rpoC1, JF317353.1-rpoC1.m13 (mRNA) Gossypium herbaceum

Overview
NamerpoC1
Unique NameJF317353.1-rpoC1.m13
TypemRNA
OrganismGossypium herbaceum (Cotton (G. herbaceum))
Cross References
External references for this mRNA
DatabaseAccession
nuccoreJF317353.1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
rpoC1JF317353.1-rpoC1Gossypium herbaceumgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
rpoC1rpoC1Gossypium herbaceumgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JF317353.1-rpoC1.m13-cds1JF317353.1-rpoC1.m13-cds1Gossypium herbaceumCDS
JF317353.1-rpoC1.m13-cds2JF317353.1-rpoC1.m13-cds2Gossypium herbaceumCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
rpoC1JF317353.1-rpoC1.p13Gossypium herbaceumpolypeptide


Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Cotton Data2019-03-14
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JF317353regionJF317353:21548..24366 -
Properties
Property NameValue
ProductRNA polymerase beta
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>JF317353.1-rpoC1.m13 ID=JF317353.1-rpoC1.m13|Name=rpoC1|organism=Gossypium herbaceum|type=mRNA|length=2070bp
atgatcgaccgatataaacatcaacaactccgaattggatcagtttctcc
ccaacaaataagtgcttgggccaagaaaatcctacctaatggagaaaccg
ttggagaggtgacaaaaccctatacttttcattacaaaaccaataaaccg
gaaaaggatggattattttgtgaaagaatttttggacctataaaaagtgg
aatttgcgcttgtggaaattatcgagtaattggaaatcaaaaggagggcc
ctaaattttgtgaacaatgcggagttgaatttgttgattctcggatacga
agatatcaaatgggatacataaggctggcatgtccagtaactcatgtatg
gtatttgaaacgccttcctagttatatcgccaatcttttagacaaacctc
ttaaagaattagagggtctagtatactgcgatgtgtatcctaatttttct
tttgctaggcccatcgctaaaaaacctactttcttacgattacgaggttc
attcgaatatgaaattcaatcctggaaatacagtatcccactttttttta
ctacccaaggtttcgatacatttcgaagtcgcgaaatttctaccggagca
ggtgctattcgagaacaattagccgatctagatttgcgaattcttatcga
ttattcggtggtagaatggaaagaattaggagaagaaggcctcacgggta
atgaatgggaagatcgaaaaattggaagaagaaaggattttttggttaga
cgcatggaattggctaagcattttattcgaacaaatatagaaccagaatg
gatggttttatgtctattaccggttcttcctcccgagttgagaccgatca
ttcagatagatgggggtaaactaatgagttcggatattaatgaactctat
agaagagttatctatcgaaataatactcttaccgatctattaacaacaag
tagatctacgccaggggaattagtaatgtgtcaggaaaaattagtacaag
aagccgtggatacacttcttgataatggaatccgcggacaaccaatgagg
gacggtcataataaggtttacaagtcgttttcagatgtaattgaaggcaa
agagggaagatttcgcgagactttgcttggcaaacgagtcgattattcgg
gacgttctgtcattgttgttggcccctcactttcattacatcgctgtgga
ttgcctcgcgaaatagcaatagagcttttccagacatttgtaattcgcgg
tctaattagacaacatcttgctccgaacataggagttgctaagagtaaaa
ttcgggaaaaagggccgattgtatgggaaatactgcaagaagttatgcgg
ggacatcctgtattgctgaatagagcgcctactctgcatagattaggtat
acaggcattccaacctattttagtggaaggacgcgctatttgtttacatc
cattagtttgtaagggattcaatgcagactttgatggggatcaaatggca
gttcatgtacctttatctttagaggcgcaagcggaggctcgtttacttat
gttttctcatatgaatctcttgtctccagctattggggatcccatttccg
taccgactcaagatatgcttattgggctctatgtattaacgagtgggaat
cgtcgaggtatttgtgcgaataggtataatccatggaatcgaaaaagcta
tcaaaatgaaagaattgacgataataactataagtctacaagggagcctt
ttttttgtaattcctatgatgcgattggagcttataggcagaaaagaatc
aatttagatagtcctttgtggctccggtggcgactagagcaatgcgttat
tgcttcaagagaagctcccatcgaagttcactatgaatctttgggtacct
atcatgagatttatggacattatctaatagtaagaagtttaaaaaaaaaa
attctttgtatatacattcgaaccactgttggtcatatttctctttaccg
agaaatcgaagaagctatacaagggttttttcgggcctactcatatgata
cccaatcatatggtatctaa
back to top

