Kirkii_Juiced.00g075700.m01, Kirkii_Juiced.00g075700.m01_ISU-kirkii_v3.0.a3 (mRNA) Gossypioides kirkii

Overview
NameKirkii_Juiced.00g075700.m01
Unique NameKirkii_Juiced.00g075700.m01_ISU-kirkii_v3.0.a3
TypemRNA
OrganismGossypioides kirkii ()
Sequence length1752
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Kirkii_Juiced.00g075700Kirkii_Juiced.00g075700_ISU-kirkii_v3.0.a3Gossypioides kirkiigene


This mRNA is member of the following syntenic_region feature(s):

Feature NameUnique NameSpeciesType
gkgkR044gkgkR044Gossypioides kirkiisyntenic_region
gkgkR123gkgkR123Gossypioides kirkiisyntenic_region
gkgkR218gkgkR218Gossypioides kirkiisyntenic_region
gkgkR284gkgkR284Gossypioides kirkiisyntenic_region
gkrbL0606gkrbL0606Gossypioides kirkiisyntenic_region
gkrbL0612gkrbL0612Gossypioides kirkiisyntenic_region
gkrbL0663gkrbL0663Gossypioides kirkiisyntenic_region
gkrbL0675gkrbL0675Gossypioides kirkiisyntenic_region
gkrbL0699gkrbL0699Gossypioides kirkiisyntenic_region
acgkR0062acgkR0062Gossypioides kirkiisyntenic_region
acgkR0441acgkR0441Gossypioides kirkiisyntenic_region
acgkR0564acgkR0564Gossypioides kirkiisyntenic_region
acgkR0741acgkR0741Gossypioides kirkiisyntenic_region
bhgkR0623bhgkR0623Gossypioides kirkiisyntenic_region
bhgkR0869bhgkR0869Gossypioides kirkiisyntenic_region
bhgkR0885bhgkR0885Gossypioides kirkiisyntenic_region
bhgkR1063bhgkR1063Gossypioides kirkiisyntenic_region
bhgkR2221bhgkR2221Gossypioides kirkiisyntenic_region
bhgkR2345bhgkR2345Gossypioides kirkiisyntenic_region
bhgkR2449bhgkR2449Gossypioides kirkiisyntenic_region
ghgkR0046ghgkR0046Gossypioides kirkiisyntenic_region
ghgkR0381ghgkR0381Gossypioides kirkiisyntenic_region
ghgkR0489ghgkR0489Gossypioides kirkiisyntenic_region
ghgkR0582ghgkR0582Gossypioides kirkiisyntenic_region
ghgkR0663ghgkR0663Gossypioides kirkiisyntenic_region
ghgkR0812ghgkR0812Gossypioides kirkiisyntenic_region
ghgkR1682ghgkR1682Gossypioides kirkiisyntenic_region
ghgkR1803ghgkR1803Gossypioides kirkiisyntenic_region
ghgkR1892ghgkR1892Gossypioides kirkiisyntenic_region
ghgkR1976ghgkR1976Gossypioides kirkiisyntenic_region
abgkR0311abgkR0311Gossypioides kirkiisyntenic_region
abgkR0482abgkR0482Gossypioides kirkiisyntenic_region
gbgkR0044gbgkR0044Gossypioides kirkiisyntenic_region
abgkR1277abgkR1277Gossypioides kirkiisyntenic_region
gbgkR0377gbgkR0377Gossypioides kirkiisyntenic_region
gkhbL0768gkhbL0768Gossypioides kirkiisyntenic_region
gkhbL0781gkhbL0781Gossypioides kirkiisyntenic_region
gkhbL0788gkhbL0788Gossypioides kirkiisyntenic_region
gkhbL0798gkhbL0798Gossypioides kirkiisyntenic_region
gkhbL0825gkhbL0825Gossypioides kirkiisyntenic_region
gkhbL0840gkhbL0840Gossypioides kirkiisyntenic_region
gbgkR0505gbgkR0505Gossypioides kirkiisyntenic_region
gkhbL0896gkhbL0896Gossypioides kirkiisyntenic_region
gbgkR0598gbgkR0598Gossypioides kirkiisyntenic_region
abgkR1959abgkR1959Gossypioides kirkiisyntenic_region
gbgkR0673gbgkR0673Gossypioides kirkiisyntenic_region
gbgkR0821gbgkR0821Gossypioides kirkiisyntenic_region
gkhnL0568gkhnL0568Gossypioides kirkiisyntenic_region
gkhnL0574gkhnL0574Gossypioides kirkiisyntenic_region
gkhnL0587gkhnL0587Gossypioides kirkiisyntenic_region
gkhnL0598gkhnL0598Gossypioides kirkiisyntenic_region
gkhnL0633gkhnL0633Gossypioides kirkiisyntenic_region
gkhnL0642gkhnL0642Gossypioides kirkiisyntenic_region
gkhnL0646gkhnL0646Gossypioides kirkiisyntenic_region
gbgkR1708gbgkR1708Gossypioides kirkiisyntenic_region
gbgkR1824gbgkR1824Gossypioides kirkiisyntenic_region
gbgkR1918gbgkR1918Gossypioides kirkiisyntenic_region
gbgkR1996gbgkR1996Gossypioides kirkiisyntenic_region
gkrjL0329gkrjL0329Gossypioides kirkiisyntenic_region
gkrjL0337gkrjL0337Gossypioides kirkiisyntenic_region
gkrjL0346gkrjL0346Gossypioides kirkiisyntenic_region
gkrjL0366gkrjL0366Gossypioides kirkiisyntenic_region
bzgkR0044bzgkR0044Gossypioides kirkiisyntenic_region
gkhjL0547gkhjL0547Gossypioides kirkiisyntenic_region
gkhjL0555gkhjL0555Gossypioides kirkiisyntenic_region
gkhjL0567gkhjL0567Gossypioides kirkiisyntenic_region
gkhjL0580gkhjL0580Gossypioides kirkiisyntenic_region
gkhjL0609gkhjL0609Gossypioides kirkiisyntenic_region
gkhjL0617gkhjL0617Gossypioides kirkiisyntenic_region
gkhjL0618gkhjL0618Gossypioides kirkiisyntenic_region
gkhzL0545gkhzL0545Gossypioides kirkiisyntenic_region
gkhjL0627gkhjL0627Gossypioides kirkiisyntenic_region
bzgkR0370bzgkR0370Gossypioides kirkiisyntenic_region
gkhzL0552gkhzL0552Gossypioides kirkiisyntenic_region
gkhzL0565gkhzL0565Gossypioides kirkiisyntenic_region
gkhzL0577gkhzL0577Gossypioides kirkiisyntenic_region
gkhzL0607gkhzL0607Gossypioides kirkiisyntenic_region
gkhzL0619gkhzL0619Gossypioides kirkiisyntenic_region
gkhzL0620gkhzL0620Gossypioides kirkiisyntenic_region
bzgkR0478bzgkR0478Gossypioides kirkiisyntenic_region
gkhzL0631gkhzL0631Gossypioides kirkiisyntenic_region
bzgkR0572bzgkR0572Gossypioides kirkiisyntenic_region
bzgkR0650bzgkR0650Gossypioides kirkiisyntenic_region
bzgkR0803bzgkR0803Gossypioides kirkiisyntenic_region
bzgkR1700bzgkR1700Gossypioides kirkiisyntenic_region
bzgkR1813bzgkR1813Gossypioides kirkiisyntenic_region
bzgkR1905bzgkR1905Gossypioides kirkiisyntenic_region
bzgkR1991bzgkR1991Gossypioides kirkiisyntenic_region
gkgrbL0404gkgrbL0404Gossypioides kirkiisyntenic_region
gkgrbL0420gkgrbL0420Gossypioides kirkiisyntenic_region
gkgrbL0428gkgrbL0428Gossypioides kirkiisyntenic_region
gkgrbL0439gkgrbL0439Gossypioides kirkiisyntenic_region
gkgrbL0449gkgrbL0449Gossypioides kirkiisyntenic_region
gkgtbL0413gkgtbL0413Gossypioides kirkiisyntenic_region
gkgtbL0430gkgtbL0430Gossypioides kirkiisyntenic_region
gkgtbL0442gkgtbL0442Gossypioides kirkiisyntenic_region
gkgtbL0453gkgtbL0453Gossypioides kirkiisyntenic_region
gkgtbL0458gkgtbL0458Gossypioides kirkiisyntenic_region
ghzgkR0049ghzgkR0049Gossypioides kirkiisyntenic_region
ghzgkR0377ghzgkR0377Gossypioides kirkiisyntenic_region
ghzgkR0483ghzgkR0483Gossypioides kirkiisyntenic_region
ghzgkR0583ghzgkR0583Gossypioides kirkiisyntenic_region
ghzgkR0655ghzgkR0655Gossypioides kirkiisyntenic_region
ghzgkR0804ghzgkR0804Gossypioides kirkiisyntenic_region
ghzgkR1682ghzgkR1682Gossypioides kirkiisyntenic_region
ghzgkR1789ghzgkR1789Gossypioides kirkiisyntenic_region
ghzgkR1879ghzgkR1879Gossypioides kirkiisyntenic_region
ghzgkR1960ghzgkR1960Gossypioides kirkiisyntenic_region
ghtgkR0050ghtgkR0050Gossypioides kirkiisyntenic_region
ghtgkR0376ghtgkR0376Gossypioides kirkiisyntenic_region
ghtgkR0485ghtgkR0485Gossypioides kirkiisyntenic_region
ghtgkR0589ghtgkR0589Gossypioides kirkiisyntenic_region
ghtgkR0662ghtgkR0662Gossypioides kirkiisyntenic_region
ghtgkR0814ghtgkR0814Gossypioides kirkiisyntenic_region
ghtgkR1698ghtgkR1698Gossypioides kirkiisyntenic_region
ghtgkR1810ghtgkR1810Gossypioides kirkiisyntenic_region
ghtgkR1899ghtgkR1899Gossypioides kirkiisyntenic_region
ghtgkR1986ghtgkR1986Gossypioides kirkiisyntenic_region
gaugkR0039gaugkR0039Gossypioides kirkiisyntenic_region
gaugkR0314gaugkR0314Gossypioides kirkiisyntenic_region
gaugkR0410gaugkR0410Gossypioides kirkiisyntenic_region
gaugkR0602gaugkR0602Gossypioides kirkiisyntenic_region
gaugkR0657gaugkR0657Gossypioides kirkiisyntenic_region
adgkR0045adgkR0045Gossypioides kirkiisyntenic_region
adgkR0382adgkR0382Gossypioides kirkiisyntenic_region
adgkR0490adgkR0490Gossypioides kirkiisyntenic_region
adgkR0581adgkR0581Gossypioides kirkiisyntenic_region
adgkR0670adgkR0670Gossypioides kirkiisyntenic_region
adgkR0821adgkR0821Gossypioides kirkiisyntenic_region
adgkR1733adgkR1733Gossypioides kirkiisyntenic_region
adgkR1854adgkR1854Gossypioides kirkiisyntenic_region
adgkR1947adgkR1947Gossypioides kirkiisyntenic_region
adgkR2031adgkR2031Gossypioides kirkiisyntenic_region
gkhgsL0480gkhgsL0480Gossypioides kirkiisyntenic_region
gkhgsL0486gkhgsL0486Gossypioides kirkiisyntenic_region
gkhgsL0501gkhgsL0501Gossypioides kirkiisyntenic_region
gkhgsL0513gkhgsL0513Gossypioides kirkiisyntenic_region
gkhgsL0554gkhgsL0554Gossypioides kirkiisyntenic_region
gkhgsL0555gkhgsL0555Gossypioides kirkiisyntenic_region
gkhgsL0566gkhgsL0566Gossypioides kirkiisyntenic_region
gdgkR0044gdgkR0044Gossypioides kirkiisyntenic_region
gdgkR0388gdgkR0388Gossypioides kirkiisyntenic_region
gdgkR0500gdgkR0500Gossypioides kirkiisyntenic_region
gdgkR0591gdgkR0591Gossypioides kirkiisyntenic_region
gdgkR0677gdgkR0677Gossypioides kirkiisyntenic_region
gdgkR0832gdgkR0832Gossypioides kirkiisyntenic_region
gdgkR1743gdgkR1743Gossypioides kirkiisyntenic_region
gdgkR1854gdgkR1854Gossypioides kirkiisyntenic_region
gdgkR1941gdgkR1941Gossypioides kirkiisyntenic_region
gdgkR2028gdgkR2028Gossypioides kirkiisyntenic_region
gktoL0477gktoL0477Gossypioides kirkiisyntenic_region
gktoL0481gktoL0481Gossypioides kirkiisyntenic_region
gktoL0496gktoL0496Gossypioides kirkiisyntenic_region
gktoL0508gktoL0508Gossypioides kirkiisyntenic_region
gktoL0534gktoL0534Gossypioides kirkiisyntenic_region
gktoL0541gktoL0541Gossypioides kirkiisyntenic_region
gktoL0544gktoL0544Gossypioides kirkiisyntenic_region
gktoL0554gktoL0554Gossypioides kirkiisyntenic_region
fngkR0037fngkR0037Gossypioides kirkiisyntenic_region
fngkR0357fngkR0357Gossypioides kirkiisyntenic_region
fngkR0473fngkR0473Gossypioides kirkiisyntenic_region
fngkR0624fngkR0624Gossypioides kirkiisyntenic_region
fngkR0696fngkR0696Gossypioides kirkiisyntenic_region
dtgkR0256dtgkR0256Gossypioides kirkiisyntenic_region
dtgkR0722dtgkR0722Gossypioides kirkiisyntenic_region
dtgkR0725dtgkR0725Gossypioides kirkiisyntenic_region
dtgkR0806dtgkR0806Gossypioides kirkiisyntenic_region
gkhwL0455gkhwL0455Gossypioides kirkiisyntenic_region
gkhwL0471gkhwL0471Gossypioides kirkiisyntenic_region
gkhwL0485gkhwL0485Gossypioides kirkiisyntenic_region
gkhwL0497gkhwL0497Gossypioides kirkiisyntenic_region
gkhwL0506gkhwL0506Gossypioides kirkiisyntenic_region
awgkR0049awgkR0049Gossypioides kirkiisyntenic_region
awgkR0390awgkR0390Gossypioides kirkiisyntenic_region
awgkR0507awgkR0507Gossypioides kirkiisyntenic_region
awgkR0666awgkR0666Gossypioides kirkiisyntenic_region
awgkR0741awgkR0741Gossypioides kirkiisyntenic_region
gktwL0565gktwL0565Gossypioides kirkiisyntenic_region
gktwL0572gktwL0572Gossypioides kirkiisyntenic_region
gktwL0586gktwL0586Gossypioides kirkiisyntenic_region
gktwL0596gktwL0596Gossypioides kirkiisyntenic_region
gktwL0627gktwL0627Gossypioides kirkiisyntenic_region
gktwL0632gktwL0632Gossypioides kirkiisyntenic_region
gktwL0639gktwL0639Gossypioides kirkiisyntenic_region
gktwL0640gktwL0640Gossypioides kirkiisyntenic_region
gkuhL0469gkuhL0469Gossypioides kirkiisyntenic_region
gkuhL0477gkuhL0477Gossypioides kirkiisyntenic_region
gkuhL0490gkuhL0490Gossypioides kirkiisyntenic_region
gkuhL0501gkuhL0501Gossypioides kirkiisyntenic_region
gkuhL0532gkuhL0532Gossypioides kirkiisyntenic_region
gkuhL0544gkuhL0544Gossypioides kirkiisyntenic_region
gkuhL0545gkuhL0545Gossypioides kirkiisyntenic_region
gkuhL0555gkuhL0555Gossypioides kirkiisyntenic_region


