rpoC2, NC_016692.1-rpoC2.m12 (mRNA) Gossypium herbaceum

Overview
NamerpoC2
Unique NameNC_016692.1-rpoC2.m12
TypemRNA
OrganismGossypium herbaceum (Cotton (G. herbaceum))
Cross References
External references for this mRNA
DatabaseAccession
GIGeneID:11539543
nuccoreNC_016692.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
rpoC2NC_016692.1-rpoC2Gossypium herbaceumgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
rpoC2rpoC2Gossypium herbaceumgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
NC_016692.1-rpoC2.m12-cds1NC_016692.1-rpoC2.m12-cds1Gossypium herbaceumCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
rpoC2NC_016692.1-rpoC2.p12Gossypium herbaceumpolypeptide


Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Cotton Data2019-03-14
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
NC_016692regionNC_016692:17264..21445 -
Properties
Property NameValue
ProductRNA polymerase beta'' subunit
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>NC_016692.1-rpoC2.m12 ID=NC_016692.1-rpoC2.m12|Name=rpoC2|organism=Gossypium herbaceum|type=mRNA|length=4182bp
atggcagaacgggccaatctggtatttcacaataaagtgatagatggaac
tgccattaaacggcttattagcagattaatagatcacttcggaatggcat
atacatcacacatcctggatcaagtaaaagctctgggtttccagcaagcc
actgctacatccatttcattaggaattgatgatcttttaacgataccttc
taagggatggctagtccaagatgctgaacaacaaagtttgattttggaaa
aacaccatcattttgggaatgtacacgcggtagaaaaattacgccaatca
attgagatatggtatgctacaagtgaatatttgcgacaagaaatgaatcc
taattttaggatgactgacccgtttaacccagtccatataatgtcttttt
caggagctagaggaaatgcatctcaagtgcaccaattagtaggtatgaga
ggattaatgtcggatccccaaggacaaatgatcgatttacccattcaaag
caatttacgcgaaggactgtctttaacagaatatatcatttcttgctacg
gagcccgaaaaggggttgtggataccgccgtacgaacatcagatgctgga
tatcttacgcgcagacttgttgaagtagttcaacacattgttgtacgtag
aacagattgtggcaccacccgagggatttctgtgagtcctcaaaagagga
cgcttccggaaagaatttttatccaaacattaattggtcgtgtattagcg
gacgatatatatatgggtccgcggtgcattgccattcgaaatcaagatat
tgggcttgggcttgtcgatcgattcagagcctttcgaacacaaccaatat
ctattcgaactccctttacttgtaggagtacatcttggatttgtcgatta
tgttatggtcggagccccactcatggtgacctggttgaattgggagaagc
tgtaggtattattgcggggcaatccattggagaaccgggaacgcaactaa
cattaagaacttttcataccggcggagtatttacagggggtactgcagaa
catgtccgagccccttttaatggaaaaataaaattcaatgaggatttggt
tcatcctacacgcacacgtcacgggcatcctgcttttttatgttatcggg
acttgtatgtaattattgagagtgaagatattatacataaggtgactatt
