g.barbadense_cottongen_reftransV1_0092016, g.barbadense_cottongen_reftransV1_0092016 (contig) Gossypium barbadense

Overview
Nameg.barbadense_cottongen_reftransV1_0092016
Unique Nameg.barbadense_cottongen_reftransV1_0092016
Typecontig
OrganismGossypium barbadense (Sea Island cotton)
Sequence length1941
Homology
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: RSC5_DICDI (Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.003e-31
Identity = 77/239 (32.22%), Postives = 134/239 (56.07%), Query Frame = -2
Query:  447 KELRAALRPLSD-RGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRW-HEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQL--RHLVYMIENAI--LNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPK---NKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQ 1136
            KE+++    L+D   + +CTD C  RYL ARN+ V KS+KML +TL+WR  ++P++I+   +I   G  G VY  N  D+ GR ++   P      ++ ++L  ++LVY +E     ++ P+  EQ  +++D+  +  S ++ +K+  + ++ L +H PER+  ++  +PP +F   WKI+  FL+  T  KV+F+  K    K +   +  Y D ENL  + GG     YN +E+ K+
Sbjct:   53 KEIKSNFSDLTDPTDIAFCTDMCFLRYLRARNYIVSKSEKMLRDTLEWRKKFRPQDIQLGGDIREIGSAGCVY-VNKRDKKGRPIIFAVPRNDTLKNVPSELKFKNLVYWLEQGFSRMDEPKGIEQFCFIVDYKDFG-SGNMDMKTNLEAMHFLLDHCPERMGQSLFLDPPALFWFAWKIISPFLNEVTLSKVRFINSKKVDGKRTFAELLEYVDIENLEQNLGGNLDYNYNIDEYLKE 289          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: YJX4_SCHPO (CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.04c PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.291e-30
Identity = 75/215 (34.88%), Postives = 118/215 (54.88%), Query Frame = -2
Query:  438 TDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQ 1082
            T  C+ RYL A  W+V  +KK + +TL WR  +    +   EI  E  TGK     + D+DGR  L L P +QNT +   Q+RHLV+ +E AI  +P   E +  LI+F   S  ++  +   ++ +N+LQ HY ERL  A++ N P     F+K++  F+D  T +K+KF  P ++        Y  ++ L ++FGG    EY+HE++  Q+V+
Sbjct:  634 TRECILRYLRATKWHVSNAKKRIVDTLVWRRHFGVNNMDPDEIQEENATGKQVLLGY-DKDGRPCLYLYPARQNTKTSPLQIRHLVFSLECAIDLMPPGVETLALLINFKSSSNRSNPSVGQGKEVLNILQTHYCERLGRALVINIPWAVWGFFKLISPFIDPITREKLKFNEPLDR--------YVPKDQLDSNFGGSLHFEYHHEKYWPQLVE 839          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: PDR16_YEAST (Phosphatidylinositol transfer protein PDR16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR16 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.199e-27
Identity = 75/242 (30.99%), Postives = 119/242 (49.17%), Query Frame = -2
Query:  438 LRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTY--------KPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSV-------PIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQ 1118
            L+PL +    + T  C  RYL A  W +      +  TL WR  +          ++I    +AVE E+GK     + + D R +L L+PG+QNT +   Q++HLV+M+E  I  +P  Q+ +  LIDF  +     V       PI   ++ +++LQ HYPERL  A+L N P +   F K++  F+D  T +K+ F  P  K        Y  +  L + +GG    +YNH+ +   +V+
Sbjct:   74 LKPLEEEEKAWLTRECFLRYLRATKWVLKDCIDRITMTLAWRREFGISHLGEEHGDKITADLVAVENESGKQVILGY-ENDARPILYLKPGRQNTKTSHRQVQHLVFMLERVIDFMPAGQDSLALLIDFKDYPDVPKVPGNSKIPPIGVGKEVLHILQTHYPERLGKALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFVK--------YVPKNELDSLYGGDLKFKYNHDVYWPALVE 306          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: PDR17_YEAST (Phosphatidylinositol transfer protein PDR17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR17 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 5.701e-27