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Kirkii_Juiced.00g075700.m01.CDS04Kirkii_Juiced.00g075700.m01.CDS04_ISU-kirkii_v3.0.a3Gossypioides kirkiiCDS
Kirkii_Juiced.00g075700.m01.CDS03Kirkii_Juiced.00g075700.m01.CDS03_ISU-kirkii_v3.0.a3Gossypioides kirkiiCDS
Kirkii_Juiced.00g075700.m01.CDS02Kirkii_Juiced.00g075700.m01.CDS02_ISU-kirkii_v3.0.a3Gossypioides kirkiiCDS
Kirkii_Juiced.00g075700.m01.CDS01Kirkii_Juiced.00g075700.m01.CDS01_ISU-kirkii_v3.0.a3Gossypioides kirkiiCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Kirkii_Juiced.00g075700.m01.exon04Kirkii_Juiced.00g075700.m01.exon04_ISU-kirkii_v3.0.a3Gossypioides kirkiiexon
Kirkii_Juiced.00g075700.m01.exon03Kirkii_Juiced.00g075700.m01.exon03_ISU-kirkii_v3.0.a3Gossypioides kirkiiexon
Kirkii_Juiced.00g075700.m01.exon02Kirkii_Juiced.00g075700.m01.exon02_ISU-kirkii_v3.0.a3Gossypioides kirkiiexon
Kirkii_Juiced.00g075700.m01.exon01Kirkii_Juiced.00g075700.m01.exon01_ISU-kirkii_v3.0.a3Gossypioides kirkiiexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Kirkii_Juiced.00g075700.m01Kirkii_Juiced.00g075700.m01_ISU-kirkii_v3.0.a3-proteinGossypioides kirkiipolypeptide


Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
KI_03chromosomeKI_03:38546016..38548043 -
Homology
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|1028969012|ref|XP_016728024.1| (PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Gossypium hirsutum])

HSP 1 Score: 1158.28 bits (2995), Expect = 0.000e+0
Identity = 563/585 (96.24%), Postives = 572/585 (97.78%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFS+IIAI SFFASFIYLLGFFGIDFVQSLVFQPSPD W   DEEEDNEVLLAKEDARKVPCGQALDCS+PPLPPAAPIVTTQKVCDEKP  VI EEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSRMLA IVA AVLAGELSLMSA+AAGQLVKSHMKYNRS+KDVSKASS
Sbjct:    1 MEAPRLYSTKPVQSLKPTKKIPLEEDLGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSDIIAIFSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDNEVLLAKEDARKVPCGQALDCSLPPLPPAAPIVTTQKVCDEKPLMVIPEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRMLAAIVASAVLAGELSLMSAIAAGQLVKSHMKYNRSTKDVSKASS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|1029063068|ref|XP_016691783.1| (PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Gossypium hirsutum])

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 563/585 (96.24%), Postives = 571/585 (97.61%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKP QSLKP+KKIPLEED GKASDALPLPL+LTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPD W   DEEEDNEVLLAKEDAR VPCGQALDCS+PPLPPAAPIVT QKV DEKP TV  EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEA IKGDVVRKVLKTSVES+VELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS
Sbjct:    1 MEAPRLYSTKPAQSLKPSKKIPLEEDHGKASDALPLPLHLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDNEVLLAKEDARMVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVTTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEAIIKGDVVRKVLKTSVESIVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|823160128|ref|XP_012479906.1| (PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Gossypium raimondii] >gi|763764699|gb|KJB31953.1| hypothetical protein B456_005G215700 [Gossypium raimondii])

HSP 1 Score: 1154.43 bits (2985), Expect = 0.000e+0
Identity = 562/585 (96.07%), Postives = 573/585 (97.95%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKP+KKIPLEED GKASDALPLPL+LTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSF ASFIYLLGFFGIDFVQSLVFQPSPD W   DEEED+EVLLAKEDARKVPCGQALDCS+PPLPPAAPIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGI+GPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA IKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS
Sbjct:    1 MEAPRLYSTKPVQSLKPSKKIPLEEDHGKASDALPLPLHLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFLASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGISGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|1344104039|gb|PPD78182.1| (hypothetical protein GOBAR_DD24873 [Gossypium barbadense])