ccaccaaaaagttttcttttagttcaaaacgatcaatatgtagaatcaga
acaagtgattgctgagattcgcgcgggaacatacactttaaatttgaaag
agagggttcgaaaacatatttattctgactcagagggggaaatgcactgg
agtaccgatgtgtaccattcgcccgaatttacatatagtaatgtccatct
cttaccaaaaacaagccatttgtggatattatcagggggttcgtacaaat
tcagtgtagttcctttttcgctccacaaggatcaagatcaaataaacatt
cattatctttctgccgaacgaagatatatttctagattctcagtgaataa
tgatcaagtgagacacaacttatttagttcggatttttcggataaaaaag
aagagaggatttacgattattcagaattgaatcgaataataggtactggg
cattgtgatttcatatattctgctattctccacgagaatgctgatttatt
ggcaaagagacgaagaaatagatttattattccatttcaattgattcaag
accaagagaaagaactaatgctacattcccattccggtatctcgatggaa
atacccataaatggtattttccgtagaaaaagtattcttgctttttttga
cgatcctcgatacagaagaaagagttcaggaattactaaatatgggactc
taggggcgcattcaatcgtcaaaagggaggatgtgattgagtatcgagga
gtcaaaaaggttaagccaaaataccaaatgaaagtagatcgatttttttt
cattcccgaggaagtgcatattttatccgaatcttcttccataatggtac
ggaacaatagtatcattggagtagataccccaatcactttaaatacaaga
agccaagtgggcggattggtccgagtggaaagaaaaaaaaaaaggattga
actgaaaattttttcgggtaatatctattttcccggagaaagagataaga
tatctcgacacagtggcatcttgataccaccaggaacgggcaaaacaaac
tctaaggaatcaaaaaaattgaaaaaatggatctatgtccaacggatcac
acctaccaagaaaaagtattttgttttggttcgacctgtaaccccatatg
aaataccggacggtctaaatttagcaacactcttcccccaggatccattt
caggaaaaagataatatgcaacttcgagctgtcaattatatcctttatgg
aaatggcaaaccgactcggagaatttctgacacaagtattcaactagttc
ggacttgtttagtgttgagttgggaccaagacaacaaaagttctttcgcc
gaagaggtctgtgcttcctttgttgaagtaaggacaaatggtctgattcg
agatttcctaagaatcgacttagtgaaatctcatattttttatatcagaa
aaagaaatgatccgtcaggttcagaattgatttctgataataggtcagat
cgtaccaataaaaatccgttttattccatttattccaacgcaaggattca
acaatcgtttagccaaaatcacggaactattcatacgctcttgaacagaa
ataaggaatcccaatctttgataattttgtcagcatctaattgttttcgc
atgggcccattcaacgatgtaaaatatcacaatgtgataaaacaatcaat
taaaaaagatcctctaattccaattaagaatttattgggtcctttaggaa
cagcccccaaaattgcgaatttttattcatcattttaccctttaataact
cataatcagacctcggtagcgaaatattttgagcttgacaatttaaaaca
ggcttttcaagtacttaactattatttaatagctgaaaatgggagaattt
ataatttcgatccatgccgtaacatctttttgaatgcagtcaatttgaat
tggtattttccccatcatcattatcatcataattattgtgaagaaacgtc
cacaataattagtcttgggcagtttatttgtgaaaatgtatgtatagcca
aaagcggaccacgcctaaaatcgggtcaagtttttattgttcaagctgat
tctatagtaataagatcggctaagccttatttggcgactccgggagcaac
tgtccatgggcattatggagaaaccctttacgaaggagatacgttagtta
catttatatatgaaaaatcgagatctggtgatataacgcagggtcttcca
