V4URF5_9ROSI2.082e-5483.62Uncharacterized protein OS=Citrus clementina GN=CI... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 7..14
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 20..147
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..6
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..19
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 15..19
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.519
NoneNo IPR availableTMHMMTMhelixcoord: 7..29

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092017 ID=g.barbadense_cottongen_reftransV1_0092017|Name=g.barbadense_cottongen_reftransV1_0092017|organism=Gossypium barbadense|type=contig|length=2863bp
CAATATCCGCTGAGAAGTTCAGGTTTTTTATTTTGTTATGAATTTTTTCT
TCTTTTTTATCTATATATATATATTTGTGATAGTTGTATAAATAGAGATA
CCCATGGAGCTAAATTAGAAGATTTTCTATTTATTTTGAAGTAATCTTGT
GCAATTAGAGATACCCTTTATGCTAAAGTTAAAGAATTTGCAAATATCTT
TTGTTAGTTTTGAGGTATAGAGATGCCCATTTAGCCAGAGAAAAAAATAT
TTACATTTACCTCTTCTTAACATTCTTGGTTTATTTTGAAGTAATATTGT
GTAATTATAGACAAACATTGATAAAAGGGAGGAATTTGAGCAATTTTCTT
TGTTAGTTTTGTTATAATCGTGGATTAATTTGAGACACCCATTAAGCTGA
ATTAGGAGAATCTAGTAAGCGCATCTGAAAAAAAAAAGTATTGAAGGAAC
TAAAATGCTTGAGATTATAACAATGTTGTCACTCAAATGAACTTGTAAGT
CAGTTATATTACTCTTATCAGGAAAAAAAAGAGATGCTTCTTTTTACTAA
AAGGTTTGTTTAGATTTCGGATGGTTTTATGTCAGGGATTCCATCCAGGG
ATGAAGCATGCACTGCAACTCGTATCATTATGTAGACGTTTTACCTCCGA
GTGAAATATGCCAATTATTTCAAATGCATTTTGTTAAGGAAGAATGAATG
CTTGTTAACCTCAGCTCGATATCAAAATATATTGCCATCCTTAATGAATG
CACACCTAGGGCATTGACCACAATTCCAATTCAACTTTTTATTATTCCTA
GAACTAGAGTCTATACACAAGAGAACTTATAGTAGTAGTTGTTTCTTAGA
ATTATCAATTTATCACAAAGTTATTGAACATTAAACATATGCAATAGCCA
CCATTACCATGGCTGCTGAACCTGTACTTTAGCATTGTTAGTAAGCTGTA
GGATTAACTTCTGCAGAGTCCAGCTTCTTCAACTTTTTCAATTGTTTTTT
TGCCATATGTACATGTTTCAGCAAATGGGATGTATGCATATACAACAGTG
CTGATTTTCTAGTCGAGTAACATCCTATTTAAAATTTTGAAATGCACACA
CAGGGTTATGTCACATTTCCCAAGTTATAAAGGGGGATAATGATGTTTTA
CTTAAAGGAGTGGGAGATAAGAGTGCTATCGAAGAAGTGAAACATATACT
TGATACGGCTAGACGTGCAGCAACCAGAAGAGAGGTATTCCATACAGATT
TTCTAACCCCACCAGTATTAAAGGAGTCCATGATTGTTCTGCAAAAACTG
GCTGATGTTAAGGCAGTTGCACAGGGGGGGTATCCTCAGGTTGAACCAAA
TGGATTCAGTTTACTTCTCCTTCATTGATTTCTTTGGTTATACAAGTTGA
TGAATCTCCGTGATCCTTTAGGCTGAGCGTTGCCGTCTTTCTATTGGACA
TTCAGAAGTATTGACCAATGATCCTAATGTAGTTGCAATAATAAAGTAAG
TAATATCCTTCATTGTCAAGAGCTGGTGACTGCTTGACAGGATTGAAACT
CTGAATCAAGATATATGCATATTTGGTTTTTTCTTTGTCAGTATCTCGGG
AAACTTCAGCTTTCAACCTTGTTCTCATGGTGACTTCCTTGGTGCAATTC
TTGGTAAAGGTATTGCTAGAGAGAAGCTTGGGGATATTATCTTGCAGGTA
TTCAGATGGTCAATTGCGGATTAGGCAATTTAGAACTTGGGTTTACTTTA
AAAGCCCTGGTTTAATTTCTTTCATTAAGATCATTTATACCTGCCTCCTA
AACCAGCAAAGAAGTTTTCTCTGCGTCTAATATATTACCAGGCTGTAACC
TATGTTGACTGTTAACTAGGGAGAAAAGGGAGCTCATGTCCTGATTGTTC
CTGAACTCGTTGACTTTCTTATGTCGACACTGGACAAGGTGAACTTTTTT
CCCCTTGGATACACTCAATGACTGCAATAATTTTAAATTTAAATTTTTTT
CCACTTTTTCGGGTAACAGTAACAGCATTATCACAGTAACCTTGCAGTGA
AATTTTTATTCTTGCACACTGTTAGTATCACATTAAAATCAATATATTGT
CTGTCATATTTGTTTGTTTTTAGTGGTAAATAACACTCACATTCTTGTAA
TGTCTGTAACGGTTATGGAGTCTCCAAAGGCATGAGCTAATCTTGCCGTA
TTGCAGTAAAAAGAATTGTGGGTGAAATCCTCTCCAACTCTTTTTGTTAT
GTGTTTCCTTTTGCAGGTTGCTAATGTATCAGTATCATGTACACAGATAC
CTCTGCTTGCACTTGAATATGAGCCACCAAGGACGCAGTCATTCAAAACC
ATAGAAGCATCGCTTCGTGTTGATGCTCTTGCTAGTGCAGGATTTAAGAT
TTCTAGATCTAAACTAGTTGATTTGATAAGCAACGGAGATGTACGCGTAA
ATTGGGCAACTGTAACAAAAAATGGAACAACTCTCAAGACCGGTGACATT
ATCTCTGTTAGTGGGAAAGGAAGACTAAAGATTGGAGAAATTAACAGTAC
AAAGAAGGGAAAGTTTTCTGTGGAACTCATTCGGTATTTGTAGGGTTAGC
AATTGAGTAAAAGGATGATGGAGTTTAGGCAATTGAGGATACACATTGTG
ATGTTTCTAACTAAACAAGGGATTCTCAAATATCAGAAGCCATAGAAAAG
AAAAAAAGGAATTACATTACAAGGAGTCTGGCTAATGTATCAAAGCTGTG
AATTCCAAGACAAATGCCAGCTTCTTGCATGGCATCTGAGGGTCATAGGA
AAACTCATCACTTGAGTGCATTAGAGGCATCCAGAATATTCATATAACTT
TTTTATTAGTCAA
back to top