HSP 1 Score: 1152.12 bits (2979), Expect = 0.000e+0
Identity = 562/585 (96.07%), Postives = 570/585 (97.44%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKP QSLKP+KKIPLEED GKASDALPLPL+LTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSF ASFIYLLGFFGIDFVQSLVFQPSPD W   DEEEDNEVLLAKEDAR VPCGQALDCS+PPLPPAAPIVT QKV DEKP TV  EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA IKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS
Sbjct:    1 MEAPRLYSTKPAQSLKPSKKIPLEEDHGKASDALPLPLHLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFLASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDNEVLLAKEDARMVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVTTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|1344104040|gb|PPD78183.1| (hypothetical protein GOBAR_DD24874 [Gossypium barbadense])

HSP 1 Score: 1145.18 bits (2961), Expect = 0.000e+0
Identity = 554/583 (95.03%), Postives = 567/583 (97.26%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFS+IIAILSF ASFIYLLGFFGIDFVQSLVFQ SPD W  EEED+EVLLAKEDARKVPCGQALDCS+PPLPP APIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRL GKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGI+GPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMSA+AAGQLVKSHMKYNRS+KDVSKASS
Sbjct:    1 MEAPRLYSTKPVQSLKPTKKIPLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSDIIAILSFLASFIYLLGFFGIDFVQSLVFQSSPDVWIAEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPVAPIVTVQKVVDEKPVTVLTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLIGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGISGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSAIAAGQLVKSHMKYNRSTKDVSKASS 583          
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|1029063070|ref|XP_016691784.1| (PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Gossypium hirsutum])

HSP 1 Score: 1143.64 bits (2957), Expect = 0.000e+0
Identity = 554/583 (95.03%), Postives = 567/583 (97.26%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFS+IIAILSF ASFIYLLGFFGIDFVQSLVFQ SPD W  EEED+EVLLAKEDARKVPCGQALDCS+PPLPP APIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLESKLGDCK AAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGI+GPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMSA+AAGQLVKSHMKYNRS+KDVSKASS
Sbjct:    1 MEAPRLYSTKPVQSLKPTKKIPLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSDIIAILSFLASFIYLLGFFGIDFVQSLVFQSSPDVWIAEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPVAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLESKLGDCKMAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGISGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSAIAAGQLVKSHMKYNRSTKDVSKASS 583          
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|1050621520|ref|XP_017633578.1| (PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Gossypium arboreum])

HSP 1 Score: 1130.93 bits (2924), Expect = 0.000e+0
Identity = 560/585 (95.73%), Postives = 571/585 (97.61%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFS+IIAI SFFASF YLLGFFGIDFVQSLVFQPSPD W   DEEEDNEVLLAKEDARKVPCGQALDCS+PPLPPAAPIVTTQKVCDEKP  VI EEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEAT+KGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEA+N+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSRMLA IVA AVLAGELSLMSA+AAGQLVKSHMKYNRS+KDVSKASS
Sbjct:    1 MEAPRLYSTKPVQSLKPTKKIPLEEDLGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSDIIAIFSFFASFSYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDNEVLLAKEDARKVPCGQALDCSLPPLPPAAPIVTTQKVCDEKPLMVIPEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATVKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAINDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRMLAAIVASAVLAGELSLMSAIAAGQLVKSHMKYNRSTKDVSKASS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|1029063072|ref|XP_016691785.1| (PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Gossypium hirsutum])

HSP 1 Score: 1128.62 bits (2918), Expect = 0.000e+0
Identity = 556/582 (95.53%), Postives = 569/582 (97.77%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKAS 582
            MEAHRL STKPVQSLKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPD W  EEED+EVLLAKE+ARKVPCGQALDCS+PPLPPAAPIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMS ++AGQLV+SHMKYNRSSKDVSKA+
Sbjct:    1 MEAHRLSSTKPVQSLKPTKKIPLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEEEDDEVLLAKEEARKVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSGISAGQLVRSHMKYNRSSKDVSKAT 582          
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|1050621718|ref|XP_017633676.1| (PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Gossypium arboreum])

HSP 1 Score: 1126.69 bits (2913), Expect = 0.000e+0
Identity = 554/582 (95.19%), Postives = 569/582 (97.77%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKAS 582
            MEAHRL STKPVQ+LKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPD W  EEED+EVLLAKEDARKVPCGQALDCS+PPLPPAAPIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGM+RAPCVRFG AKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMSA++AGQLV+SHMKYNRSSKDVSKA+
Sbjct:    1 MEAHRLSSTKPVQALKPTKKIPLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMSRAPCVRFGNAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSAISAGQLVRSHMKYNRSSKDVSKAT 582          
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Match: gi|1347710636|gb|PPS08096.1| (hypothetical protein GOBAR_AA12555 [Gossypium barbadense])

HSP 1 Score: 1122.46 bits (2902), Expect = 0.000e+0
Identity = 553/582 (95.02%), Postives = 567/582 (97.42%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKAS 582
            MEAHRL STKPVQ+LKPTKKI LEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPD W  EEED+EVLLAKEDARKVPCGQALDCS+PPLPPAAPIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLE KLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFG AKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMSA++AGQLV+SHMKYNRSSKDVSKA+
Sbjct:    1 MEAHRLSSTKPVQALKPTKKISLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLELKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGNAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSAISAGQLVRSHMKYNRSSKDVSKAT 582          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A1U8MR75_GOSHI (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium hirsutum OX=3635 GN=LOC107939234 PE=3 SV=1)

HSP 1 Score: 1158.28 bits (2995), Expect = 0.000e+0
Identity = 563/585 (96.24%), Postives = 572/585 (97.78%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFS+IIAI SFFASFIYLLGFFGIDFVQSLVFQPSPD W   DEEEDNEVLLAKEDARKVPCGQALDCS+PPLPPAAPIVTTQKVCDEKP  VI EEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSRMLA IVA AVLAGELSLMSA+AAGQLVKSHMKYNRS+KDVSKASS
Sbjct:    1 MEAPRLYSTKPVQSLKPTKKIPLEEDLGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSDIIAIFSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDNEVLLAKEDARKVPCGQALDCSLPPLPPAAPIVTTQKVCDEKPLMVIPEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRMLAAIVASAVLAGELSLMSAIAAGQLVKSHMKYNRSTKDVSKASS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A1U8JSM7_GOSHI (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium hirsutum OX=3635 GN=LOC107908971 PE=3 SV=1)

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 563/585 (96.24%), Postives = 571/585 (97.61%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKP QSLKP+KKIPLEED GKASDALPLPL+LTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPD W   DEEEDNEVLLAKEDAR VPCGQALDCS+PPLPPAAPIVT QKV DEKP TV  EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEA IKGDVVRKVLKTSVES+VELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS
Sbjct:    1 MEAPRLYSTKPAQSLKPSKKIPLEEDHGKASDALPLPLHLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDNEVLLAKEDARMVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVTTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEAIIKGDVVRKVLKTSVESIVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A0D2PXA5_GOSRA (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium raimondii OX=29730 GN=B456_005G215700 PE=3 SV=1)

HSP 1 Score: 1154.43 bits (2985), Expect = 0.000e+0
Identity = 562/585 (96.07%), Postives = 573/585 (97.95%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKP+KKIPLEED GKASDALPLPL+LTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSF ASFIYLLGFFGIDFVQSLVFQPSPD W   DEEED+EVLLAKEDARKVPCGQALDCS+PPLPPAAPIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGI+GPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA IKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS
Sbjct:    1 MEAPRLYSTKPVQSLKPSKKIPLEEDHGKASDALPLPLHLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFLASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGISGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A2P5QUE2_GOSBA (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium barbadense OX=3634 GN=GOBAR_DD24873 PE=3 SV=1)

HSP 1 Score: 1152.12 bits (2979), Expect = 0.000e+0
Identity = 562/585 (96.07%), Postives = 570/585 (97.44%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKP QSLKP+KKIPLEED GKASDALPLPL+LTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSF ASFIYLLGFFGIDFVQSLVFQPSPD W   DEEEDNEVLLAKEDAR VPCGQALDCS+PPLPPAAPIVT QKV DEKP TV  EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA IKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS
Sbjct:    1 MEAPRLYSTKPAQSLKPSKKIPLEEDHGKASDALPLPLHLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFLASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDNEVLLAKEDARMVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVTTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A2P5QUH6_GOSBA (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium barbadense OX=3634 GN=GOBAR_DD24874 PE=3 SV=1)

HSP 1 Score: 1145.18 bits (2961), Expect = 0.000e+0
Identity = 554/583 (95.03%), Postives = 567/583 (97.26%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFS+IIAILSF ASFIYLLGFFGIDFVQSLVFQ SPD W  EEED+EVLLAKEDARKVPCGQALDCS+PPLPP APIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRL GKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGI+GPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMSA+AAGQLVKSHMKYNRS+KDVSKASS
Sbjct:    1 MEAPRLYSTKPVQSLKPTKKIPLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSDIIAILSFLASFIYLLGFFGIDFVQSLVFQSSPDVWIAEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPVAPIVTVQKVVDEKPVTVLTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLIGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGISGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSAIAAGQLVKSHMKYNRSTKDVSKASS 583          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A1U8JU29_GOSHI (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium hirsutum OX=3635 GN=LOC107908972 PE=3 SV=1)

