rpoC1, NC_016692.1-rpoC1.m13 (mRNA) Gossypium herbaceum

Overview
NamerpoC1
Unique NameNC_016692.1-rpoC1.m13
TypemRNA
OrganismGossypium herbaceum (Cotton (G. herbaceum))
Cross References
External references for this mRNA
DatabaseAccession
GIGeneID:11539547
nuccoreNC_016692.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
rpoC1NC_016692.1-rpoC1Gossypium herbaceumgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
rpoC1rpoC1Gossypium herbaceumgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
NC_016692.1-rpoC1.m13-cds1NC_016692.1-rpoC1.m13-cds1Gossypium herbaceumCDS
NC_016692.1-rpoC1.m13-cds2NC_016692.1-rpoC1.m13-cds2Gossypium herbaceumCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
rpoC1NC_016692.1-rpoC1.p13Gossypium herbaceumpolypeptide


Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Cotton Data2019-03-14
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
NC_016692regionNC_016692:21613..24423 -
Properties
Property NameValue
ProductRNA polymerase beta' subunit
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>NC_016692.1-rpoC1.m13 ID=NC_016692.1-rpoC1.m13|Name=rpoC1|organism=Gossypium herbaceum|type=mRNA|length=2058bp
atgatcgaccgatataaacatcaacaactccgaattggatcagtttctcc
ccaacaaataagtgcttgggccaagaaaatcctacctaatggagaaaccg
ttggagaggtgacaaaaccctatacttttcattacaaaaccaataaaccg
gaaaaggatggattattttgtgaaagaatttttggacctataaaaagtgg
aatttgcgcttgtggaaattatcgagtaattggaaatcaaaaggagggcc
ctaaattttgtgaacaatgcggagttgaatttgttgattctcggatacga
agatatcaaatgggatacataaggctggcatgtccagtaactcatgtatg
gtatttgaaacgtcttcctagttatatcgccaatcttttagacaaacctc
ttaaagaattagagggtctagtatactgcgatttttcttttgctaggccc
atcgctaaaaaacctactttcttacgattacgaggttcattcgaatatga
aattcaatcctggaaatacagtatcccacttttttttactacccaaggtt
tcgatacatttcgaagtcgcgaaatttctaccggagcaggtgctattcga
gaacaattagccgatctagatttgcgaattcttatcgattattcggtggt
agaatggaaagaattaggagaagaaggcctcacgggtaatgaatgggaag
atcgaaaaattggaagaagaaaggattttttggttagacgcatggaattg
gctaagcattttattcgaacaaatatagaaccagaatggatggttttatg
tctattaccggttcttcctcccgagttgagaccgatcattcagatagatg
ggggtaaactaatgagttcggatattaatgaactctatagaagagttatc
tatcgaaataatactcttaccgatctattaacaacaagtagatctacgcc
aggggaattagtaatgtgtcaggaaaaattggtacaagaagccgtggata
cacttcttgataatggaatccgcggacaaccaatgagggacggtcataat
aaggtttacaagtcgttttcagatgtaattgaaggcaaagagggaagatt
tcgcgagactttgcttggcaaacgagtcgattattcgggacgttctgtca
ttgttgttggcccctcactttcattacatcgctgtggattgcctcgcgaa
atagcaatagagcttttccagacatttgtaattcgcggtctaattagaca
acatcttgctccgaacataggagttgctaagagtaaaattcgggaaaaag
ggccgattgtatgggaaatactgcaagaagttatgcggggacatcctgta
ttgctgaatagagcgcctactctgcatagattaggtatacaggcattcca
acctattttagtggaaggacgcgctatttgtttacatccattagtttgta
agggattcaatgcagactttgatggggatcaaatggcagttcatgtacct
ttatctttagaggcgcaagcggaggctcgtttacttatgttttctcatat
gaatctcttgtctccagctattggggatcccatttccgtacctactcaag
atatgcttattgggctctatgtattaacgagtgggaatcgtcgaggtatt
tgtgcgaataggtataatccatggaatcgaaaaagctatcaaaatgaaag
aattgacgataataactataagtctacaagggagccttttttttgtaatt
cctatgatgcgattggagcttataggcagaaaagaatcaatttagatagt
cctttgtggctccggtggcgactagagcaatgcgttattgcttcaagaga
agctcccatcgaagttcactatgaatcttcgggtacctatcatgagattt
atggacattatctaatagtaagaagtttaaaaaaaaaaattctttgtata
tacattcgaaccactgttggtcatatttctctttaccgagaaatcgaaga
agctatacaagggttttttcgggcctactcatatgatacccaatcatatg
gtatctaa
back to top