Identity = 95/281 (33.81%), Postives = 135/281 (48.04%), Query Frame = -2
Query:  381 QNDSLQHESKVKEL----RAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRS----TYKPEE---IRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDF-----TGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQ--DDIKSATLWGFDNKLQSTG 1169
            Q+D L+    + +L     A  RPLSD    + +  C  RYL A  WN   + K L +TL WR     T+  E+   +   ++AVE ETGK     F D   R +  ++ G+QNT S   Q++ LVYM+E A    P+  E++  L+DF      G     + PI  AR  +NV+Q+HYPERLA  VL N P    AF K++  FLD  T  K  F  P          ++ +   L   + G    +Y HE +   MV+  DD++   L  FD  L+  G
Sbjct:   58 QDDDLKLPENLNDLDNGTHANDRPLSDWEKFWLSRECFLRYLRANKWNTANAIKGLTKTLVWRREIGLTHGKEDKDPLTADKVAVENETGKQVILGF-DNAKRPLYYMKNGRQNTESSFRQVQELVYMMETATTVAPQGVEKITVLVDFKSYKEPGIITDKAPPISIARMCLNVMQDHYPERLAKCVLINIPWFAWAFLKMMYPFLDPATKAKAIFDEP--------FENHIEPSQLDALYNGLLDFKYKHEVYWPDMVKKVDDLR---LKRFDRFLKFGG 326          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: RETM_DROME (Protein real-time OS=Drosophila melanogaster GN=retm PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 2.852e-18
Identity = 71/245 (28.98%), Postives = 113/245 (46.12%), Query Frame = -2
Query:  483 SLQHESKVKELRAALRPLSD--RGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFH--DRDGRTVLILRPGKQNTTSL------DNQLRHLVYMIENAILNLPEDQEQM-------VWLIDFTGWSLST--SVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKA 1160
            S   ESK+ ELR  L  + D  R   Y T   + R+L AR+W+V ++  ML ++L+WR  ++ + +   E +      + +   +H  D+DGR V ILR G  +   L      D  LR  +++ E  I  + E  E++         L+D  G S+       IK+  + I  ++ +YPE +   ++   PR+F   W IV  F+D  T  K  F  P      + +  Y DEE +P   GG  
Sbjct:  218 SPMQESKLLELRKMLDGVDDLERVPSYQT---ILRFLAARDWHVSQAYAMLCDSLRWRREHRIDAL-LAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGPC 458          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: RETM_DROPS (Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.338e-18
Identity = 73/247 (29.55%), Postives = 113/247 (45.75%), Query Frame = -2
Query:  483 SLQHESKVKELRAALRPLSD--RGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKP----EEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSL------DNQLRHLVYMIENAILNLPEDQEQM-------VWLIDFTGWSLST--SVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKA 1160
            S   ESK+ ELR  L  + D  R   Y T   + R+L AR+W+V ++  ML ++L+WR  ++     EE     + VE   G  +    HD+DGR + ILR G  +   L      +  LR  +++ E  I  + E  E++         L+D  G S+       IK+    I  ++ +YPE +   ++   PR+F   W IV  F+D  T  K  F  P  +   + +  Y DEE +P   GG  
Sbjct:  216 SPMQESKLLELRKMLDGVDDLERVPSYQT---ILRFLSARDWHVSQAFAMLCDSLQWRKEHRMDSLLEEYTEPAVVVEHFPGGWHH---HDKDGRPIYILRLGHMDVKGLLKSLGMEGLLRLALHICEEGIQKINESAERLDKPVLNWSLLVDLEGLSMRHLWRPGIKALLYIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCEHMKDGLAQYIDEEIVPDFLGGPC 456          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: SEC14_CANGA (SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.507e-17