aaagtggaacaagtgttagaagtgcgttcgattgattcaatatcgatgaa
cctagaaaagagaattgagggttggaacgaatgtataacaagaattcttg
gaattccttggggattcgtgattggtgctgagctaactatagtgcaaagt
cgtctctctttggttaataagatccaaaaggtttatcgatctcagggggt
acagatccataataggcatatagaaattattgtacgtcaaataacatcaa
aagtattggtttcagaagatggaatgtctaatgtttttttacccggggaa
ctgattggattattgcgagcggaacgaacggggcgtgctttagaagaagc
gatttgttatcgagccgttttattgggaataacgagagcatctctgaaca
ctcaaagttttatatctgaagcaagttttcaagaaactgctcgagtttta
gcaaaagctgctctccggggtcgtatcgattggttgaaaggcctgaaaga
aaacgttgtgcttgggggtatgatacccgccggtaccggattcaaaggat
tagtgcaccggtcacggcaacataacaacattcttttggaaacaaaaaaa
aagaatttcttcgggggagaaatgagagatattttcttccaccaccgaga
attatttgactcttgcatttcaaacaatttacatgatacatcaggccgct
cttttataggtatagaatttaatgattcttaa
back to top

protein sequence of rpoC2

>NC_016692.1-rpoC2.p12 ID=NC_016692.1-rpoC2.p12|Name=rpoC2|organism=Gossypium herbaceum|type=polypeptide|length=1393bp
MAERANLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKALGFQQA
TATSISLGIDDLLTIPSKGWLVQDAEQQSLILEKHHHFGNVHAVEKLRQS
IEIWYATSEYLRQEMNPNFRMTDPFNPVHIMSFSGARGNASQVHQLVGMR
GLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGARKGVVDTAVRTSDAG
YLTRRLVEVVQHIVVRRTDCGTTRGISVSPQKRTLPERIFIQTLIGRVLA
DDIYMGPRCIAIRNQDIGLGLVDRFRAFRTQPISIRTPFTCRSTSWICRL
CYGRSPTHGDLVELGEAVGIIAGQSIGEPGTQLTLRTFHTGGVFTGGTAE
HVRAPFNGKIKFNEDLVHPTRTRHGHPAFLCYRDLYVIIESEDIIHKVTI
PPKSFLLVQNDQYVESEQVIAEIRAGTYTLNLKERVRKHIYSDSEGEMHW
STDVYHSPEFTYSNVHLLPKTSHLWILSGGSYKFSVVPFSLHKDQDQINI
HYLSAERRYISRFSVNNDQVRHNLFSSDFSDKKEERIYDYSELNRIIGTG
HCDFIYSAILHENADLLAKRRRNRFIIPFQLIQDQEKELMLHSHSGISME
IPINGIFRRKSILAFFDDPRYRRKSSGITKYGTLGAHSIVKREDVIEYRG
VKKVKPKYQMKVDRFFFIPEEVHILSESSSIMVRNNSIIGVDTPITLNTR
SQVGGLVRVERKKKRIELKIFSGNIYFPGERDKISRHSGILIPPGTGKTN
SKESKKLKKWIYVQRITPTKKKYFVLVRPVTPYEIPDGLNLATLFPQDPF
QEKDNMQLRAVNYILYGNGKPTRRISDTSIQLVRTCLVLSWDQDNKSSFA
EEVCASFVEVRTNGLIRDFLRIDLVKSHIFYIRKRNDPSGSELISDNRSD
RTNKNPFYSIYSNARIQQSFSQNHGTIHTLLNRNKESQSLIILSASNCFR
MGPFNDVKYHNVIKQSIKKDPLIPIKNLLGPLGTAPKIANFYSSFYPLIT
HNQTSVAKYFELDNLKQAFQVLNYYLIAENGRIYNFDPCRNIFLNAVNLN
WYFPHHHYHHNYCEETSTIISLGQFICENVCIAKSGPRLKSGQVFIVQAD
SIVIRSAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQGLP
KVEQVLEVRSIDSISMNLEKRIEGWNECITRILGIPWGFVIGAELTIVQS
RLSLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVSEDGMSNVFLPGE
LIGLLRAERTGRALEEAICYRAVLLGITRASLNTQSFISEASFQETARVL