protein sequence of rpoC1

>NC_016692.1-rpoC1.p13 ID=NC_016692.1-rpoC1.p13|Name=rpoC1|organism=Gossypium herbaceum|type=polypeptide|length=685bp
MIDRYKHQQLRIGSVSPQQISAWAKKILPNGETVGEVTKPYTFHYKTNKP
EKDGLFCERIFGPIKSGICACGNYRVIGNQKEGPKFCEQCGVEFVDSRIR
RYQMGYIRLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFARP
IAKKPTFLRLRGSFEYEIQSWKYSIPLFFTTQGFDTFRSREISTGAGAIR
EQLADLDLRILIDYSVVEWKELGEEGLTGNEWEDRKIGRRKDFLVRRMEL
AKHFIRTNIEPEWMVLCLLPVLPPELRPIIQIDGGKLMSSDINELYRRVI
YRNNTLTDLLTTSRSTPGELVMCQEKLVQEAVDTLLDNGIRGQPMRDGHN
KVYKSFSDVIEGKEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPRE
IAIELFQTFVIRGLIRQHLAPNIGVAKSKIREKGPIVWEILQEVMRGHPV
LLNRAPTLHRLGIQAFQPILVEGRAICLHPLVCKGFNADFDGDQMAVHVP
LSLEAQAEARLLMFSHMNLLSPAIGDPISVPTQDMLIGLYVLTSGNRRGI
CANRYNPWNRKSYQNERIDDNNYKSTREPFFCNSYDAIGAYRQKRINLDS
PLWLRWRLEQCVIASREAPIEVHYESSGTYHEIYGHYLIVRSLKKKILCI
YIRTTVGHISLYREIEEAIQGFFRAYSYDTQSYGI
back to top