Identity = 79/270 (29.26%), Postives = 122/270 (45.19%), Query Frame = -2
Query:  483 ARFLASVTMFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEI----RWHEIAVEGETGKVYRANFH--DRDGRTVLILRPGKQNTTSLDN------QLRHLVYMIENAI-LNLPEDQEQMVWLI-------DFTGWSLSTSVPIKS-ARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKA 1229
            A FLAS               N     E  +K+LR+ L     +  +   D+ L R+L AR ++V  +K+M E   KWR  Y    I     + E  +     K Y   +H  D+DGR V     G  N T ++        L++LV+  E+ +   LP       +L+       D  G S+S++  + S  R+   + QN+YPER+    L N P  F   +++ K FLD  T  K+ F+   + +S EL++     ENLP+ FGGK+
Sbjct:    5 AEFLASYPQKCPAGSLPGTPGNTDEAQEGALKQLRSELEAAGFK--ERLDDSTLLRFLRARKFDVALAKEMFENCEKWRKEYGTNTIMQDFHYDEKPL---VAKYYPQYYHKTDKDGRPVYFEELGAVNLTEMEKITTQERMLKNLVWEYESVVNYRLPACSRAAGYLVETSCTVMDLKGISISSAYSVLSYVREASYISQNYYPERMGKFYLINAPFGFSTAFRLFKPFLDPVTVSKI-FILGSSYQS-ELLKQ-IPAENLPSKFGGKS 266          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: SEC14_ASHGO (SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 2.197e-17
Identity = 75/250 (30.00%), Postives = 120/250 (48.00%), Query Frame = -2
Query:  483 NDSLQHESKVKELRAALRPLSDRGL-KYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKP----EEIRWHEIAVEGETGKVYRANFH--DRDGRTVLILRPGKQNTTSL------DNQLRHLVYMIEN-AILNLPEDQEQMVWLI-------DFTGWSLSTSVPIKS-ARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKA 1166
            N + +HE+ ++ELR  L+     G  K   D+ L R+L AR ++V  ++ M E   KWR         E+  + E  +     K Y   +H  D+DGR V I   G  N T +      +  L++L++  E+ +   LP    Q   L+       D  G S+S +  + S  R+  N+ QN+YPER+    + N P  F A +++ K FLD  T  K+ F+   + +  EL++     ENLP  FGG++
Sbjct:   26 NLTSEHEAALEELRKVLK---QAGFTKRLDDSTLLRFLRARKFDVAAARAMFENCEKWRKENGVDTIFEDFHYEEKPL---VAKFYPQYYHKTDKDGRPVYIEELGAVNLTEMYKITTQERMLKNLIWEYESFSRYRLPASSRQADCLVETSCTILDLKGISISAAAQVLSYVREASNIGQNYYPERMGKFYMINAPFGFSAAFRLFKPFLDPVTVSKI-FILGSSYQK-ELLKQ-IPAENLPVKFGGQS 266          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: SEC14_KLULA (SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 6.249e-17
Identity = 73/245 (29.80%), Postives = 118/245 (48.16%), Query Frame = -2
Query:  483 QHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKP----EEIRWHEIAVEGETGKVYRANFH--DRDGRTVLILRPGKQNTTSL------DNQLRHLVYMIENAI-LNLPEDQEQMVWLI-------DFTGWSLSTSVPIKS-ARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKA 1154
            + E+K+KE R  L  L  +  +   D+ L R+L AR ++++ SK M E   KWR  +      E+  + E  +     K Y   +H  D DGR V I   G  N T +      +  L++LV+  E  +   LP    +  +L+       D  G S+S++  + S  R+  N+ QN+YPER+    L N P  F   +++ K FLD  T  K+ F+   + +  +L++     ENLP  FGG++
Sbjct:   30 EQEAKLKEFRELLESLGYK--ERLDDSTLLRFLRARKFDLEASKIMYENCEKWRKEFGVDTIFEDFHYEEKPL---VAKYYPQYYHKTDNDGRPVYIEELGSVNLTQMYKITTQERMLKNLVWEYEAFVRYRLPACSRKAGYLVETSCTILDLKGISISSAAQVLSYVREASNIGQNYYPERMGKFYLINAPFGFSTAFRLFKPFLDPVTVSKI-FILGSSYQK-DLLKQ-IPAENLPKKFGGQS 266          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Match: SEC14_YARLI (SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.294e-16
Identity = 77/250 (30.80%), Postives = 121/250 (48.40%), Query Frame = -2
Query:  483 NDSLQHESKVKELRAAL--RPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIR---WHEIAVEGETGKVYRANFH--DRDGRTVLILRPGKQNT------TSLDNQLRHLVYMIENAILN-LPEDQ-------EQMVWLIDFTGWSLSTSVPIKS-ARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKA 1166