AKAALRGRIDWLKGLKENVVLGGMIPAGTGFKGLVHRSRQHNNILLETKK
KNFFGGEMRDIFFHHRELFDSCISNNLHDTSGRSFIGIEFNDS
back to top

mRNA from alignment at NC_016692:17264..21445-

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>NC_016692.1-rpoC2.m12 ID=NC_016692.1-rpoC2.m12|Name=rpoC2|organism=Gossypium herbaceum|type=mRNA|length=4182bp|location=Sequence derived from alignment at NC_016692:17264..21445- (Gossypium herbaceum)
ATGGCAGAACGGGCCAATCTGGTATTTCACAATAAAGTGATAGATGGAAC TGCCATTAAACGGCTTATTAGCAGATTAATAGATCACTTCGGAATGGCAT ATACATCACACATCCTGGATCAAGTAAAAGCTCTGGGTTTCCAGCAAGCC ACTGCTACATCCATTTCATTAGGAATTGATGATCTTTTAACGATACCTTC TAAGGGATGGCTAGTCCAAGATGCTGAACAACAAAGTTTGATTTTGGAAA AACACCATCATTTTGGGAATGTACACGCGGTAGAAAAATTACGCCAATCA ATTGAGATATGGTATGCTACAAGTGAATATTTGCGACAAGAAATGAATCC TAATTTTAGGATGACTGACCCGTTTAACCCAGTCCATATAATGTCTTTTT CAGGAGCTAGAGGAAATGCATCTCAAGTGCACCAATTAGTAGGTATGAGA GGATTAATGTCGGATCCCCAAGGACAAATGATCGATTTACCCATTCAAAG CAATTTACGCGAAGGACTGTCTTTAACAGAATATATCATTTCTTGCTACG GAGCCCGAAAAGGGGTTGTGGATACCGCCGTACGAACATCAGATGCTGGA TATCTTACGCGCAGACTTGTTGAAGTAGTTCAACACATTGTTGTACGTAG AACAGATTGTGGCACCACCCGAGGGATTTCTGTGAGTCCTCAAAAGAGGA CGCTTCCGGAAAGAATTTTTATCCAAACATTAATTGGTCGTGTATTAGCG GACGATATATATATGGGTCCGCGGTGCATTGCCATTCGAAATCAAGATAT TGGGCTTGGGCTTGTCGATCGATTCAGAGCCTTTCGAACACAACCAATAT CTATTCGAACTCCCTTTACTTGTAGGAGTACATCTTGGATTTGTCGATTA TGTTATGGTCGGAGCCCCACTCATGGTGACCTGGTTGAATTGGGAGAAGC TGTAGGTATTATTGCGGGGCAATCCATTGGAGAACCGGGAACGCAACTAA CATTAAGAACTTTTCATACCGGCGGAGTATTTACAGGGGGTACTGCAGAA CATGTCCGAGCCCCTTTTAATGGAAAAATAAAATTCAATGAGGATTTGGT TCATCCTACACGCACACGTCACGGGCATCCTGCTTTTTTATGTTATCGGG ACTTGTATGTAATTATTGAGAGTGAAGATATTATACATAAGGTGACTATT CCACCAAAAAGTTTTCTTTTAGTTCAAAACGATCAATATGTAGAATCAGA ACAAGTGATTGCTGAGATTCGCGCGGGAACATACACTTTAAATTTGAAAG AGAGGGTTCGAAAACATATTTATTCTGACTCAGAGGGGGAAATGCACTGG AGTACCGATGTGTACCATTCGCCCGAATTTACATATAGTAATGTCCATCT CTTACCAAAAACAAGCCATTTGTGGATATTATCAGGGGGTTCGTACAAAT TCAGTGTAGTTCCTTTTTCGCTCCACAAGGATCAAGATCAAATAAACATT CATTATCTTTCTGCCGAACGAAGATATATTTCTAGATTCTCAGTGAATAA TGATCAAGTGAGACACAACTTATTTAGTTCGGATTTTTCGGATAAAAAAG AAGAGAGGATTTACGATTATTCAGAATTGAATCGAATAATAGGTACTGGG CATTGTGATTTCATATATTCTGCTATTCTCCACGAGAATGCTGATTTATT GGCAAAGAGACGAAGAAATAGATTTATTATTCCATTTCAATTGATTCAAG ACCAAGAGAAAGAACTAATGCTACATTCCCATTCCGGTATCTCGATGGAA ATACCCATAAATGGTATTTTCCGTAGAAAAAGTATTCTTGCTTTTTTTGA