HSP 1 Score: 1143.64 bits (2957), Expect = 0.000e+0
Identity = 554/583 (95.03%), Postives = 567/583 (97.26%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFS+IIAILSF ASFIYLLGFFGIDFVQSLVFQ SPD W  EEED+EVLLAKEDARKVPCGQALDCS+PPLPP APIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLESKLGDCK AAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGI+GPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMSA+AAGQLVKSHMKYNRS+KDVSKASS
Sbjct:    1 MEAPRLYSTKPVQSLKPTKKIPLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSDIIAILSFLASFIYLLGFFGIDFVQSLVFQSSPDVWIAEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPVAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLESKLGDCKMAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGISGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSAIAAGQLVKSHMKYNRSTKDVSKASS 583          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A1U8JND8_GOSHI (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium hirsutum OX=3635 GN=LOC107908973 PE=3 SV=1)

HSP 1 Score: 1128.62 bits (2918), Expect = 0.000e+0
Identity = 556/582 (95.53%), Postives = 569/582 (97.77%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKAS 582
            MEAHRL STKPVQSLKPTKKIPLEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPD W  EEED+EVLLAKE+ARKVPCGQALDCS+PPLPPAAPIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMS ++AGQLV+SHMKYNRSSKDVSKA+
Sbjct:    1 MEAHRLSSTKPVQSLKPTKKIPLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEEEDDEVLLAKEEARKVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSGISAGQLVRSHMKYNRSSKDVSKAT 582          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A2P5XXT4_GOSBA (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium barbadense OX=3634 GN=GOBAR_AA12555 PE=3 SV=1)

HSP 1 Score: 1122.46 bits (2902), Expect = 0.000e+0
Identity = 553/582 (95.02%), Postives = 567/582 (97.42%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKAS 582
            MEAHRL STKPVQ+LKPTKKI LEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPD W  EEED+EVLLAKEDARKVPCGQALDCS+PPLPPAAPIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLE KLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFG AKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMSA++AGQLV+SHMKYNRSSKDVSKA+
Sbjct:    1 MEAHRLSSTKPVQALKPTKKISLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLELKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGNAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSAISAGQLVRSHMKYNRSSKDVSKAT 582          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A1U8MMG8_GOSHI (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium hirsutum OX=3635 GN=LOC107939227 PE=3 SV=1)

HSP 1 Score: 1120.15 bits (2896), Expect = 0.000e+0
Identity = 552/582 (94.85%), Postives = 566/582 (97.25%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKAS 582
            MEAHRL STKPVQ+LKPTKKI LEED GKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPD W  EEED+EVLLAKEDARKVPCGQALDCS+PPLPPAAPIVT QKV DEKP TV+ EEDEEI+KSVVAGTTPSYSLE KLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFG AKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIV AIYIATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMSA++A QLV+SHMKYNRSSKDVSKA+
Sbjct:    1 MEAHRLSSTKPVQALKPTKKISLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEEEDDEVLLAKEDARKVPCGQALDCSLPPLPPAAPIVTVQKVFDEKPVTVLTEEDEEIIKSVVAGTTPSYSLELKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGNAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSAISAAQLVRSHMKYNRSSKDVSKAT 582          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Match: A0A2P5XXK8_GOSBA (3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Gossypium barbadense OX=3634 GN=GOBAR_AA12547 PE=3 SV=1)

HSP 1 Score: 1112.83 bits (2877), Expect = 0.000e+0
Identity = 551/585 (94.19%), Postives = 567/585 (96.92%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA RLYSTKPVQSLKPTKKIPLEED GKASDALPLPL+LTNALFFTLFFSVVYFLLSRWREKIRTST LHVVTFS+IIA+LSFFASFIYLLGFFGIDFVQSLVFQPSPD W   DEE+DNEVLLAKED RKVPCGQALDCS+PPLPPAAPIVT QKV DE+P TV  EEDEE++KSVV GTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDG DYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPD+FETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA IKGDV++KVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIY+ATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KETPGANSR LATIVA AVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKA+S
Sbjct:    1 MEAPRLYSTKPVQSLKPTKKIPLEEDHGKASDALPLPLHLTNALFFTLFFSVVYFLLSRWREKIRTSTALHVVTFSDIIALLSFFASFIYLLGFFGIDFVQSLVFQPSPDVWVAEDEEDDNEVLLAKEDTRKVPCGQALDCSLPPLPPAAPIVTPQKVFDEQPVTVTTEEDEELIKSVVDGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGLDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDNFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIKGDVIKKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYLATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKETPGANSRTLATIVASAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKATS 585          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH2_GOSHI (3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Gossypium hirsutum OX=3635 GN=HMG2 PE=3 SV=1)

HSP 1 Score: 1029.24 bits (2660), Expect = 0.000e+0
Identity = 509/628 (81.05%), Postives = 541/628 (86.15%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEED-PGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWN--DEEEDNEVLLAKEDARKVPCGQALDCSIPPLP------------------------------------------PAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            MEA R  + KPV  LKP+K+ PL ED PGKASDALPLPLYLTNA+FFTLFF+VVYFLLSRWREKIR S PLH VTF EI+AI +F AS IYLLGFFGIDFVQSL+ +PS D W+  D EE+NEVLL +EDAR VPCGQALDCS+P LP                                          P  PIVT+QK+  EK   V  EEDEEI+KSVVAGT PSYSLESKLGDCKRAAAIRREALQRLTG+SLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLL+NGREYSVPMATTEGCLVASTNRGCKAIHLSGGATS+LLKDGMTRAP VRF TAKRAA+LK YLEDP++F+TL+VVFNRSSRFGRLQ IKCAIAGKNLY+RFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA I+GDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVN+GKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+K+  GANSRMLATIV GAVLAGELSLMSALAAGQLVKSHMKYNRSSKD+S  SS
Sbjct:    1 MEASRRSAVKPVIVLKPSKRFPLVEDTPGKASDALPLPLYLTNAVFFTLFFTVVYFLLSRWREKIRASIPLHAVTFPEIVAIFAFVASLIYLLGFFGIDFVQSLIIRPSGDVWSGEDYEEENEVLLHEEDARTVPCGQALDCSVPSLPHMARNVTAQRLFDEKPVRVATEEDARKVSCGQAVDCSLHSLPPRPPIVTSQKLFHEKTVIVTTEEDEEIIKSVVAGTLPSYSLESKLGDCKRAAAIRREALQRLTGRSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLLNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSILLKDGMTRAPVVRFSTAKRAAELKFYLEDPENFDTLAVVFNRSSRFGRLQSIKCAIAGKNLYLRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIEGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKDVAGANSRMLATIVTGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDMSNLSS 628          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH1_GOSHI (3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Gossypium hirsutum OX=3635 GN=HMG1 PE=3 SV=1)

HSP 1 Score: 1015.37 bits (2624), Expect = 0.000e+0
Identity = 494/575 (85.91%), Postives = 525/575 (91.30%), Query Frame = 0
Query:    1 MEAHRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAW--NDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNR 573
            ME HR  ST  ++S KP + I LE+D  KASDALPLPLYLTNA+FFTLFFS VYFLL RWREKIR+STPLHVVTFSEI+AIL+  ASFIYLLGFFGIDFVQSLV +PS D W   D+E ++EVLL  EDAR VPCGQALD SI  L P  PIVT +KV DE P TV+ EEDEEI++SVV G TPSYSLESKL DCKRAAAIRREALQR+TGKSLSGLPLDGFDYESILGQCCEMPVGY QIPVGIAGPLL+NGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLL+DGMTRAP VRFGTAKRAADLKLYLEDP++FETL+ VFNRSSRF RLQ IKCAIAGKNLY+RF+C TGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA I GDVV KVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTA+YIATGQDPAQNVESSHCITMMEAVN GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KE+PGANS +LATIVAGAVLAGELSLMSALAAGQLVKSHMKYNR
Sbjct:    1 METHRRSSTNSIRSHKPARPIALEDDSTKASDALPLPLYLTNAVFFTLFFSAVYFLLCRWREKIRSSTPLHVVTFSEIVAILASVASFIYLLGFFGIDFVQSLVLRPSADVWATEDDEVESEVLLRNEDARHVPCGQALDRSIRSLQPPEPIVTAEKVFDEMPVTVMTEEDEEIIRSVVCGMTPSYSLESKLDDCKRAAAIRREALQRITGKSLSGLPLDGFDYESILGQCCEMPVGYEQIPVGIAGPLLLNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLRDGMTRAPVVRFGTAKRAADLKLYLEDPENFETLACVFNRSSRFARLQSIKCAIAGKNLYLRFSCFTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIINGDVVTKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAVYIATGQDPAQNVESSHCITMMEAVNGGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKESPGANSILLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNR 575          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH_NICSY (3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Nicotiana sylvestris OX=4096 GN=HMGR PE=2 SV=1)

HSP 1 Score: 918.687 bits (2373), Expect = 0.000e+0
Identity = 456/605 (75.37%), Postives = 516/605 (85.29%), Query Frame = 0
Query:    5 RLYSTKPVQSLKPTKKIPLEEDPGK--------------ASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPD-AWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPA---APIVTTQ--KVC--DEKPATVI----AEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            R  S KP     PTK+    E P K              ASDALPLPLYLTN LFFT+FFSV+Y+LLSRWREKIR STPLHVVTFSE++AI S  AS IYLLGFFGI FVQS V + + D  W++E+E++E  L +ED+R+ P    L C+  P PPA    P+V  Q  KV    EKPA ++    +EEDEEI+KSVV G  PSYSLESKLGDCKRAA+IR+EALQR+TGKSL GLPL+GFDYESILGQCCEMP+GYVQIPVGIAGPLL++GREYSVPMATTEGCLVASTNRGCKAI+ SGGATSVLL+DGMTRAPCVRFGTAKRAA+LK ++EDP  FETL+ VFN+SSRF RLQ I+CAIAGKNLY+RF CSTGDAMGMNMVSKGVQNVLD+LQ ++PDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA I  +VV+KVLKT V +LVELNMLKNLTGSAMAGALGGFNAHASNIV+A+YIATGQDPAQN+ESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGAN+E PG+N+R+LATIVAG+VLAGELSLMSA++AGQLVKSHMKYNRS+KDV+KASS
Sbjct:    4 RRRSEKPAY---PTKEFAAGEKPLKPHKQQQEQDNSLLIASDALPLPLYLTNGLFFTMFFSVMYYLLSRWREKIRNSTPLHVVTFSELVAIASLIASVIYLLGFFGIGFVQSFVSRDNNDECWDEEDENDEQFLLEEDSRRGP-ATTLGCTAVPPPPALQIVPMVPPQPSKVAAMSEKPAPLVTPAASEEDEEIIKSVVQGKMPSYSLESKLGDCKRAASIRKEALQRITGKSLEGLPLEGFDYESILGQCCEMPIGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIYASGGATSVLLRDGMTRAPCVRFGTAKRAAELKFFVEDPVKFETLAAVFNQSSRFARLQRIQCAIAGKNLYMRFVCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATGQDPAQNIESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANREVPGSNARLLATIVAGSVLAGELSLMSAISAGQLVKSHMKYNRSTKDVTKASS 604          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH2_CAPAN (3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Capsicum annuum OX=4072 GN=HMGR2 PE=2 SV=1)