            N + + E K+ EL+  L  +   DR      DA L R+L AR ++V  +++M E   KWR  +    I    W++   + E  K+Y   +H  D+DGR V +   GK N       T+ +  LR+LV+  E+ + + LP          E    ++D  G SLS++  +    +D  N+ QN+YPER+    L N P  F   + ++K FLD  T  K+  VY  N +  E + +     NLP  FGG++
Sbjct:   27 NLTAEQEQKLGELKMILLTKGYEDR----TDDATLLRFLRARKFDVPLAQEMWENCEKWRKEFGTNTILEDFWYK--EKKEVAKLYPQYYHKTDKDGRPVYVENVGKVNIHEMYKITTQERMLRNLVWEYESFVRHRLPACSRVVGHLIETSCTILDLKGVSLSSASQVYGFLKDASNIGQNYYPERMGKFYLINAPFGFSTVFSVIKRFLDPVTVSKIH-VYGSNYK--EKLLAQVPAYNLPIKFGGQS 267          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: A0A0D2U6Y6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G010500 PE=4 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 293/295 (99.32%), Postives = 294/295 (99.66%), Query Frame = -2
Query:  321 MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTNQSGPEITPEPICLAPAAS 1205
            MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPE QEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGT+QSGPEITPEPICLAPAAS
Sbjct:    1 MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEGQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTDQSGPEITPEPICLAPAAS 295          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: A0A0B0P6U1_GOSAR (Cral-trio domain-containing c23b6.04c OS=Gossypium arboreum GN=F383_10739 PE=4 SV=1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 285/295 (96.61%), Postives = 292/295 (98.98%), Query Frame = -2
Query:  321 MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTNQSGPEITPEPICLAPAAS 1205
            MFSRWSHSHH+Q+ DSLQHESKVKELRAA+RPLSDRGLKYCTDACL RYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIA+EGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLA AVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIK+ATLWGFDNKLQSTGT+QSGP+ITPEPICLAPAAS
Sbjct:    1 MFSRWSHSHHSQETDSLQHESKVKELRAAVRPLSDRGLKYCTDACLMRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAIEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLATAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKTATLWGFDNKLQSTGTDQSGPQITPEPICLAPAAS 295          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: A0A0D2TN34_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G202600 PE=4 SV=1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 255/295 (86.44%), Postives = 274/295 (92.88%), Query Frame = -2
Query:  321 MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTNQSGPEITPEPICLAPAAS 1205
            MFSRWS SHHN++NDSLQ ESK+KELRAA+ PLS R LKYCTDACLRRYLEARNWN DKSKKMLEETLKWRSTYKPEEIRWH++AVEGETGKVYRA+FHDR GRTVLILRPGKQNTTSLDNQLRHLVY+IENAILNLPE QEQM WLIDFTGW+LSTSVPIKSARDTIN+LQNHYPERL +A LYNPPRIFEAFWKIVKYF+DAKTFQKVKFVYPKN ESVELMRSYFDEENLPT+FGGKA+LEYNHEEFSKQM QDDIKSA LWGFD+KLQ  G   SG ++ PEP+CLAP+AS
Sbjct:    1 MFSRWSSSHHNKENDSLQQESKIKELRAAIGPLSGRSLKYCTDACLRRYLEARNWNADKSKKMLEETLKWRSTYKPEEIRWHKVAVEGETGKVYRASFHDRHGRTVLILRPGKQNTTSLDNQLRHLVYLIENAILNLPETQEQMAWLIDFTGWTLSTSVPIKSARDTINLLQNHYPERLVIAFLYNPPRIFEAFWKIVKYFMDAKTFQKVKFVYPKNTESVELMRSYFDEENLPTEFGGKAVLEYNHEEFSKQMNQDDIKSANLWGFDDKLQCIGNGHSGSDVAPEPVCLAPSAS 295          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: A0A0B0P2Z4_GOSAR (Random slug 5 OS=Gossypium arboreum GN=F383_23926 PE=4 SV=1)