CGATCCTCGATACAGAAGAAAGAGTTCAGGAATTACTAAATATGGGACTC TAGGGGCGCATTCAATCGTCAAAAGGGAGGATGTGATTGAGTATCGAGGA GTCAAAAAGGTTAAGCCAAAATACCAAATGAAAGTAGATCGATTTTTTTT CATTCCCGAGGAAGTGCATATTTTATCCGAATCTTCTTCCATAATGGTAC GGAACAATAGTATCATTGGAGTAGATACCCCAATCACTTTAAATACAAGA AGCCAAGTGGGCGGATTGGTCCGAGTGGAAAGAAAAAAAAAAAGGATTGA ACTGAAAATTTTTTCGGGTAATATCTATTTTCCCGGAGAAAGAGATAAGA TATCTCGACACAGTGGCATCTTGATACCACCAGGAACGGGCAAAACAAAC TCTAAGGAATCAAAAAAATTGAAAAAATGGATCTATGTCCAACGGATCAC ACCTACCAAGAAAAAGTATTTTGTTTTGGTTCGACCTGTAACCCCATATG AAATACCGGACGGTCTAAATTTAGCAACACTCTTCCCCCAGGATCCATTT CAGGAAAAAGATAATATGCAACTTCGAGCTGTCAATTATATCCTTTATGG AAATGGCAAACCGACTCGGAGAATTTCTGACACAAGTATTCAACTAGTTC GGACTTGTTTAGTGTTGAGTTGGGACCAAGACAACAAAAGTTCTTTCGCC GAAGAGGTCTGTGCTTCCTTTGTTGAAGTAAGGACAAATGGTCTGATTCG AGATTTCCTAAGAATCGACTTAGTGAAATCTCATATTTTTTATATCAGAA AAAGAAATGATCCGTCAGGTTCAGAATTGATTTCTGATAATAGGTCAGAT CGTACCAATAAAAATCCGTTTTATTCCATTTATTCCAACGCAAGGATTCA ACAATCGTTTAGCCAAAATCACGGAACTATTCATACGCTCTTGAACAGAA ATAAGGAATCCCAATCTTTGATAATTTTGTCAGCATCTAATTGTTTTCGC ATGGGCCCATTCAACGATGTAAAATATCACAATGTGATAAAACAATCAAT TAAAAAAGATCCTCTAATTCCAATTAAGAATTTATTGGGTCCTTTAGGAA CAGCCCCCAAAATTGCGAATTTTTATTCATCATTTTACCCTTTAATAACT CATAATCAGACCTCGGTAGCGAAATATTTTGAGCTTGACAATTTAAAACA GGCTTTTCAAGTACTTAACTATTATTTAATAGCTGAAAATGGGAGAATTT ATAATTTCGATCCATGCCGTAACATCTTTTTGAATGCAGTCAATTTGAAT TGGTATTTTCCCCATCATCATTATCATCATAATTATTGTGAAGAAACGTC CACAATAATTAGTCTTGGGCAGTTTATTTGTGAAAATGTATGTATAGCCA AAAGCGGACCACGCCTAAAATCGGGTCAAGTTTTTATTGTTCAAGCTGAT TCTATAGTAATAAGATCGGCTAAGCCTTATTTGGCGACTCCGGGAGCAAC TGTCCATGGGCATTATGGAGAAACCCTTTACGAAGGAGATACGTTAGTTA CATTTATATATGAAAAATCGAGATCTGGTGATATAACGCAGGGTCTTCCA AAAGTGGAACAAGTGTTAGAAGTGCGTTCGATTGATTCAATATCGATGAA CCTAGAAAAGAGAATTGAGGGTTGGAACGAATGTATAACAAGAATTCTTG GAATTCCTTGGGGATTCGTGATTGGTGCTGAGCTAACTATAGTGCAAAGT CGTCTCTCTTTGGTTAATAAGATCCAAAAGGTTTATCGATCTCAGGGGGT ACAGATCCATAATAGGCATATAGAAATTATTGTACGTCAAATAACATCAA AAGTATTGGTTTCAGAAGATGGAATGTCTAATGTTTTTTTACCCGGGGAA CTGATTGGATTATTGCGAGCGGAACGAACGGGGCGTGCTTTAGAAGAAGC GATTTGTTATCGAGCCGTTTTATTGGGAATAACGAGAGCATCTCTGAACA CTCAAAGTTTTATATCTGAAGCAAGTTTTCAAGAAACTGCTCGAGTTTTA GCAAAAGCTGCTCTCCGGGGTCGTATCGATTGGTTGAAAGGCCTGAAAGA AAACGTTGTGCTTGGGGGTATGATACCCGCCGGTACCGGATTCAAAGGAT TAGTGCACCGGTCACGGCAACATAACAACATTCTTTTGGAAACAAAAAAA AAGAATTTCTTCGGGGGAGAAATGAGAGATATTTTCTTCCACCACCGAGA ATTATTTGACTCTTGCATTTCAAACAATTTACATGATACATCAGGCCGCT CTTTTATAGGTATAGAATTTAATGATTCTTAA