mRNA from alignment at NC_016692:21613..24423-

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>NC_016692.1-rpoC1.m13 ID=NC_016692.1-rpoC1.m13|Name=rpoC1|organism=Gossypium herbaceum|type=mRNA|length=2811bp|location=Sequence derived from alignment at NC_016692:21613..24423- (Gossypium herbaceum)
ATGATCGACCGATATAAACATCAACAACTCCGAATTGGATCAGTTTCTCC CCAACAAATAAGTGCTTGGGCCAAGAAAATCCTACCTAATGGAGAAACCG TTGGAGAGGTGACAAAACCCTATACTTTTCATTACAAAACCAATAAACCG GAAAAGGATGGATTATTTTGTGAAAGAATTTTTGGACCTATAAAAAGTGG AATTTGCGCTTGTGGAAATTATCGAGTAATTGGAAATCAAAAGGAGGGCC CTAAATTTTGTGAACAATGCGGAGTTGAATTTGTTGATTCTCGGATACGA AGATATCAAATGGGATACATAAGGCTGGCATGTCCAGTAACTCATGTATG GTATTTGAAACGTCTTCCTAGTTATATCGCCAATCTTTTAGACAAACCTC TTAAAGAATTAGAGGGTCTAGTATACTGCGATGTGTGATTTGATCGAAAT TATTATTTTACAGATTAGGAATGAGAAACTGTCATCCCATTCAATCGAAT TGGGATGCCCTGGATCTGACATGTCTCTTGGGAAGAGTAACATGAAGCTC AGAATTATGGGCGTATTCAATACTCCCAAATAAAAAGGGAATTGGTCTAT GGTCGAGTCAGTAAAAATAAATAACTAGGAATTTTGAGTTGTACCTCGTG AAAAAAAGACTTCTTTTTTTGTGGAATTAACCGTTCTCATTTCTTTTAGT TCTTTTAGAAAGAAATGAAATTATGTTCAAGGAAACAAATATGTCATGGT TGCAGGAGTCTATACATCGCATATAGGCTTAGGCTTTAAGTTAAGGGCAT CGTGGTATAATCGTCGAGGTACCGCAGGACCTAAGAGATCGAATGGAAGG GTACATAGACAAGTAAATCCCTTATGACACTCCTTTAATTTAAGAGGATT CAGCATTCGAGGGGAAGTAGACTACTCAAGAATTTCACATTTCATTTATG TCCTAATTTTGAATTGAATAAAGAATTAAGAAAATCTAAATCAATAAAAG AAGAATCAATCAATGAAATGTTTCTTGGAACTTGAGTAAAGAGTAGACCT TTTTGGGGGGGTTCTAGAATTTGAAAGCGAGAACTCCTTTACTTTATCTT TATTTGGTGTAACTACTTGAGCCGGATGAGAGGAAACTCTCATGTCCGAT TTTGAGGGGGGGATCCCGCAGGGCCCTATCCTAATTTTTCTTTTGCTAGG CCCATCGCTAAAAAACCTACTTTCTTACGATTACGAGGTTCATTCGAATA TGAAATTCAATCCTGGAAATACAGTATCCCACTTTTTTTTACTACCCAAG GTTTCGATACATTTCGAAGTCGCGAAATTTCTACCGGAGCAGGTGCTATT CGAGAACAATTAGCCGATCTAGATTTGCGAATTCTTATCGATTATTCGGT GGTAGAATGGAAAGAATTAGGAGAAGAAGGCCTCACGGGTAATGAATGGG AAGATCGAAAAATTGGAAGAAGAAAGGATTTTTTGGTTAGACGCATGGAA TTGGCTAAGCATTTTATTCGAACAAATATAGAACCAGAATGGATGGTTTT ATGTCTATTACCGGTTCTTCCTCCCGAGTTGAGACCGATCATTCAGATAG ATGGGGGTAAACTAATGAGTTCGGATATTAATGAACTCTATAGAAGAGTT ATCTATCGAAATAATACTCTTACCGATCTATTAACAACAAGTAGATCTAC GCCAGGGGAATTAGTAATGTGTCAGGAAAAATTGGTACAAGAAGCCGTGG ATACACTTCTTGATAATGGAATCCGCGGACAACCAATGAGGGACGGTCAT AATAAGGTTTACAAGTCGTTTTCAGATGTAATTGAAGGCAAAGAGGGAAG ATTTCGCGAGACTTTGCTTGGCAAACGAGTCGATTATTCGGGACGTTCTG TCATTGTTGTTGGCCCCTCACTTTCATTACATCGCTGTGGATTGCCTCGC GAAATAGCAATAGAGCTTTTCCAGACATTTGTAATTCGCGGTCTAATTAG ACAACATCTTGCTCCGAACATAGGAGTTGCTAAGAGTAAAATTCGGGAAA AAGGGCCGATTGTATGGGAAATACTGCAAGAAGTTATGCGGGGACATCCT GTATTGCTGAATAGAGCGCCTACTCTGCATAGATTAGGTATACAGGCATT CCAACCTATTTTAGTGGAAGGACGCGCTATTTGTTTACATCCATTAGTTT GTAAGGGATTCAATGCAGACTTTGATGGGGATCAAATGGCAGTTCATGTA CCTTTATCTTTAGAGGCGCAAGCGGAGGCTCGTTTACTTATGTTTTCTCA TATGAATCTCTTGTCTCCAGCTATTGGGGATCCCATTTCCGTACCTACTC AAGATATGCTTATTGGGCTCTATGTATTAACGAGTGGGAATCGTCGAGGT ATTTGTGCGAATAGGTATAATCCATGGAATCGAAAAAGCTATCAAAATGA AAGAATTGACGATAATAACTATAAGTCTACAAGGGAGCCTTTTTTTTGTA ATTCCTATGATGCGATTGGAGCTTATAGGCAGAAAAGAATCAATTTAGAT AGTCCTTTGTGGCTCCGGTGGCGACTAGAGCAATGCGTTATTGCTTCAAG AGAAGCTCCCATCGAAGTTCACTATGAATCTTCGGGTACCTATCATGAGA TTTATGGACATTATCTAATAGTAAGAAGTTTAAAAAAAAAAATTCTTTGT ATATACATTCGAACCACTGTTGGTCATATTTCTCTTTACCGAGAAATCGA AGAAGCTATACAAGGGTTTTTTCGGGCCTACTCATATGATACCCAATCAT ATGGTATCTAA
back to top