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 254/295 (86.10%), Postives = 275/295 (93.22%), Query Frame = -2
Query:  321 MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTNQSGPEITPEPICLAPAAS 1205
            MFSRWS+SHHN++NDSLQ ESK+KEL+AA+ PLS R LKYCTDACLRRYLEARNWN DKSKKMLEET+KWRSTYKPEEIRWHE+AVEGETGKVYRA+FHDR GRTVLILRPGKQNTTSLDNQLRHLVY+IENAILNLPE QEQM WLIDFTGW+LSTSVPIKSA DTIN+LQNHYPERLA+A LYNPPRIFEAFWKIVKYF+DAKTFQKVKFVYPKN ESVELMRSYFDEENLPT+FGGKA+LEYNHEEFSKQM QDDIKSA LWGFD+KLQ  G   SG ++ PEP+CLAP+AS
Sbjct:    1 MFSRWSNSHHNKENDSLQQESKIKELQAAIGPLSGRSLKYCTDACLRRYLEARNWNADKSKKMLEETIKWRSTYKPEEIRWHEVAVEGETGKVYRASFHDRHGRTVLILRPGKQNTTSLDNQLRHLVYLIENAILNLPETQEQMAWLIDFTGWTLSTSVPIKSAHDTINLLQNHYPERLAIAFLYNPPRIFEAFWKIVKYFMDAKTFQKVKFVYPKNTESVELMRSYFDEENLPTEFGGKAVLEYNHEEFSKQMSQDDIKSANLWGFDDKLQCIGNRHSGSDVAPEPVCLAPSAS 295          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: A0A061FCY0_THECC (Sec14p-like phosphatidylinositol transfer family protein isoform 1 OS=Theobroma cacao GN=TCM_034028 PE=4 SV=1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 254/295 (86.10%), Postives = 273/295 (92.54%), Query Frame = -2
Query:  321 MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTNQSGPEITPEPICLAPAAS 1205
            MFSRWS+S+H Q+NDSLQHESKVKELRA+L PLS R L YCTDACLRRY+EARNWNVDKSKKMLEET+KWRS YKPEEIRWHE+AVEGETGKVYRANFHDR GRTVLILRPGKQNTTSLDNQ RHLVY+IENAILNLPE QEQM WLIDFTGW+LSTSVPIKSARDTINVLQNHYPERLA+A LYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNK+SVELMRSYFDEENLPT+FGG+A+L+YNHEEFSKQM+QDDIKSA LWG D+KLQS G   S  E+ PEP+CLAP  S
Sbjct:    1 MFSRWSNSNHVQENDSLQHESKVKELRASLPPLSGRCLNYCTDACLRRYMEARNWNVDKSKKMLEETIKWRSIYKPEEIRWHEVAVEGETGKVYRANFHDRHGRTVLILRPGKQNTTSLDNQFRHLVYLIENAILNLPEGQEQMAWLIDFTGWTLSTSVPIKSARDTINVLQNHYPERLAIAFLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKDSVELMRSYFDEENLPTEFGGRAVLQYNHEEFSKQMIQDDIKSANLWGLDDKLQSVGNGHSLAEVAPEPVCLAPPVS 295          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: M5XYV3_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa009403mg PE=4 SV=1)

HSP 1 Score: 487.649 bits (1254), Expect = 1.824e-165
Identity = 225/295 (76.27%), Postives = 252/295 (85.42%), Query Frame = -2
Query:  321 MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTNQSGPEITPEPICLAPAAS 1205
            MF  WS SHH Q ND LQHE K+ EL+AA+ PLS R L++CTDAC RRYLEARNWNVDK+KKMLEETL WRSTYKPEEI W E+A EGETGKVYRA+F DR GRTVLILRPG QNT S+DNQ+RHLVY+IENA+ NLPE QEQM WLIDFTGW+LST+VP+KSARDTIN+LQNHYPERLA+A LYNPPRIFEAFWKIVKYFLD KTF KVKFVYPKNK+SVELM+ YFDE+NLPT+FGG AIL Y+HEEFSK M QDD++SA  WG D+KL   G   SG E+ PEP+CLAP AS
Sbjct:    1 MFRLWSSSHH-QDNDPLQHEVKINELKAAIGPLSGRSLQFCTDACFRRYLEARNWNVDKAKKMLEETLNWRSTYKPEEICWREVANEGETGKVYRASFRDRSGRTVLILRPGMQNTVSIDNQMRHLVYLIENAVFNLPEGQEQMAWLIDFTGWTLSTTVPVKSARDTINILQNHYPERLAVAFLYNPPRIFEAFWKIVKYFLDNKTFHKVKFVYPKNKDSVELMKQYFDEKNLPTEFGGHAILNYDHEEFSKLMTQDDVRSAAFWGRDDKLPHYGNGHSGAEVAPEPVCLAPVAS 294          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: A0A067KQT3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04422 PE=4 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 3.706e-165