HSP 1 Score: 912.909 bits (2358), Expect = 0.000e+0
Identity = 449/596 (75.34%), Postives = 516/596 (86.58%), Query Frame = 0
Query:    6 LYSTKPV----QSLKPTKKIPLEEDPG---KASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQA--LDCSIPPLPPA---APIVTTQKVCD--EKPATVI----AEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            +YS+K      + LKP K+   EED      ASDALPLPLY TN LFFT+FFSV+YFLLSRWREKIR STPLHVVT SE+ AI+S  AS IYLLGFFGI FVQ+ V + + D+W++E+E++E  + +ED+R+ PC  A  L C++P  PPA   APIV  Q      EKPA ++    +EEDEEI+KSVV G  PSYSLESKLGDCKRAA+IR+E LQR+TGKSL GLPLDGF+YESILGQCCEM +GYVQIPVGIAGPLL+NGREYSVPMATTEGCLVASTNRGCKAI+ SGGATS+LL+DGMTRAPCVRFGTAKRAA+LK ++EDP +FETL+ VFN+SSRF RLQ I+CAIAGKNL++RF CSTGDAMGMNMVSKGVQNVLD+LQ ++ DMDVIGIS N+CSDKKPAA+NWIEGRGKSVVCEA I  +VV+KVLKT V +LVELNMLKNLTGSA+AGALGGFNAHASNIV+A+YIATGQDPAQN+ESSHCITMMEAVN+GKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGAN+E PG+N+R+LATIVAG+VLAGELSLMSA++AGQLV SHMKYNRS+KDV+KASS
Sbjct:   11 VYSSKVFAADEKPLKPHKQ-QQEEDNTLLIDASDALPLPLYFTNGLFFTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFVARGNNDSWDEEDENDEQFILEEDSRRGPCAAATTLGCAVPT-PPAKHIAPIVPQQPAVSIAEKPAPLVTPAASEEDEEIIKSVVQGKIPSYSLESKLGDCKRAASIRKEVLQRITGKSLEGLPLDGFNYESILGQCCEMTIGYVQIPVGIAGPLLLNGREYSVPMATTEGCLVASTNRGCKAIYASGGATSILLRDGMTRAPCVRFGTAKRAAELKFFVEDPINFETLANVFNQSSRFARLQRIQCAIAGKNLHMRFVCSTGDAMGMNMVSKGVQNVLDYLQNEYADMDVIGISANFCSDKKPAAVNWIEGRGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSALAGALGGFNAHASNIVSAVYIATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANREAPGSNARLLATIVAGSVLAGELSLMSAISAGQLVNSHMKYNRSTKDVTKASS 604          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH1_HEVBR (3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Hevea brasiliensis OX=3981 GN=HMGR1 PE=2 SV=1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 453/582 (77.84%), Postives = 506/582 (86.94%), Query Frame = 0
Query:    4 HRLYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKP--ATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            HR ++T PV+   PT          KASDALPLPLYLTNA+FFTLFFSV Y+LL RWR+KIR STPLH+VT SEI+AI+S  ASFIYLLGFFGIDFVQS + + S D W+ E+ D   L+  ED R V C  A + S      AAP     K+   +P  A +++EEDE IV SVV G  PSYSLESKLGDCKRAAAIRREALQR+T +SL GLP++GFDYESILGQCCEMPVGYVQIPVGIAGPLL+NGREYSVPMATTEGCLVASTNRGCKAI+LSGGATSVLLKDGMTRAP VRF +A RAA+LK +LEDPD+F+TL+VVFN+SSRF RLQGIKC+IAGKNLYIRF+CSTGDAMGMNMVSKGVQNVL+FLQ+DF DMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA IK +VV+KVLKT+V SLVELNMLKNL GSA+AGALGGFNAHA NIV+AI+IATGQDPAQNVESSHCITMMEAVN+GKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKE+PG+NSR+LA IVAG+VLAGELSLMSA+AAGQLVKSHMKYNRSSKD+SKA+S
Sbjct:    9 HRKHAT-PVEDRSPTTP--------KASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRNSTPLHIVTLSEIVAIVSLIASFIYLLGFFGIDFVQSFIARASHDVWDLEDTDPNYLI-DEDHRLVTCPPA-NISTKTTIIAAP----TKLPTSEPLIAPLVSEEDEMIVNSVVDGKIPSYSLESKLGDCKRAAAIRREALQRMTRRSLEGLPVEGFDYESILGQCCEMPVGYVQIPVGIAGPLLLNGREYSVPMATTEGCLVASTNRGCKAIYLSGGATSVLLKDGMTRAPVVRFASATRAAELKFFLEDPDNFDTLAVVFNKSSRFARLQGIKCSIAGKNLYIRFSCSTGDAMGMNMVSKGVQNVLEFLQSDFSDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIKEEVVKKVLKTNVASLVELNMLKNLAGSAVAGALGGFNAHAGNIVSAIFIATGQDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKESPGSNSRLLAAIVAGSVLAGELSLMSAIAAGQLVKSHMKYNRSSKDMSKAAS 575          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH1_SOLTU (3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Solanum tuberosum OX=4113 GN=HMG1 PE=2 SV=1)

HSP 1 Score: 911.753 bits (2355), Expect = 0.000e+0
Identity = 446/589 (75.72%), Postives = 515/589 (87.44%), Query Frame = 0
Query:    6 LYSTKPVQSLKPTKKIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQA--LDCSIPPLPPA---APIVTTQ--KVC---DEKPATVI----AEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSK 580
            LY++K   + +P K+   E    KASDALPLPLYLTN LFFT+FFSV+YFLL RWREKIR S PLHVVT SE++A++S  AS IYLLGFFGI FVQS V + + D+W+ E+E+ E L+ +ED+R+ PC  A  L C +PP PP    AP+V  Q  KV     EKP+ +I    +E+DEEI++SVV G TPSYSLESKLGDC RAA+IR+EALQR+TGKSL GLPL+GFDY SILGQCCEMPVGYVQIPVGIAGPLL++GREYSVPMATTEGCLVASTNRGCKAI +SGGA SVLL+DGMTRAP VRF TAKRAA+LK ++EDP +FETLS++FN+SSRF RLQGI+CAIAGKNLYI F+CSTGDAMGMNMVSKGVQNVLD+LQ+++PDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA IK +VV+KVLKT V +LVELNMLKNLTGSAMAGALGGFNAHASNIV+A+Y+ATGQDPAQNVESSHCITMMEAVN+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGAN++ PG+N+R+LATIVAG+VLAGELSLMSA++AGQLVKSHMKYNRS KD+SK
Sbjct:   11 LYTSKDASAGEPLKQ--QEVSSPKASDALPLPLYLTNGLFFTMFFSVMYFLLVRWREKIRNSIPLHVVTLSELLAMVSLIASVIYLLGFFGIGFVQSFVSRSNSDSWDIEDENAEQLIIEEDSRRGPCAAATTLGCVVPP-PPVRKIAPMVPQQPAKVALSQTEKPSPIIMPALSEDDEEIIQSVVQGKTPSYSLESKLGDCMRAASIRKEALQRITGKSLEGLPLEGFDYSSILGQCCEMPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIFVSGGADSVLLRDGMTRAPVVRFTTAKRAAELKFFVEDPLNFETLSLMFNKSSRFARLQGIQCAIAGKNLYITFSCSTGDAMGMNMVSKGVQNVLDYLQSEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIKEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANRDAPGSNARLLATIVAGSVLAGELSLMSAISAGQLVKSHMKYNRSIKDISK 596          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH_CAMAC (3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Camptotheca acuminata OX=16922 PE=3 SV=1)