protein sequence of rpoC1

>JF317353.1-rpoC1.p13 ID=JF317353.1-rpoC1.p13|Name=rpoC1|organism=Gossypium herbaceum|type=polypeptide|length=689bp
MIDRYKHQQLRIGSVSPQQISAWAKKILPNGETVGEVTKPYTFHYKTNKP
EKDGLFCERIFGPIKSGICACGNYRVIGNQKEGPKFCEQCGVEFVDSRIR
RYQMGYIRLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDVYPNFS
FARPIAKKPTFLRLRGSFEYEIQSWKYSIPLFFTTQGFDTFRSREISTGA
GAIREQLADLDLRILIDYSVVEWKELGEEGLTGNEWEDRKIGRRKDFLVR
RMELAKHFIRTNIEPEWMVLCLLPVLPPELRPIIQIDGGKLMSSDINELY
RRVIYRNNTLTDLLTTSRSTPGELVMCQEKLVQEAVDTLLDNGIRGQPMR
DGHNKVYKSFSDVIEGKEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCG
LPREIAIELFQTFVIRGLIRQHLAPNIGVAKSKIREKGPIVWEILQEVMR
GHPVLLNRAPTLHRLGIQAFQPILVEGRAICLHPLVCKGFNADFDGDQMA
VHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVPTQDMLIGLYVLTSGN
RRGICANRYNPWNRKSYQNERIDDNNYKSTREPFFCNSYDAIGAYRQKRI
NLDSPLWLRWRLEQCVIASREAPIEVHYESLGTYHEIYGHYLIVRSLKKK
ILCIYIRTTVGHISLYREIEEAIQGFFRAYSYDTQSYGI
back to top