Identity = 226/294 (76.87%), Postives = 257/294 (87.41%), Query Frame = -2
Query:  324 MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTNQSGPEITPEPICLAPAA 1205
            MF RWS+S+ +QQ+ SLQ +SKV ELR A+ PLS R L+YC+DACLRRYLEAR+WNVDKSKKML+ETLKWRST+KPEEIRWHE+A+EGETGKVYRANFHDR GRTVLILRPG QNT S+DNQLRHLVY+IENAILNLPE QEQM WLIDFTGWS++ SVPIK+AR+TIN+LQNHYPERLA+A LYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKN +SVE+M+SYFD+ENLP DFGGKAIL+Y+HEEFS+ M  DD K+A+ WGFDNKLQ       G E+ PEP  L   A
Sbjct:    1 MFHRWSNSNQDQQDVSLQRDSKVNELRNAIGPLSGRSLQYCSDACLRRYLEARSWNVDKSKKMLQETLKWRSTFKPEEIRWHEVAIEGETGKVYRANFHDRLGRTVLILRPGMQNTKSIDNQLRHLVYLIENAILNLPEGQEQMAWLIDFTGWSITNSVPIKTARETINILQNHYPERLAIAFLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNVDSVEVMQSYFDDENLPADFGGKAILKYDHEEFSRLMSLDDDKAASFWGFDNKLQPVTNGHHGAEVAPEPNGLVSPA 294          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: V4T4X8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10002080mg PE=4 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 1.892e-164
Identity = 222/276 (80.43%), Postives = 250/276 (90.58%), Query Frame = -2
Query:  345 QQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTNQSGPEITPEP 1172
            Q+++   HESKVKEL+AA+ PL  R L+YC+DACL+RYLEARNWNVDK+KKMLEETLKWRSTY+PEEIRW+EIAVEGETGK++RA FHDR GRTVLILRPG QNT S+DNQ+RHLVY+IENAILNLPE QEQM WLIDFTGWSLSTSVPI+SAR+TIN+LQNHYPERLA+A LYNPPRIFEAFWK+VKYFLDAKTFQKVKFVYPKNK+SVE+M SYFDEENLPT+FGGKA L Y+HEEFSK M+QDD KSATLWGFD+KLQ  G   SG E+ PEP
Sbjct:    9 QESEEHHHESKVKELKAAIGPLYGRSLQYCSDACLKRYLEARNWNVDKAKKMLEETLKWRSTYRPEEIRWNEIAVEGETGKLFRAGFHDRHGRTVLILRPGMQNTASIDNQMRHLVYLIENAILNLPEGQEQMAWLIDFTGWSLSTSVPIRSARETINILQNHYPERLAIAFLYNPPRIFEAFWKVVKYFLDAKTFQKVKFVYPKNKDSVEVMSSYFDEENLPTEFGGKATLHYDHEEFSKLMIQDDSKSATLWGFDDKLQRVGNGHSGAEVAPEP 284          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: F6H1I3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_18s0001g12420 PE=4 SV=1)

HSP 1 Score: 485.723 bits (1249), Expect = 2.100e-164
Identity = 224/295 (75.93%), Postives = 252/295 (85.42%), Query Frame = -2
Query:  324 TMFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQSTGTNQSGPEITPEPICLAPAA 1208
            TM   W  SHH+Q+ D  + +SKV EL+AAL PLS R L+YC DACL+RYLEARNWNVDKSKKMLEETL WRSTYKPEEIRW ++A EGETGKV+RANFHDR GRTVLILRPGKQNTT+LDNQ+RHLVY++ENAILNLPEDQEQMVWLIDFTG + S SVPIK+ARDTIN+LQNHYPERL +A LY+PPRIFEAFWK VKY LDAKTFQKVKFVYPK+K SVELM SYFD ENLPTDFGGKA + Y+HEEFS+ M QDD+KSA LWGF +KLQ      S  E++PEP CLAPA+
Sbjct:   21 TMLRLWGKSHHDQEKDLQKSDSKVHELKAALGPLSGRSLQYCNDACLKRYLEARNWNVDKSKKMLEETLTWRSTYKPEEIRWSDVATEGETGKVFRANFHDRHGRTVLILRPGKQNTTALDNQVRHLVYLLENAILNLPEDQEQMVWLIDFTGMTFSNSVPIKTARDTINILQNHYPERLFLAFLYSPPRIFEAFWKAVKYLLDAKTFQKVKFVYPKDKNSVELMSSYFDVENLPTDFGGKATMNYDHEEFSRLMTQDDVKSANLWGFGDKLQHVSNGHSVAEVSPEPACLAPAS 315          
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Match: A0A059BNP3_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_F01566 PE=4 SV=1)

HSP 1 Score: 482.641 bits (1241), Expect = 2.260e-163
Identity = 221/298 (74.16%), Postives = 260/298 (87.25%), Query Frame = -2