HSP 1 Score: 894.034 bits (2309), Expect = 0.000e+0
Identity = 449/580 (77.41%), Postives = 501/580 (86.38%), Query Frame = 0
Query:   10 KPVQSLKPTK--KIPLEEDPGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLA--KEDARKVPCGQA-LDCSIPPLPPAAPIVTTQKVCDEKPATV-IAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            KP Q   PTK   + L + P KASDALPLPLY+TN +FFTLFF+VVY+LL RWREKIR STPLHVVT SEI AI +F ASFIYLLGFFGI  VQ    + S D     ++D +V     KED R VPC  A +DC +PP+ P        KV D  P +   +EEDEEI+KSVV GTTPSY+LESKLGD  RAAAIRREALQR+T KSL+GLPLDGFDY+SILGQCCEMPVGYVQIPVGIAGPLL++GREYSVPMATTEGCLVASTNRGCKAI   GGATSVLL+D MTRAP VRFG+AKRAADLK +LE+P +FETL+ VFN SSRFG+LQ IKCAIAGKNLY+R++CSTGDAMGMNM+SKGVQNVLDFLQ DFPDMDVIGISGNYCSDKKPAA+NWIEGRGKSVVCEA IK +VV+KVLKT+V SLVELNMLKNLTGSAMAGALGGFNAHASNIV+A+Y+ATGQDPAQNVESSHCITMMEA+N+GKDLH+SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+KE PG+N+R+LATIVAG+VLAGELSLMSA+AAGQLV SHMKYNRS+KDV+KASS
Sbjct:   26 KPKQ---PTKVDAVDLPDSP-KASDALPLPLYITNGVFFTLFFTVVYYLLVRWREKIRNSTPLHVVTLSEIAAIFTFVASFIYLLGFFGIGLVQPFTSRSSHDDVWGVDDDEDVDEIVLKEDTRTVPCAAAPVDCPLPPIKP--------KVVDPVPISPPSSEEDEEIIKSVVEGTTPSYALESKLGDSHRAAAIRREALQRMTKKSLAGLPLDGFDYDSILGQCCEMPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIFACGGATSVLLRDAMTRAPVVRFGSAKRAADLKFFLENPLNFETLAAVFNSSSRFGKLQNIKCAIAGKNLYMRYSCSTGDAMGMNMISKGVQNVLDFLQDDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEAVIKEEVVKKVLKTNVASLVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQDPAQNVESSHCITMMEAINDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKEAPGSNARLLATIVAGSVLAGELSLMSAIAAGQLVNSHMKYNRSNKDVTKASS 593          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH_CATRO (3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Catharanthus roseus OX=4058 GN=HMGR PE=2 SV=1)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 425/564 (75.35%), Postives = 494/564 (87.59%), Query Frame = 0
Query:   29 KASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPP--LPPAAPIVTTQK---VCDEKPATVI----AEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            ++SD LPLPLYL N +FFTLFFSV+YFLL+RWREKIR +TPLHVVT SE+ A+ S  AS IYL+ FFG+DFVQSL+++P+ + W  EEE    +L  ED+R       L C++PP  +P  AP+V  Q    V  EKPA +I    +EEDE+I+K+VVAG  PSYSLESKLGDCKRAA IRREALQR+TGKSL GLPL+GFDY SILGQCCEMPVGYVQ+PVGIAGPLL++GREY +PMATTEGCLVASTNRGCKAI  SGGA SVLL+DGMTRAP VRFGTAKRAA+LK Y+ED  +FET+SVVFN+SSRF +LQ ++CAIAGKNLYIRF+CSTGDAMGMNMVSKGVQNVL+FLQTD+PDMDV+GISGN+C+DKKPAA+NWIEGRGKSVVCEA IK ++V+ VLKT V +L+ELNM+KNL GSA+AGALGGFNAHASNIV+AI+IATGQDPAQNVESS CITMMEAVN+GKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+K++PGANSR+LATIVAG+VLAGELSLMSA++AGQLV+SHMKYNRSSKD++  +S
Sbjct:   35 RSSDVLPLPLYLANGVFFTLFFSVMYFLLTRWREKIRNATPLHVVTLSELAALASLIASVIYLVSFFGLDFVQSLIYKPNNEGWEIEEE----ILMVEDSRNGTNCTTLGCAVPPPSVPKIAPVVPQQPSKMVIIEKPAPLITPQNSEEDEDIIKAVVAGKIPSYSLESKLGDCKRAAGIRREALQRITGKSLEGLPLEGFDYASILGQCCEMPVGYVQLPVGIAGPLLLDGREYMLPMATTEGCLVASTNRGCKAILASGGANSVLLRDGMTRAPVVRFGTAKRAAELKFYMEDTQNFETISVVFNKSSRFAKLQSVQCAIAGKNLYIRFSCSTGDAMGMNMVSKGVQNVLEFLQTDYPDMDVLGISGNFCADKKPAAVNWIEGRGKSVVCEAIIKEEIVKTVLKTEVAALIELNMVKNLAGSAIAGALGGFNAHASNIVSAIFIATGQDPAQNVESSQCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKDSPGANSRLLATIVAGSVLAGELSLMSAISAGQLVRSHMKYNRSSKDITNIAS 594          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH3_SOLTU (3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 OS=Solanum tuberosum OX=4113 GN=HMG3 PE=2 SV=1)

HSP 1 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 430/583 (73.76%), Postives = 494/583 (84.73%), Query Frame = 0
Query:   10 KPVQSLKPTKKI-------PLEEDPG-KASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATVI----AEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSK 580
            +PV+ L P++ I       P  +D   KASDALPLPLYLTN LFFT+FFSV+YFLL RWREKIR   PLHV+ FSE++A++S  AS IYLLGFFGI FVQS V + + D+W+ E+E  E              Q +D ++ P P    I        EK A +I    +E+DE ++KSVV G  PSYSLESKLGDCKRAA IR+EALQR +GKSL GLPLDGFDYESILGQCCEMP+GY+QIPVGIAGPLL+NG+E+SVPMATTEGCLVASTNRGCKAI++SGGATSVL +D MTRAP VRFG+AKRAA+LK ++EDP +FETLSVVFN+SSRF RLQ I+CAIAGKNLY+RF+CSTGDAMGMNMVSKGVQNVLD+LQ ++PDMD+IGISGNYCSDKKPAA+NWIEGRGKSVVCEA IK DVV+KVLKT V +LVELNMLKNLTGSAMAGALGGFNAHASNIV+A+Y+ATGQDPAQN+ESSHCITMMEAVN+GKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGAN+E PG+N+R+LATIVAG+VLAGELSLMSA++AGQLVKSHMKYNRS KDV+K
Sbjct:    6 RPVKPLYPSEHISSGEPLKPHNQDSSVKASDALPLPLYLTNGLFFTMFFSVMYFLLHRWREKIRNGIPLHVLNFSELVAMVSLIASVIYLLGFFGIGFVQSFVSKGNNDSWDVEDESPE--------------QFIDRTVTPPPVRRNIPMKSVPVAEKTAQIITPFSSEDDEVVIKSVVEGRIPSYSLESKLGDCKRAAFIRKEALQRSSGKSLEGLPLDGFDYESILGQCCEMPIGYIQIPVGIAGPLLLNGKEFSVPMATTEGCLVASTNRGCKAIYVSGGATSVLFRDAMTRAPVVRFGSAKRAAELKFFVEDPMNFETLSVVFNKSSRFARLQNIQCAIAGKNLYMRFSCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDIIGISGNYCSDKKPAAVNWIEGRGKSVVCEAIIKEDVVKKVLKTEVATLVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANREAPGSNARLLATIVAGSVLAGELSLMSAISAGQLVKSHMKYNRSCKDVTK 574          
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Match: HMDH2_SOLLC (3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Solanum lycopersicum OX=4081 GN=HMG2 PE=3 SV=1)

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 434/566 (76.68%), Postives = 496/566 (87.63%), Query Frame = 0
Query:   30 ASDALPLPLYLT-NALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQA--LDCSIPPLPPA---APIVTTQKVCD--EKPATVIAE----EDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKASS 583
            ASDALPLPLYLT N LFFT+FFSV+YFLLSRWREKIR STPLHVVT SE+ AI+S  AS IYLLGFFGI FVQ+ V + + D+W   +E++E  L KED+R   CG A  L C++P  PPA   AP+   Q      EKPA +I      EDEEI+KSVV G  PSYSLESKLGDCKRAA+IR+E +QR+TGKSL GLPL+GF+YESILGQCCEMP+GYVQIPVGIAGPLL+NG+E+SVPMATTEGCLVASTNRGCKAI+ SGGAT +LL+DGMTRAPCVRFGTAKRAA+LK ++EDP  FE+L+ VFN+SSRF RLQ I+CAIAGKNLY+R  CSTGDAMGMNMVSKGVQNVLD+LQ ++PDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA I  +VV+KVLKT V +LVELNMLKNLTGSAMAGALGGFNAHASNIV+A++IATGQDPAQN+ESSHCITMMEAVN+GKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGAN+E PG+N+R+LAT+VAG+VLAGELSLMSA+++GQLV SHMKYNRS+KDV+KASS
Sbjct:   44 ASDALPLPLYLTTNGLFFTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFVSRGNNDSW---DENDEEFLLKEDSR---CGPATTLGCAVPA-PPARQIAPMAPPQPSMSMVEKPAPLITSASSGEDEEIIKSVVQGKIPSYSLESKLGDCKRAASIRKEVMQRITGKSLEGLPLEGFNYESILGQCCEMPIGYVQIPVGIAGPLLLNGKEFSVPMATTEGCLVASTNRGCKAIYASGGATCILLRDGMTRAPCVRFGTAKRAAELKFFVEDPIKFESLANVFNQSSRFARLQRIQCAIAGKNLYMRLCCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVFIATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANREAPGSNARLLATVVAGSVLAGELSLMSAISSGQLVNSHMKYNRSTKDVTKASS 602          
BLAST of Kirkii_Juiced.00g075700.m01 vs. TAIR10
Match: AT1G76490.1 (| Symbols: HMG1, HMGR1, AtHMGR1 | hydroxy methylglutaryl CoA reductase 1 | chr1:28695801-28698206 FORWARD LENGTH=642)