back to top

Coding sequence (CDS) from alignment at NC_016692:17264..21445-

>NC_016692.1-rpoC2.m12 ID=NC_016692.1-rpoC2.m12|Name=rpoC2|organism=Gossypium herbaceum|type=CDS|length=4182bp|location=Sequence derived from alignment at NC_016692:17264..21445- (Gossypium herbaceum)
ATGGCAGAACGGGCCAATCTGGTATTTCACAATAAAGTGATAGATGGAAC
TGCCATTAAACGGCTTATTAGCAGATTAATAGATCACTTCGGAATGGCAT
ATACATCACACATCCTGGATCAAGTAAAAGCTCTGGGTTTCCAGCAAGCC
ACTGCTACATCCATTTCATTAGGAATTGATGATCTTTTAACGATACCTTC
TAAGGGATGGCTAGTCCAAGATGCTGAACAACAAAGTTTGATTTTGGAAA
AACACCATCATTTTGGGAATGTACACGCGGTAGAAAAATTACGCCAATCA
ATTGAGATATGGTATGCTACAAGTGAATATTTGCGACAAGAAATGAATCC
TAATTTTAGGATGACTGACCCGTTTAACCCAGTCCATATAATGTCTTTTT
CAGGAGCTAGAGGAAATGCATCTCAAGTGCACCAATTAGTAGGTATGAGA
GGATTAATGTCGGATCCCCAAGGACAAATGATCGATTTACCCATTCAAAG
CAATTTACGCGAAGGACTGTCTTTAACAGAATATATCATTTCTTGCTACG
GAGCCCGAAAAGGGGTTGTGGATACCGCCGTACGAACATCAGATGCTGGA
TATCTTACGCGCAGACTTGTTGAAGTAGTTCAACACATTGTTGTACGTAG
AACAGATTGTGGCACCACCCGAGGGATTTCTGTGAGTCCTCAAAAGAGGA
CGCTTCCGGAAAGAATTTTTATCCAAACATTAATTGGTCGTGTATTAGCG
GACGATATATATATGGGTCCGCGGTGCATTGCCATTCGAAATCAAGATAT
TGGGCTTGGGCTTGTCGATCGATTCAGAGCCTTTCGAACACAACCAATAT
CTATTCGAACTCCCTTTACTTGTAGGAGTACATCTTGGATTTGTCGATTA
TGTTATGGTCGGAGCCCCACTCATGGTGACCTGGTTGAATTGGGAGAAGC
TGTAGGTATTATTGCGGGGCAATCCATTGGAGAACCGGGAACGCAACTAA
CATTAAGAACTTTTCATACCGGCGGAGTATTTACAGGGGGTACTGCAGAA
CATGTCCGAGCCCCTTTTAATGGAAAAATAAAATTCAATGAGGATTTGGT
TCATCCTACACGCACACGTCACGGGCATCCTGCTTTTTTATGTTATCGGG
ACTTGTATGTAATTATTGAGAGTGAAGATATTATACATAAGGTGACTATT
CCACCAAAAAGTTTTCTTTTAGTTCAAAACGATCAATATGTAGAATCAGA
ACAAGTGATTGCTGAGATTCGCGCGGGAACATACACTTTAAATTTGAAAG
AGAGGGTTCGAAAACATATTTATTCTGACTCAGAGGGGGAAATGCACTGG
AGTACCGATGTGTACCATTCGCCCGAATTTACATATAGTAATGTCCATCT
CTTACCAAAAACAAGCCATTTGTGGATATTATCAGGGGGTTCGTACAAAT
TCAGTGTAGTTCCTTTTTCGCTCCACAAGGATCAAGATCAAATAAACATT
CATTATCTTTCTGCCGAACGAAGATATATTTCTAGATTCTCAGTGAATAA
TGATCAAGTGAGACACAACTTATTTAGTTCGGATTTTTCGGATAAAAAAG
AAGAGAGGATTTACGATTATTCAGAATTGAATCGAATAATAGGTACTGGG
CATTGTGATTTCATATATTCTGCTATTCTCCACGAGAATGCTGATTTATT
GGCAAAGAGACGAAGAAATAGATTTATTATTCCATTTCAATTGATTCAAG
ACCAAGAGAAAGAACTAATGCTACATTCCCATTCCGGTATCTCGATGGAA
ATACCCATAAATGGTATTTTCCGTAGAAAAAGTATTCTTGCTTTTTTTGA
CGATCCTCGATACAGAAGAAAGAGTTCAGGAATTACTAAATATGGGACTC
TAGGGGCGCATTCAATCGTCAAAAGGGAGGATGTGATTGAGTATCGAGGA