Query:  321 MFSRWSHSHHNQQNDSLQHESKVKELRAALRPLSDRGLKYCTDACLRRYLEARNWNVDKSKKMLEETLKWRSTYKPEEIRWHEIAVEGETGKVYRANFHDRDGRTVLILRPGKQNTTSLDNQLRHLVYMIENAILNLPEDQEQMVWLIDFTGWSLSTSVPIKSARDTINVLQNHYPERLAMAVLYNPPRIFEAFWKIVKYFLDAKTFQKVKFVYPKNKESVELMRSYFDEENLPTDFGGKAILEYNHEEFSKQMVQDDIKSATLWGFDNKLQST---GTNQSGPEITPEPICLAPAAS 1205
            MF RWS+SHH++++DSLQ ESKV EL+ A+ PLS R LKYC DACLRRYLEARNWN+D +KKML +TLKWRS +KPEEI W E+A EGETGKVYRA+FHDR GR+VLILRPG QNT SLD+Q+RHLVY+IENAILNLPE QEQM WLIDFTGWSLS +VPIKSAR++IN+LQNHYPERLA+A LYNPPRIFEAFWK+VKYF++AKTFQKVKFVYPKNK+SVELMRS+FDEENLPT+FGG+A L+Y+HEEFS+ M QDDIK+A+LWGFD + +     G   SG E+ PEP+ +AP AS
Sbjct:    1 MFRRWSNSHHSEEDDSLQFESKVNELKTAMGPLSGRSLKYCDDACLRRYLEARNWNIDNAKKMLADTLKWRSAFKPEEISWEEVANEGETGKVYRASFHDRYGRSVLILRPGMQNTQSLDDQMRHLVYLIENAILNLPEGQEQMAWLIDFTGWSLSNNVPIKSARESINILQNHYPERLAVAFLYNPPRIFEAFWKVVKYFMEAKTFQKVKFVYPKNKDSVELMRSFFDEENLPTEFGGRAKLKYDHEEFSRLMAQDDIKAASLWGFDRQPEKAFRDGNKHSGAEVAPEPVGVAPPAS 298          
The following BLAST results are available for this feature:
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-01 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
RSC5_DICDI1.003e-3132.22Random slug protein 5 OS=Dictyostelium discoideum ... [more]
YJX4_SCHPO3.291e-3034.88CRAL-TRIO domain-containing protein C23B6.04c OS=S... [more]
PDR16_YEAST2.199e-2730.99Phosphatidylinositol transfer protein PDR16 OS=Sac... [more]
PDR17_YEAST5.701e-2733.81Phosphatidylinositol transfer protein PDR17 OS=Sac... [more]
RETM_DROME2.852e-1828.98Protein real-time OS=Drosophila melanogaster GN=re... [more]
RETM_DROPS3.338e-1829.55Protein real-time OS=Drosophila pseudoobscura pseu... [more]
SEC14_CANGA1.507e-1729.26SEC14 cytosolic factor OS=Candida glabrata (strain... [more]
SEC14_ASHGO2.197e-1730.00SEC14 cytosolic factor OS=Ashbya gossypii (strain ... [more]
SEC14_KLULA6.249e-1729.80SEC14 cytosolic factor OS=Kluyveromyces lactis (st... [more]
SEC14_YARLI1.294e-1630.80SEC14 cytosolic factor OS=Yarrowia lipolytica (str... [more]

Pages

back to top
BLAST of g.barbadense_cottongen_reftransV1_0092016 vs. ExPASy TrEMBL
Analysis Date: 2016-11-02 (Homology Analysis for Gossypium barbadense CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2U6Y6_GOSRA0.000e+099.32Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0P6U1_GOSAR0.000e+096.61Cral-trio domain-containing c23b6.04c OS=Gossypium... [more]
A0A0D2TN34_GOSRA0.000e+086.44Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0P2Z4_GOSAR0.000e+086.10Random slug 5 OS=Gossypium arboreum GN=F383_23926 ... [more]
A0A061FCY0_THECC0.000e+086.10Sec14p-like phosphatidylinositol transfer family p... [more]
M5XYV3_PRUPE1.824e-16576.27Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
A0A067KQT3_JATCU3.706e-16576.87Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
V4T4X8_9ROSI1.892e-16480.43Uncharacterized protein OS=Citrus clementina GN=CI... [more]
F6H1I3_VITVI2.100e-16475.93Putative uncharacterized protein OS=Vitis vinifera... [more]
A0A059BNP3_EUCGR2.260e-16374.16Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium barbadense CottonGen RefTrans V1
Date Performed: 2016-11-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001251CRAL-TRIO lipid binding domainSMARTSM00516sec14_4coord: 87..242
e-value: 1.2E-48
score: 177.6
IPR001251CRAL-TRIO lipid binding domainGENE3D3.40.525.10coord: 69..258