HSP 1 Score: 862.062 bits (2226), Expect = 0.000e+0
Identity = 416/557 (74.69%), Postives = 482/557 (86.54%), Query Frame = 0
Query:   27 PGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDCSIPPLPPAAPIVTTQKVCDEKPATV--IAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKA 581
            P KASDALPLPLYLTNA+FFTLFFSV Y+LL RWR+KIR +TPLHVVT +E+ AI++  ASFIYLLGFFGIDFVQS + + S DAW+  +      +  +D R V C            P  PIV+  K+ + +P     + EEDEEIVKSV+ G  PSYSLES+LGDCKRAA+IRREALQR+TG+S+ GLPLDGFDYESILGQCCEMPVGY+QIPVGIAGPLL++G EYSVPMATTEGCLVASTNRGCKA+ +SGGATS +LKDGMTRAP VRF +A+RA++LK +LE+P++F+TL+VVFNRSSRF RLQ +KC IAGKN Y+RF CSTGDAMGMNMVSKGVQNVL++L  DFPDMDVIGISGN+CSDKKPAA+NWIEGRGKSVVCEA I+G++V KVLKTSV +LVELNMLKNL GSA+AG+LGGFNAHASNIV+A++IATGQDPAQNVESS CITMMEA+N+GKD+HISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA+ E+PG N+R LATIVAGAVLAGELSLMSA+AAGQLV+SHMKYNRSS+D+S A
Sbjct:   94 PPKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSFISRASGDAWDLADT-----IDDDDHRLVTCS-----------PPTPIVSVAKLPNPEPIVTESLPEEDEEIVKSVIDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSIEGLPLDGFDYESILGQCCEMPVGYIQIPVGIAGPLLLDGYEYSVPMATTEGCLVASTNRGCKAMFISGGATSTVLKDGMTRAPVVRFASARRASELKFFLENPENFDTLAVVFNRSSRFARLQSVKCTIAGKNAYVRFCCSTGDAMGMNMVSKGVQNVLEYLTDDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAVIRGEIVNKVLKTSVAALVELNMLKNLAGSAVAGSLGGFNAHASNIVSAVFIATGQDPAQNVESSQCITMMEAINDGKDIHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASTESPGMNARRLATIVAGAVLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGA 634          
BLAST of Kirkii_Juiced.00g075700.m01 vs. TAIR10
Match: AT2G17370.1 (| Symbols: HMG2, HMGR2 | 3-hydroxy-3-methylglutaryl-CoA reductase 2 | chr2:7550007-7551981 FORWARD LENGTH=562)

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 399/555 (71.89%), Postives = 463/555 (83.42%), Query Frame = 0
Query:   29 KASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTSTPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDAWNDEEEDNEVLLAKEDARKVPCGQALDC-SIPPLPPAAPIVTTQKVCDEKPATVIAEEDEEIVKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLVNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLKDGMTRAPCVRFGTAKRAADLKLYLEDPDHFETLSVVFNRSSRFGRLQGIKCAIAGKNLYIRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNYCSDKKPAAINWIEGRGKSVVCEATIKGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNEGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKETPGANSRMLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKAS 582
            KASDALPLPLYLTN  F +LFF+ VYFLLSRWREKIR STPLHVV  SEI A++ F ASFIYLLGF GID    L+F+ S D   D+   N+ +        +PC Q+LDC  + P+ P         V   + + + + EDEEIVK V+ GT PSYSLE+KLGDCKRAAAIRREA+QR+TGKSL+GLPL+GFDY SILGQCCEMPVGYVQIPVGIAGPLL++G EYSVPMATTEGCLVASTNRG KAIHLSGGA SVL+KD MTRAP VRF +A+RAA +  YL+DP +FE LS++FN+SSRF RLQ I C IAG+NLY RF CSTGDAMGMNMVSKGVQNVLDF++++FPDMDVIGISGNYCSDKK +A+NWIEGRGK VVCEA IK ++V KVLKTSVE+LVELN LKNL GSAMAG+LGGFNAH+SNIV+A++IATGQDPAQNVESSHC+TM+  + +G DLHISV+MP IEVGTVGGGTQLASQ+ACLNLLGVKG+N E PG+N++ LA IVAG+VLAGELSLMSA+AAGQLVKSHMKYNRSS+D+  +S
Sbjct:   28 KASDALPLPLYLTNTFFLSLFFATVYFLLSRWREKIRNSTPLHVVDLSEICALIGFVASFIYLLGFCGID----LIFRSSSD---DDVWVNDGM--------IPCNQSLDCREVLPIKP-------NSVDPPRESELDSVEDEEIVKLVIDGTIPSYSLETKLGDCKRAAAIRREAVQRITGKSLTGLPLEGFDYNSILGQCCEMPVGYVQIPVGIAGPLLLDGVEYSVPMATTEGCLVASTNRGFKAIHLSGGAFSVLVKDAMTRAPVVRFPSARRAALVMFYLQDPSNFERLSLIFNKSSRFARLQSITCTIAGRNLYPRFACSTGDAMGMNMVSKGVQNVLDFVKSEFPDMDVIGISGNYCSDKKASAVNWIEGRGKHVVCEAFIKAEIVEKVLKTSVEALVELNTLKNLVGSAMAGSLGGFNAHSSNIVSAVFIATGQDPAQNVESSHCMTMI--LPDGDDLHISVSMPCIEVGTVGGGTQLASQAACLNLLGVKGSNNEKPGSNAQQLARIVAGSVLAGELSLMSAIAAGQLVKSHMKYNRSSRDIGPSS 558          
The following BLAST results are available for this feature:
BLAST of Kirkii_Juiced.00g075700.m01 vs. NCBI nr
Analysis Date: 2019-04-12 (BLASTP of ISU v3.0.a3 Gossypioides kirkii proteins vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
gi|1028969012|ref|XP_016728024.1|0.000e+096.24PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A r... [more]
gi|1029063068|ref|XP_016691783.1|0.000e+096.24PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A r... [more]
gi|823160128|ref|XP_012479906.1|0.000e+096.07PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A r... [more]
gi|1344104039|gb|PPD78182.1|0.000e+096.07hypothetical protein GOBAR_DD24873 [Gossypium barb... [more]
gi|1344104040|gb|PPD78183.1|0.000e+095.03hypothetical protein GOBAR_DD24874 [Gossypium barb... [more]
gi|1029063070|ref|XP_016691784.1|0.000e+095.03PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A r... [more]
gi|1050621520|ref|XP_017633578.1|0.000e+095.73PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A r... [more]
gi|1029063072|ref|XP_016691785.1|0.000e+095.53PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A r... [more]
gi|1050621718|ref|XP_017633676.1|0.000e+095.19PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A r... [more]
gi|1347710636|gb|PPS08096.1|0.000e+095.02hypothetical protein GOBAR_AA12555 [Gossypium barb... [more]
back to top
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy TrEMBL
Analysis Date: 2019-04-12 (BLASTP of ISU v3.0.a3 Gossypioides kirkii proteins vs UniProt TrEMBL)
Total hits: 10
Match NameE-valueIdentityDescription
A0A1U8MR75_GOSHI0.000e+096.243-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
A0A1U8JSM7_GOSHI0.000e+096.243-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
A0A0D2PXA5_GOSRA0.000e+096.073-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
A0A2P5QUE2_GOSBA0.000e+096.073-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
A0A2P5QUH6_GOSBA0.000e+095.033-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
A0A1U8JU29_GOSHI0.000e+095.033-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
A0A1U8JND8_GOSHI0.000e+095.533-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
A0A2P5XXT4_GOSBA0.000e+095.023-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
A0A1U8MMG8_GOSHI0.000e+094.853-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
A0A2P5XXK8_GOSBA0.000e+094.193-hydroxy-3-methylglutaryl coenzyme A reductase OS... [more]
back to top
BLAST of Kirkii_Juiced.00g075700.m01 vs. ExPASy Swiss-Prot
Analysis Date: 2019-04-12 (BLASTP of ISU v3.0.a3 Gossypioides kirkii proteins vs UniProt Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
HMDH2_GOSHI0.000e+081.053-hydroxy-3-methylglutaryl-coenzyme A reductase 2 ... [more]
HMDH1_GOSHI0.000e+085.913-hydroxy-3-methylglutaryl-coenzyme A reductase 1 ... [more]
HMDH_NICSY0.000e+075.373-hydroxy-3-methylglutaryl-coenzyme A reductase OS... [more]
HMDH2_CAPAN0.000e+075.343-hydroxy-3-methylglutaryl-coenzyme A reductase 2 ... [more]
HMDH1_HEVBR0.000e+077.843-hydroxy-3-methylglutaryl-coenzyme A reductase 1 ... [more]
HMDH1_SOLTU0.000e+075.723-hydroxy-3-methylglutaryl-coenzyme A reductase 1 ... [more]
HMDH_CAMAC0.000e+077.413-hydroxy-3-methylglutaryl-coenzyme A reductase OS... [more]
HMDH_CATRO0.000e+075.353-hydroxy-3-methylglutaryl-coenzyme A reductase OS... [more]
HMDH3_SOLTU0.000e+073.763-hydroxy-3-methylglutaryl-coenzyme A reductase 3 ... [more]
HMDH2_SOLLC0.000e+076.683-hydroxy-3-methylglutaryl-coenzyme A reductase 2 ... [more]
back to top
BLAST of Kirkii_Juiced.00g075700.m01 vs. TAIR10
Analysis Date: 2019-04-12 (BLASTP of ISU v3.0.a3 Gossypioides kirkii proteins vs arabidopsis TAIR10)
Total hits: 2
Match NameE-valueIdentityDescription
AT1G76490.10.000e+074.69| Symbols: HMG1, HMGR1, AtHMGR1 | hydroxy methylgl... [more]
AT2G17370.10.000e+071.89| Symbols: HMG2, HMGR2 | 3-hydroxy-3-methylglutary... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for ISU v3.0.a3 Gossypioides kirkii proteins
Date Performed: 2019-04-12
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002202Hydroxymethylglutaryl-CoA reductase, class I/IIPRINTSPR00071HMGCOARDTASEcoord: 387..412
score: 87.26
coord: 492..513
score: 85.04
coord: 347..365
score: 81.8
coord: 438..464
score: 78.55
coord: 256..276
score: 91.87
coord: 229..250
score: 71.97
IPR002202Hydroxymethylglutaryl-CoA reductase, class I/IIPFAMPF00368HMG-CoA_redcoord: 197..573
e-value: 2.0E-146
score: 487.7
IPR002202Hydroxymethylglutaryl-CoA reductase, class I/IIPANTHERPTHR105723-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASEcoord: 23..582
IPR002202Hydroxymethylglutaryl-CoA reductase, class I/IIPROSITEPS50065HMG_COA_REDUCTASE_4coord: 169..573
score: 141.791
IPR023074Hydroxymethylglutaryl-CoA reductase, class I/II, catalytic domain superfamilyGENE3D3.90.770.10coord: 240..560
e-value: 3.6E-146
score: 488.2
IPR009023Hydroxymethylglutaryl-CoA reductase, class I/II, NAD/NADP-binding domain superfamilyGENE3D3.30.70.420coord: 290..406
e-value: 3.6E-146
score: 488.2
IPR009023Hydroxymethylglutaryl-CoA reductase, class I/II, NAD/NADP-binding domain superfamilySUPERFAMILY55035NAD-binding domain of HMG-CoA reductasecoord: 290..406
IPR004554Hydroxymethylglutaryl-CoA reductase, eukaryotic/archaeal typeTIGRFAMTIGR00533TIGR00533coord: 169..573
e-value: 3.3E-163
score: 541.3
IPR004554Hydroxymethylglutaryl-CoA reductase, eukaryotic/archaeal typeCDDcd00643HMG-CoA_reductase_classIcoord: 170..573
e-value: 0.0
score: 693.912
IPR023282Hydroxymethylglutaryl-CoA reductase, N-terminalGENE3D1.10.3270.10coord: 164..239
e-value: 1.3E-20
score: 75.0
NoneNo IPR availablePANTHERPTHR10572:SF223-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE 2coord: 23..582
IPR023076Hydroxymethylglutaryl-CoA reductase, class I/II, conserved sitePROSITEPS01192HMG_COA_REDUCTASE_3coord: 558..571
IPR023076Hydroxymethylglutaryl-CoA reductase, class I/II, conserved sitePROSITEPS00066HMG_COA_REDUCTASE_1coord: 349..363
IPR023076Hydroxymethylglutaryl-CoA reductase, class I/II, conserved sitePROSITEPS00318HMG_COA_REDUCTASE_2coord: 504..511
IPR009029Hydroxymethylglutaryl-CoA reductase, class I/II, substrate-binding domain superfamilySUPERFAMILY56542Substrate-binding domain of HMG-CoA reductasecoord: 160..562