Coding sequence (CDS) from alignment at NC_016692:21613..24423-

>NC_016692.1-rpoC1.m13 ID=NC_016692.1-rpoC1.m13|Name=rpoC1|organism=Gossypium herbaceum|type=CDS|length=2058bp|location=Sequence derived from alignment at NC_016692:21613..24423- (Gossypium herbaceum)
ATGATCGACCGATATAAACATCAACAACTCCGAATTGGATCAGTTTCTCC
CCAACAAATAAGTGCTTGGGCCAAGAAAATCCTACCTAATGGAGAAACCG
TTGGAGAGGTGACAAAACCCTATACTTTTCATTACAAAACCAATAAACCG
GAAAAGGATGGATTATTTTGTGAAAGAATTTTTGGACCTATAAAAAGTGG
AATTTGCGCTTGTGGAAATTATCGAGTAATTGGAAATCAAAAGGAGGGCC
CTAAATTTTGTGAACAATGCGGAGTTGAATTTGTTGATTCTCGGATACGA
AGATATCAAATGGGATACATAAGGCTGGCATGTCCAGTAACTCATGTATG
GTATTTGAAACGTCTTCCTAGTTATATCGCCAATCTTTTAGACAAACCTC
TTAAAGAATTAGAGGGTCTAGTATACTGCGATTTTTCTTTTGCTAGGCCC
ATCGCTAAAAAACCTACTTTCTTACGATTACGAGGTTCATTCGAATATGA
AATTCAATCCTGGAAATACAGTATCCCACTTTTTTTTACTACCCAAGGTT
TCGATACATTTCGAAGTCGCGAAATTTCTACCGGAGCAGGTGCTATTCGA
GAACAATTAGCCGATCTAGATTTGCGAATTCTTATCGATTATTCGGTGGT
AGAATGGAAAGAATTAGGAGAAGAAGGCCTCACGGGTAATGAATGGGAAG
ATCGAAAAATTGGAAGAAGAAAGGATTTTTTGGTTAGACGCATGGAATTG
GCTAAGCATTTTATTCGAACAAATATAGAACCAGAATGGATGGTTTTATG
TCTATTACCGGTTCTTCCTCCCGAGTTGAGACCGATCATTCAGATAGATG
GGGGTAAACTAATGAGTTCGGATATTAATGAACTCTATAGAAGAGTTATC
TATCGAAATAATACTCTTACCGATCTATTAACAACAAGTAGATCTACGCC
AGGGGAATTAGTAATGTGTCAGGAAAAATTGGTACAAGAAGCCGTGGATA
CACTTCTTGATAATGGAATCCGCGGACAACCAATGAGGGACGGTCATAAT
AAGGTTTACAAGTCGTTTTCAGATGTAATTGAAGGCAAAGAGGGAAGATT
TCGCGAGACTTTGCTTGGCAAACGAGTCGATTATTCGGGACGTTCTGTCA
TTGTTGTTGGCCCCTCACTTTCATTACATCGCTGTGGATTGCCTCGCGAA
ATAGCAATAGAGCTTTTCCAGACATTTGTAATTCGCGGTCTAATTAGACA
ACATCTTGCTCCGAACATAGGAGTTGCTAAGAGTAAAATTCGGGAAAAAG
GGCCGATTGTATGGGAAATACTGCAAGAAGTTATGCGGGGACATCCTGTA
TTGCTGAATAGAGCGCCTACTCTGCATAGATTAGGTATACAGGCATTCCA
ACCTATTTTAGTGGAAGGACGCGCTATTTGTTTACATCCATTAGTTTGTA
AGGGATTCAATGCAGACTTTGATGGGGATCAAATGGCAGTTCATGTACCT
TTATCTTTAGAGGCGCAAGCGGAGGCTCGTTTACTTATGTTTTCTCATAT
GAATCTCTTGTCTCCAGCTATTGGGGATCCCATTTCCGTACCTACTCAAG
ATATGCTTATTGGGCTCTATGTATTAACGAGTGGGAATCGTCGAGGTATT
TGTGCGAATAGGTATAATCCATGGAATCGAAAAAGCTATCAAAATGAAAG
AATTGACGATAATAACTATAAGTCTACAAGGGAGCCTTTTTTTTGTAATT
CCTATGATGCGATTGGAGCTTATAGGCAGAAAAGAATCAATTTAGATAGT
CCTTTGTGGCTCCGGTGGCGACTAGAGCAATGCGTTATTGCTTCAAGAGA
AGCTCCCATCGAAGTTCACTATGAATCTTCGGGTACCTATCATGAGATTT
ATGGACATTATCTAATAGTAAGAAGTTTAAAAAAAAAAATTCTTTGTATA
TACATTCGAACCACTGTTGGTCATATTTCTCTTTACCGAGAAATCGAAGA
AGCTATACAAGGGTTTTTTCGGGCCTACTCATATGATACCCAATCATATG
GTATCTAA
back to top