e-value: 6.5E-49
score: 165.7
IPR001251CRAL-TRIO lipid binding domainPFAMPF00650CRAL_TRIOcoord: 87..240
e-value: 1.4E-38
score: 131.9
IPR001251CRAL-TRIO lipid binding domainPROSITEPS50191CRAL_TRIOcoord: 81..245
score: 20.894
IPR001251CRAL-TRIO lipid binding domainSUPERFAMILY52087CRAL/TRIO domaincoord: 81..259
IPR011074CRAL/TRIO, N-terminal domainSMARTSM01100CRAL_TRIO_N_2coord: 42..67
e-value: 6.0E-8
score: 42.4
IPR011074CRAL/TRIO, N-terminal domainPFAMPF03765CRAL_TRIO_Ncoord: 41..66
e-value: 1.2E-6
score: 28.4
IPR011074CRAL/TRIO, N-terminal domainSUPERFAMILY46938CRAL/TRIO N-terminal domaincoord: 13..83
NoneNo IPR availableGENE3D1.10.8.20coord: 13..68
e-value: 9.1E-15
score: 54.0
NoneNo IPR availablePANTHERPTHR10174:SF151SUBFAMILY NOT NAMEDcoord: 9..269
NoneNo IPR availablePANTHERPTHR10174RETINALDEHYDE BINDING PROTEIN-RELATEDcoord: 9..269

Sequences
The following sequences are available for this feature:

contig sequence

>g.barbadense_cottongen_reftransV1_0092016 ID=g.barbadense_cottongen_reftransV1_0092016|Name=g.barbadense_cottongen_reftransV1_0092016|organism=Gossypium barbadense|type=contig|length=1941bp
AAATAAAAAAAATACTCACCTTACGACAATGCAACTAAAAAAATGACATT
GTAATAAATCTGAATTTAACAAAATAATTTTAACAATGTTAACGATCGTA
CCTGAATTTTGAAATCTTAAAAATAAAGGACTAAATTTATAGAAATAAAA
GCACAAAAAAATTAAATTCTAAATTTACGAAAAGTACAAAATTTGTAACA
TATTTTAACCCACCAAATAATGATTTTTTGGAGTAAAAACCAAAGCTGAA
AATTTATACCTCATGTCCCTTAAAAGGCTATATATATTTGTTACATAATA
AGCCAAGGGCGGTTAGATCAACTAGCTGCCGGTGCGAGACAGATTGGCTC
GGGTGTTATCTCGGGTCCAGACTGATTCGTACCGGTAGATTGAAGTTTAT
TATCAAATCCCCACAATGTGGCGGATTTAATATCATCTTGGACCATTTGC
TTTGAGAATTCTTCATGGTTATATTCCAATATGGCTTTTCCTCCAAAATC
TGTTGGGAGATTTTCTTCATCAAAATAGGATCTCATTAGCTCCACACTTT
CTTTGTTTTTAGGGTACACAAATTTCACCTTTTGGAAGGTTTTGGCATCG
AGGAAATATTTAACAATCTTCCAAAATGCTTCGAAAATTCTTGGCGGATT
GTATAGAACCGCCATCGCCAACCTTTCGGGATAGTGGTTTTGTAACACGT
TAATGGTGTCGCGAGCGGACTTGATTGGAACACTCGTGCTCAAGCTCCAG
CCGGTGAAATCTATCAACCATACCATCTGTTCTTGATCCTCTGGAAGGTT
TAATATAGCATTCTCAATCATATACACCAAATGACGGAGCTGATTGTCTA
AGGATGTAGTGTTCTGTTTTCCCGGTCGCAATATAAGAACAGTCCTACCG
TCTCGGTCGTGAAAATTTGCTCGGTATACTTTTCCAGTCTCGCCTTCTAC
TGCAATTTCATGCCAACGTATTTCCTCAGGCTTATAGGTTGATCTCCATT
TGAGTGTCTCTTCCAGCATTTTCTTCGATTTGTCGACATTCCAGTTTCGT
GCCTCCAAGTATCTCCTCAAGCAAGCATCGGTGCAATATTTCAAACCGCG
GTCGGATAGTGGTCTGAGTGCGGCTCTAAGCTCCTTAACCTTAGATTCAT
GCTGCAATGAATCATTCTGTTGGTTATGATGAGAATGGCTCCATCTACTA
AACATTGTGACTGATGCTAGAAATCTAGCAAAAACCTAGTGCAACCTGCA
AAACATTGCATAACACTAAATTGGAACTAATTATTAAGAATTAAACAATC
TCAAAGAAAACCAGACAAGTTGAGAGGAGATGACTCTTTCCAGGGAAATT
TGTAAAGTGTTGTCTATCCAGAGTAACAGACCCCTCAAGGGATAGGTATA
GTACTCGAATCAAGCCGAGGTTCACAGAATGAGTGCTTTAGGCAGACCAC
ACTTTTGGAGACTTCTTCATATGGAGTTAACCTATGGAACACAGACGAAA
TCTTAGGACATTAAACTTTGTATAAACGACCAGAAAAAGAGCCAACCTTC
CTTGAGTCTTGCCTGAGAAAAGAAACAGAGCAAAGACACTACTAAGCTTA
AAAGACAAGAAAAAGGGTTTGATCACTTGATGTTGATTTTTTTTTATCAC
TAAAGTAGCATGGAATTCTTCAACATGCCAAAACCAGTAAGTGAGTAGGT
ATGGCTTTTTATGGTTTTTTGGTCCAGAGATATTTCTTAAAAAAGAGTAG
CAAAAGGTGCACGGTATTCGTGGTAAAGGAGACTTGGTTGATGTTTTATG
GGTTTAGATTTTTCGGACAGGTGTTAAGGCCAAATGTTATTGCTGTCAAT
TTTATGACAGATTTGCAGGAAGCAGAACCTATAATTTTATGGTGAAGAAA
AACTCTTCATTTTCAGATTTCAGACAGAGAGTAGACAACAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR001251CRAL-TRIO_dom
IPR011074CRAL/TRIO_N_dom