GTCAAAAAGGTTAAGCCAAAATACCAAATGAAAGTAGATCGATTTTTTTT
CATTCCCGAGGAAGTGCATATTTTATCCGAATCTTCTTCCATAATGGTAC
GGAACAATAGTATCATTGGAGTAGATACCCCAATCACTTTAAATACAAGA
AGCCAAGTGGGCGGATTGGTCCGAGTGGAAAGAAAAAAAAAAAGGATTGA
ACTGAAAATTTTTTCGGGTAATATCTATTTTCCCGGAGAAAGAGATAAGA
TATCTCGACACAGTGGCATCTTGATACCACCAGGAACGGGCAAAACAAAC
TCTAAGGAATCAAAAAAATTGAAAAAATGGATCTATGTCCAACGGATCAC
ACCTACCAAGAAAAAGTATTTTGTTTTGGTTCGACCTGTAACCCCATATG
AAATACCGGACGGTCTAAATTTAGCAACACTCTTCCCCCAGGATCCATTT
CAGGAAAAAGATAATATGCAACTTCGAGCTGTCAATTATATCCTTTATGG
AAATGGCAAACCGACTCGGAGAATTTCTGACACAAGTATTCAACTAGTTC
GGACTTGTTTAGTGTTGAGTTGGGACCAAGACAACAAAAGTTCTTTCGCC
GAAGAGGTCTGTGCTTCCTTTGTTGAAGTAAGGACAAATGGTCTGATTCG
AGATTTCCTAAGAATCGACTTAGTGAAATCTCATATTTTTTATATCAGAA
AAAGAAATGATCCGTCAGGTTCAGAATTGATTTCTGATAATAGGTCAGAT
CGTACCAATAAAAATCCGTTTTATTCCATTTATTCCAACGCAAGGATTCA
ACAATCGTTTAGCCAAAATCACGGAACTATTCATACGCTCTTGAACAGAA
ATAAGGAATCCCAATCTTTGATAATTTTGTCAGCATCTAATTGTTTTCGC
ATGGGCCCATTCAACGATGTAAAATATCACAATGTGATAAAACAATCAAT
TAAAAAAGATCCTCTAATTCCAATTAAGAATTTATTGGGTCCTTTAGGAA
CAGCCCCCAAAATTGCGAATTTTTATTCATCATTTTACCCTTTAATAACT
CATAATCAGACCTCGGTAGCGAAATATTTTGAGCTTGACAATTTAAAACA
GGCTTTTCAAGTACTTAACTATTATTTAATAGCTGAAAATGGGAGAATTT
ATAATTTCGATCCATGCCGTAACATCTTTTTGAATGCAGTCAATTTGAAT
TGGTATTTTCCCCATCATCATTATCATCATAATTATTGTGAAGAAACGTC
CACAATAATTAGTCTTGGGCAGTTTATTTGTGAAAATGTATGTATAGCCA
AAAGCGGACCACGCCTAAAATCGGGTCAAGTTTTTATTGTTCAAGCTGAT
TCTATAGTAATAAGATCGGCTAAGCCTTATTTGGCGACTCCGGGAGCAAC
TGTCCATGGGCATTATGGAGAAACCCTTTACGAAGGAGATACGTTAGTTA
CATTTATATATGAAAAATCGAGATCTGGTGATATAACGCAGGGTCTTCCA
AAAGTGGAACAAGTGTTAGAAGTGCGTTCGATTGATTCAATATCGATGAA
CCTAGAAAAGAGAATTGAGGGTTGGAACGAATGTATAACAAGAATTCTTG
GAATTCCTTGGGGATTCGTGATTGGTGCTGAGCTAACTATAGTGCAAAGT
CGTCTCTCTTTGGTTAATAAGATCCAAAAGGTTTATCGATCTCAGGGGGT
ACAGATCCATAATAGGCATATAGAAATTATTGTACGTCAAATAACATCAA
AAGTATTGGTTTCAGAAGATGGAATGTCTAATGTTTTTTTACCCGGGGAA
CTGATTGGATTATTGCGAGCGGAACGAACGGGGCGTGCTTTAGAAGAAGC
GATTTGTTATCGAGCCGTTTTATTGGGAATAACGAGAGCATCTCTGAACA
CTCAAAGTTTTATATCTGAAGCAAGTTTTCAAGAAACTGCTCGAGTTTTA
GCAAAAGCTGCTCTCCGGGGTCGTATCGATTGGTTGAAAGGCCTGAAAGA
AAACGTTGTGCTTGGGGGTATGATACCCGCCGGTACCGGATTCAAAGGAT
TAGTGCACCGGTCACGGCAACATAACAACATTCTTTTGGAAACAAAAAAA
AAGAATTTCTTCGGGGGAGAAATGAGAGATATTTTCTTCCACCACCGAGA
ATTATTTGACTCTTGCATTTCAAACAATTTACATGATACATCAGGCCGCT
CTTTTATAGGTATAGAATTTAATGATTCTTAA
back to top