psbK, HQ325742.1-psbK.m5 (mRNA) Gossypium herbaceum

Overview
NamepsbK
Unique NameHQ325742.1-psbK.m5
TypemRNA
OrganismGossypium herbaceum (Cotton (G. herbaceum))
Cross References
External references for this mRNA
DatabaseAccession
nuccoreHQ325742.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
psbKHQ325742.1-psbKGossypium herbaceumgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
psbKpsbKGossypium herbaceumgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
HQ325742.1-psbK.m5-cds1HQ325742.1-psbK.m5-cds1Gossypium herbaceumCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
psbKHQ325742.1-psbK.p5Gossypium herbaceumpolypeptide


Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Cotton Data2019-03-14
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
HQ325742regionHQ325742:7378..7563 +
Properties
Property NameValue
Productphotosystem II protein K
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>HQ325742.1-psbK.m5 ID=HQ325742.1-psbK.m5|Name=psbK|organism=Gossypium herbaceum|type=mRNA|length=186bp
atgcttaatatctttaatttgatctgtatctgttttaattctgccctttt
ttcgagtagttttttattcgccaaattgcccgaggcctatgcttttttga
atccaatcgtagattttatgccagtaatacctgttctcttttttctctta
gcctttgtttggcaagctgctgtaagttttcgatga
back to top

protein sequence of psbK

>HQ325742.1-psbK.p5 ID=HQ325742.1-psbK.p5|Name=psbK|organism=Gossypium herbaceum|type=polypeptide|length=61bp
MLNIFNLICICFNSALFSSSFLFAKLPEAYAFLNPIVDFMPVIPVLFFLL
AFVWQAAVSFR
back to top

mRNA from alignment at HQ325742:7378..7563+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>HQ325742.1-psbK.m5 ID=HQ325742.1-psbK.m5|Name=psbK|organism=Gossypium herbaceum|type=mRNA|length=186bp|location=Sequence derived from alignment at HQ325742:7378..7563+ (Gossypium herbaceum)
atgcttaatatctttaatttgatctgtatctgttttaattctgccctttt ttcgagtagttttttattcgccaaattgcccgaggcctatgcttttttga atccaatcgtagattttatgccagtaatacctgttctcttttttctctta gcctttgtttggcaagctgctgtaagttttcgatga
back to top

Coding sequence (CDS) from alignment at HQ325742:7378..7563+

>HQ325742.1-psbK.m5 ID=HQ325742.1-psbK.m5|Name=psbK|organism=Gossypium herbaceum|type=CDS|length=186bp|location=Sequence derived from alignment at HQ325742:7378..7563+ (Gossypium herbaceum)
atgcttaatatctttaatttgatctgtatctgttttaattctgccctttt
ttcgagtagttttttattcgccaaattgcccgaggcctatgcttttttga
atccaatcgtagattttatgccagtaatacctgttctcttttttctctta
gcctttgtttggcaagctgctgtaagttttcgatga
back to top