mRNA from alignment at JF317353:21548..24366-

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>JF317353.1-rpoC1.m13 ID=JF317353.1-rpoC1.m13|Name=rpoC1|organism=Gossypium herbaceum|type=mRNA|length=2819bp|location=Sequence derived from alignment at JF317353:21548..24366- (Gossypium herbaceum)
ATGATCGACCGATATAAACATCAACAACTCCGAATTGGATCAGTTTCTCC CCAACAAATAAGTGCTTGGGCCAAGAAAATCCTACCTAATGGAGAAACCG TTGGAGAGGTGACAAAACCCTATACTTTTCATTACAAAACCAATAAACCG GAAAAGGATGGATTATTTTGTGAAAGAATTTTTGGACCTATAAAAAGTGG AATTTGCGCTTGTGGAAATTATCGAGTAATTGGAAATCAAAAGGAGGGCC CTAAATTTTGTGAACAATGCGGAGTTGAATTTGTTGATTCTCGGATACGA AGATATCAAATGGGATACATAAGGCTGGCATGTCCAGTAACTCATGTATG GTATTTGAAACGCCTTCCTAGTTATATCGCCAATCTTTTAGACAAACCTC TTAAAGAATTAGAGGGTCTAGTATACTGCGATGTGTGATTTGATCGAAAT TATTATTTTACAGATTAGGAATGAGAAACTGTCATCCCATTCAATCGAAT TGGGATGCCCTGGATCTGACATGTCTCTTGGGAAGAGTAACATGAAGCTC AGAATTATGGGCGTATTCAATACTCCCAAATAAAAAGGGAATTGGTCTAT GGTCGAGTCAGTAAAAATAAATAACTAGGAATTTTGAGTTGTACCTCGTG AAAAAAAGACTTCTTTTTTTTGTGGAATTAACCGTTCTCATTTCTTTTAG TTCTTTTAGAAAGAAATGAAATTATGTTCAAGGAAACAAATATGTCATGG TTGCAGGAGTCTATACATCGCATATAGGCTTAGGCTTTAAGTTAAGGGCA TCGTGGTATAATCGTCGAGGTACCGCAGGACCTAAGAGATCGAATGGAAG GGTACATAGACAAGTAAATCCCTTATGACACTCCTTTAATTTTAGAGGAT TCAGCATTCGAGGGGAAGTAGACTACTCAAGAATTTCACATTTCATTTAT GTCCTAATTTTGAATTGAATAAAGAATTAAGAAAATCTAAATCAATAAAT CAATAAAAGAAGAATCAATCAATGAAATGTTTCTTGGAACTTGAGTAAAG AGTAGACCTTTTTTGGGGGTTCTAGAATTTGAAAGCGAGAACTCCTTTAC TTTATCTTTATTTGGTGTAACTACTTGAGCCGGATGAGAGGAAACTCTCA TGTCCGATTTTGAGGGGGGGATCCCGCAGGGCCCTATCCTAATTTTTCTT TTGCTAGGCCCATCGCTAAAAAACCTACTTTCTTACGATTACGAGGTTCA TTCGAATATGAAATTCAATCCTGGAAATACAGTATCCCACTTTTTTTTAC TACCCAAGGTTTCGATACATTTCGAAGTCGCGAAATTTCTACCGGAGCAG GTGCTATTCGAGAACAATTAGCCGATCTAGATTTGCGAATTCTTATCGAT TATTCGGTGGTAGAATGGAAAGAATTAGGAGAAGAAGGCCTCACGGGTAA TGAATGGGAAGATCGAAAAATTGGAAGAAGAAAGGATTTTTTGGTTAGAC GCATGGAATTGGCTAAGCATTTTATTCGAACAAATATAGAACCAGAATGG ATGGTTTTATGTCTATTACCGGTTCTTCCTCCCGAGTTGAGACCGATCAT TCAGATAGATGGGGGTAAACTAATGAGTTCGGATATTAATGAACTCTATA GAAGAGTTATCTATCGAAATAATACTCTTACCGATCTATTAACAACAAGT AGATCTACGCCAGGGGAATTAGTAATGTGTCAGGAAAAATTAGTACAAGA AGCCGTGGATACACTTCTTGATAATGGAATCCGCGGACAACCAATGAGGG ACGGTCATAATAAGGTTTACAAGTCGTTTTCAGATGTAATTGAAGGCAAA GAGGGAAGATTTCGCGAGACTTTGCTTGGCAAACGAGTCGATTATTCGGG ACGTTCTGTCATTGTTGTTGGCCCCTCACTTTCATTACATCGCTGTGGAT TGCCTCGCGAAATAGCAATAGAGCTTTTCCAGACATTTGTAATTCGCGGT CTAATTAGACAACATCTTGCTCCGAACATAGGAGTTGCTAAGAGTAAAAT TCGGGAAAAAGGGCCGATTGTATGGGAAATACTGCAAGAAGTTATGCGGG GACATCCTGTATTGCTGAATAGAGCGCCTACTCTGCATAGATTAGGTATA CAGGCATTCCAACCTATTTTAGTGGAAGGACGCGCTATTTGTTTACATCC ATTAGTTTGTAAGGGATTCAATGCAGACTTTGATGGGGATCAAATGGCAG TTCATGTACCTTTATCTTTAGAGGCGCAAGCGGAGGCTCGTTTACTTATG TTTTCTCATATGAATCTCTTGTCTCCAGCTATTGGGGATCCCATTTCCGT ACCGACTCAAGATATGCTTATTGGGCTCTATGTATTAACGAGTGGGAATC GTCGAGGTATTTGTGCGAATAGGTATAATCCATGGAATCGAAAAAGCTAT CAAAATGAAAGAATTGACGATAATAACTATAAGTCTACAAGGGAGCCTTT TTTTTGTAATTCCTATGATGCGATTGGAGCTTATAGGCAGAAAAGAATCA ATTTAGATAGTCCTTTGTGGCTCCGGTGGCGACTAGAGCAATGCGTTATT GCTTCAAGAGAAGCTCCCATCGAAGTTCACTATGAATCTTTGGGTACCTA TCATGAGATTTATGGACATTATCTAATAGTAAGAAGTTTAAAAAAAAAAA TTCTTTGTATATACATTCGAACCACTGTTGGTCATATTTCTCTTTACCGA GAAATCGAAGAAGCTATACAAGGGTTTTTTCGGGCCTACTCATATGATAC CCAATCATATGGTATCTAA
back to top

