atpI, NC_016692.1-atpI.m10 (mRNA) Gossypium herbaceum

Overview
NameatpI
Unique NameNC_016692.1-atpI.m10
TypemRNA
OrganismGossypium herbaceum (Cotton (G. herbaceum))
Cross References
External references for this mRNA
DatabaseAccession
GIGeneID:11539470
nuccoreNC_016692.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
atpINC_016692.1-atpIGossypium herbaceumgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
atpIatpIGossypium herbaceumgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
NC_016692.1-atpI.m10-cds1NC_016692.1-atpI.m10-cds1Gossypium herbaceumCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
atpINC_016692.1-atpI.p10Gossypium herbaceumpolypeptide


Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Cotton Data2019-03-14
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
NC_016692regionNC_016692:15365..16099 -
Properties
Property NameValue
ProductATP synthase CF0 A subunit
Sourcegenbank
Genbank noteATPase IV subunit; ATP synthase CF0 A chain
Sequences
The following sequences are available for this feature:

mRNA sequence

>NC_016692.1-atpI.m10 ID=NC_016692.1-atpI.m10|Name=atpI|organism=Gossypium herbaceum|type=mRNA|length=735bp
atgaatggtatatcaaacgcactaaacgggttatacgatatctctggtgt
ggaagtaggccaacatttctattggcaaatagcaggtttccaagtccatg
cccaagtacttattacctcttgggttgtaattgctatcttattaggttcc
gccgttatcgctgttcggaatccacaaaccattccaaccgccggtcaaaa
tttcttcgaatatgttcttgaattcattcgagacgtaagcaaaactcaga
ttggagaagaatatggtccatgggttccctttattggaactatgtttcta
tttatttttgtttctaactggtcgggtgctctgttaccttggaaaatcat
acaattacctcatggagagttagccgcacccacgaatgatataaatacta
ctgttgctttagctttactcacgtcagtagcatatttctatgcgggtctt
tcaaaaaaaggattggggtatttcagtaaatacattcaacccactccaat
tcttttacctattaacattttagaggatttcacaaaacccttatcactta
gttttcgacttttcgggaatatattagctgatgaattagtagttgttgtt
cttgtttctttagtaccttcagtcgtccctatacctgtcatgttccttgg
attatttacaagtgggattcaagctcttatttttgcaactttagctgcgg
cttatataggcgaatccatggagggtcatcattga
back to top

protein sequence of atpI

>NC_016692.1-atpI.p10 ID=NC_016692.1-atpI.p10|Name=atpI|organism=Gossypium herbaceum|type=polypeptide|length=244bp
MNGISNALNGLYDISGVEVGQHFYWQIAGFQVHAQVLITSWVVIAILLGS
AVIAVRNPQTIPTAGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFL
FIFVSNWSGALLPWKIIQLPHGELAAPTNDINTTVALALLTSVAYFYAGL
SKKGLGYFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVV
LVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH
back to top

mRNA from alignment at NC_016692:15365..16099-

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>NC_016692.1-atpI.m10 ID=NC_016692.1-atpI.m10|Name=atpI|organism=Gossypium herbaceum|type=mRNA|length=735bp|location=Sequence derived from alignment at NC_016692:15365..16099- (Gossypium herbaceum)
ATGAATGGTATATCAAACGCACTAAACGGGTTATACGATATCTCTGGTGT GGAAGTAGGCCAACATTTCTATTGGCAAATAGCAGGTTTCCAAGTCCATG CCCAAGTACTTATTACCTCTTGGGTTGTAATTGCTATCTTATTAGGTTCC GCCGTTATCGCTGTTCGGAATCCACAAACCATTCCAACCGCCGGTCAAAA TTTCTTCGAATATGTTCTTGAATTCATTCGAGACGTAAGCAAAACTCAGA TTGGAGAAGAATATGGTCCATGGGTTCCCTTTATTGGAACTATGTTTCTA TTTATTTTTGTTTCTAACTGGTCGGGTGCTCTGTTACCTTGGAAAATCAT ACAATTACCTCATGGAGAGTTAGCCGCACCCACGAATGATATAAATACTA CTGTTGCTTTAGCTTTACTCACGTCAGTAGCATATTTCTATGCGGGTCTT TCAAAAAAAGGATTGGGGTATTTCAGTAAATACATTCAACCCACTCCAAT TCTTTTACCTATTAACATTTTAGAGGATTTCACAAAACCCTTATCACTTA GTTTTCGACTTTTCGGGAATATATTAGCTGATGAATTAGTAGTTGTTGTT CTTGTTTCTTTAGTACCTTCAGTCGTCCCTATACCTGTCATGTTCCTTGG ATTATTTACAAGTGGGATTCAAGCTCTTATTTTTGCAACTTTAGCTGCGG CTTATATAGGCGAATCCATGGAGGGTCATCATTGA
back to top

Coding sequence (CDS) from alignment at NC_016692:15365..16099-

>NC_016692.1-atpI.m10 ID=NC_016692.1-atpI.m10|Name=atpI|organism=Gossypium herbaceum|type=CDS|length=735bp|location=Sequence derived from alignment at NC_016692:15365..16099- (Gossypium herbaceum)
ATGAATGGTATATCAAACGCACTAAACGGGTTATACGATATCTCTGGTGT
GGAAGTAGGCCAACATTTCTATTGGCAAATAGCAGGTTTCCAAGTCCATG
CCCAAGTACTTATTACCTCTTGGGTTGTAATTGCTATCTTATTAGGTTCC
GCCGTTATCGCTGTTCGGAATCCACAAACCATTCCAACCGCCGGTCAAAA
TTTCTTCGAATATGTTCTTGAATTCATTCGAGACGTAAGCAAAACTCAGA
TTGGAGAAGAATATGGTCCATGGGTTCCCTTTATTGGAACTATGTTTCTA
TTTATTTTTGTTTCTAACTGGTCGGGTGCTCTGTTACCTTGGAAAATCAT
ACAATTACCTCATGGAGAGTTAGCCGCACCCACGAATGATATAAATACTA
CTGTTGCTTTAGCTTTACTCACGTCAGTAGCATATTTCTATGCGGGTCTT
TCAAAAAAAGGATTGGGGTATTTCAGTAAATACATTCAACCCACTCCAAT
TCTTTTACCTATTAACATTTTAGAGGATTTCACAAAACCCTTATCACTTA
GTTTTCGACTTTTCGGGAATATATTAGCTGATGAATTAGTAGTTGTTGTT
CTTGTTTCTTTAGTACCTTCAGTCGTCCCTATACCTGTCATGTTCCTTGG
ATTATTTACAAGTGGGATTCAAGCTCTTATTTTTGCAACTTTAGCTGCGG
CTTATATAGGCGAATCCATGGAGGGTCATCATTGA
back to top