Coding sequence (CDS) from alignment at JF317353:21548..24366-

>JF317353.1-rpoC1.m13 ID=JF317353.1-rpoC1.m13|Name=rpoC1|organism=Gossypium herbaceum|type=CDS|length=2070bp|location=Sequence derived from alignment at JF317353:21548..24366- (Gossypium herbaceum)
ATGATCGACCGATATAAACATCAACAACTCCGAATTGGATCAGTTTCTCC
CCAACAAATAAGTGCTTGGGCCAAGAAAATCCTACCTAATGGAGAAACCG
TTGGAGAGGTGACAAAACCCTATACTTTTCATTACAAAACCAATAAACCG
GAAAAGGATGGATTATTTTGTGAAAGAATTTTTGGACCTATAAAAAGTGG
AATTTGCGCTTGTGGAAATTATCGAGTAATTGGAAATCAAAAGGAGGGCC
CTAAATTTTGTGAACAATGCGGAGTTGAATTTGTTGATTCTCGGATACGA
AGATATCAAATGGGATACATAAGGCTGGCATGTCCAGTAACTCATGTATG
GTATTTGAAACGCCTTCCTAGTTATATCGCCAATCTTTTAGACAAACCTC
TTAAAGAATTAGAGGGTCTAGTATACTGCGATGTGTATCCTAATTTTTCT
TTTGCTAGGCCCATCGCTAAAAAACCTACTTTCTTACGATTACGAGGTTC
ATTCGAATATGAAATTCAATCCTGGAAATACAGTATCCCACTTTTTTTTA
CTACCCAAGGTTTCGATACATTTCGAAGTCGCGAAATTTCTACCGGAGCA
GGTGCTATTCGAGAACAATTAGCCGATCTAGATTTGCGAATTCTTATCGA
TTATTCGGTGGTAGAATGGAAAGAATTAGGAGAAGAAGGCCTCACGGGTA
ATGAATGGGAAGATCGAAAAATTGGAAGAAGAAAGGATTTTTTGGTTAGA
CGCATGGAATTGGCTAAGCATTTTATTCGAACAAATATAGAACCAGAATG
GATGGTTTTATGTCTATTACCGGTTCTTCCTCCCGAGTTGAGACCGATCA
TTCAGATAGATGGGGGTAAACTAATGAGTTCGGATATTAATGAACTCTAT
AGAAGAGTTATCTATCGAAATAATACTCTTACCGATCTATTAACAACAAG
TAGATCTACGCCAGGGGAATTAGTAATGTGTCAGGAAAAATTAGTACAAG
AAGCCGTGGATACACTTCTTGATAATGGAATCCGCGGACAACCAATGAGG
GACGGTCATAATAAGGTTTACAAGTCGTTTTCAGATGTAATTGAAGGCAA
AGAGGGAAGATTTCGCGAGACTTTGCTTGGCAAACGAGTCGATTATTCGG
GACGTTCTGTCATTGTTGTTGGCCCCTCACTTTCATTACATCGCTGTGGA
TTGCCTCGCGAAATAGCAATAGAGCTTTTCCAGACATTTGTAATTCGCGG
TCTAATTAGACAACATCTTGCTCCGAACATAGGAGTTGCTAAGAGTAAAA
TTCGGGAAAAAGGGCCGATTGTATGGGAAATACTGCAAGAAGTTATGCGG
GGACATCCTGTATTGCTGAATAGAGCGCCTACTCTGCATAGATTAGGTAT
ACAGGCATTCCAACCTATTTTAGTGGAAGGACGCGCTATTTGTTTACATC
CATTAGTTTGTAAGGGATTCAATGCAGACTTTGATGGGGATCAAATGGCA
GTTCATGTACCTTTATCTTTAGAGGCGCAAGCGGAGGCTCGTTTACTTAT
GTTTTCTCATATGAATCTCTTGTCTCCAGCTATTGGGGATCCCATTTCCG
TACCGACTCAAGATATGCTTATTGGGCTCTATGTATTAACGAGTGGGAAT
CGTCGAGGTATTTGTGCGAATAGGTATAATCCATGGAATCGAAAAAGCTA
TCAAAATGAAAGAATTGACGATAATAACTATAAGTCTACAAGGGAGCCTT
TTTTTTGTAATTCCTATGATGCGATTGGAGCTTATAGGCAGAAAAGAATC
AATTTAGATAGTCCTTTGTGGCTCCGGTGGCGACTAGAGCAATGCGTTAT
TGCTTCAAGAGAAGCTCCCATCGAAGTTCACTATGAATCTTTGGGTACCT
ATCATGAGATTTATGGACATTATCTAATAGTAAGAAGTTTAAAAAAAAAA
ATTCTTTGTATATACATTCGAACCACTGTTGGTCATATTTCTCTTTACCG
AGAAATCGAAGAAGCTATACAAGGGTTTTTTCGGGCCTACTCATATGATA
CCCAATCATATGGTATCTAA
back to top