Properties
Property NameValue
Original IDKirkii_Juiced.00g075700.m01
Original nameKirkii_Juiced.00g075700
Sequences
The following sequences are available for this feature:

mRNA sequence

>Kirkii_Juiced.00g075700.m01_ISU-kirkii_v3.0.a3 ID=Kirkii_Juiced.00g075700.m01_ISU-kirkii_v3.0.a3|Name=Kirkii_Juiced.00g075700.m01|organism=Gossypioides kirkii|type=mRNA|length=1752bp
ATGGAGGCTCACCGGCTGTATTCGACTAAACCTGTTCAATCTCTCAAGCC
CACGAAGAAGATTCCTTTAGAGGAAGATCCCGGTAAAGCCTCCGACGCAT
TGCCGCTTCCCTTGTACCTAACCAATGCCCTGTTCTTCACCCTCTTCTTC
TCGGTGGTTTATTTTCTTCTTTCCCGTTGGCGTGAGAAGATTCGTACCTC
CACGCCTCTCCATGTCGTCACCTTTTCCGAGATCATCGCCATTCTCTCAT
TTTTCGCCTCCTTTATTTACCTTTTGGGTTTCTTTGGGATTGACTTCGTT
CAATCTTTGGTTTTCCAACCATCGCCTGACGCTTGGAATGACGAGGAAGA
GGATAATGAAGTTTTGCTCGCGAAGGAAGACGCCCGTAAGGTCCCTTGTG
GACAAGCTCTCGATTGCTCGATTCCACCTCTGCCTCCTGCCGCACCAATC
GTGACTACCCAGAAGGTGTGCGATGAAAAGCCTGCGACGGTTATAGCAGA
GGAAGATGAAGAAATAGTTAAATCTGTAGTGGCTGGAACAACCCCTTCGT
ATTCCTTGGAATCCAAATTGGGTGATTGCAAGAGGGCGGCTGCAATCAGG
CGGGAAGCGTTGCAAAGATTAACAGGGAAGTCGTTATCTGGATTGCCCTT
GGATGGGTTTGATTACGAGTCGATTTTAGGGCAGTGTTGTGAGATGCCGG
TTGGCTACGTGCAGATTCCCGTTGGAATTGCTGGGCCTTTGTTGGTTAAT
GGAAGAGAGTACTCGGTTCCTATGGCAACCACGGAAGGGTGCTTGGTGGC
TAGCACTAATAGGGGCTGTAAGGCTATTCATTTGTCTGGTGGAGCTACAA
GTGTTCTATTGAAAGATGGTATGACTAGAGCTCCATGTGTAAGGTTCGGT
ACAGCAAAAAGGGCAGCTGATTTGAAGTTGTATTTGGAGGACCCTGATCA
TTTCGAGACCTTGTCTGTTGTTTTCAACAGATCAAGTAGATTTGGCAGGC
TCCAAGGTATCAAATGTGCAATTGCTGGAAAGAATCTGTATATTAGATTC
ACTTGCAGTACAGGTGATGCTATGGGGATGAACATGGTTTCCAAGGGAGT
CCAAAACGTTTTGGATTTCCTTCAAACTGATTTCCCTGACATGGATGTCA
TTGGCATCTCTGGAAACTATTGTTCCGACAAAAAACCGGCTGCTATAAAT
TGGATTGAAGGACGAGGCAAATCTGTTGTCTGTGAAGCCACCATTAAGGG
TGATGTGGTTAGGAAGGTCTTGAAGACAAGTGTGGAATCTCTGGTTGAGC
TTAACATGCTTAAGAACCTTACTGGATCAGCTATGGCTGGAGCTCTGGGT
GGATTCAACGCTCACGCCAGTAACATCGTCACTGCAATCTACATAGCTAC
GGGCCAAGATCCGGCTCAAAACGTCGAGAGCTCTCATTGCATCACTATGA
TGGAAGCTGTTAACGAGGGCAAGGACCTCCACATCTCTGTCACAATGCCT
TCCATCGAGGTTGGTACTGTTGGTGGTGGAACACAGCTTGCATCTCAGTC
AGCCTGTTTGAACTTACTTGGAGTGAAGGGTGCAAATAAAGAGACACCTG
GAGCAAACTCTAGAATGCTGGCAACCATTGTAGCAGGTGCTGTCCTAGCC
GGGGAGCTGTCACTCATGTCAGCACTTGCTGCAGGGCAATTAGTTAAGAG
CCATATGAAATACAATAGGTCAAGTAAGGATGTGTCCAAGGCTTCTTCAT
AG
back to top

mRNA from alignment at KI_03:38546016..38548043-

Legend: CDSexonpolypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
>Kirkii_Juiced.00g075700.m01_ISU-kirkii_v3.0.a3 ID=Kirkii_Juiced.00g075700.m01_ISU-kirkii_v3.0.a3|Name=Kirkii_Juiced.00g075700.m01|organism=Gossypioides kirkii|type=mRNA|length=2028bp|location=Sequence derived from alignment at KI_03:38546016..38548043- (Gossypioides kirkii)
ATGGAGGCTCACCGGCTGTATTCGACTAAACCTGTTCAATCTCTCAAGCC CACGAAGAAGATTCCTTTAGAGGAAGATCCCGGTAAAGCCTCCGACGCAT TGCCGCTTCCCTTGTACCTAACCAATGCCCTGTTCTTCACCCTCTTCTTC TCGGTGGTTTATTTTCTTCTTTCCCGTTGGCGTGAGAAGATTCGTACCTC CACGCCTCTCCATGTCGTCACCTTTTCCGAGATCATCGCCATTCTCTCAT TTTTCGCCTCCTTTATTTACCTTTTGGGTTTCTTTGGGATTGACTTCGTT CAATCTTTGGTTTTCCAACCATCGCCTGACGCTTGGAATGACGAGGAAGA GGATAATGAAGTTTTGCTCGCGAAGGAAGACGCCCGTAAGGTCCCTTGTG GACAAGCTCTCGATTGCTCGATTCCACCTCTGCCTCCTGCCGCACCAATC GTGACTACCCAGAAGGTGTGCGATGAAAAGCCTGCGACGGTTATAGCAGA GGAAGATGAAGAAATAGTTAAATCTGTAGTGGCTGGAACAACCCCTTCGT ATTCCTTGGAATCCAAATTGGGTGATTGCAAGAGGGCGGCTGCAATCAGG CGGGAAGCGTTGCAAAGATTAACAGGGAAGTCGTTATCTGGATTGCCCTT GGATGGGTTTGATTACGAGTCGATTTTAGGGCAGTGTTGTGAGATGCCGG TTGGCTACGTGCAGATTCCCGTTGGAATTGCTGGGCCTTTGTTGGTTAAT GGAAGAGAGTACTCGGTTCCTATGGCAACCACGGAAGGGTGCTTGGTGGC TAGCACTAATAGGGGCTGTAAGGCTATTCATTTGTCTGGTGGAGCTACAA GTGTTCTATTGAAAGATGGTATGACTAGAGCTCCATGTGTAAGGTTCGGT ACAGCAAAAAGGGCAGCTGATTTGAAGTTGTATTTGGAGGACCCTGATCA TTTCGAGACCTTGTCTGTTGTTTTCAACAGGTTTGTGTTGATATTTCTAC AACTCCATATTGATGGATTTAAAATTCAAGCTAGTATTGAAAATTTTGGC TTTTTGGTGGTTGCAGATCAAGTAGATTTGGCAGGCTCCAAGGTATCAAA TGTGCAATTGCTGGAAAGAATCTGTATATTAGATTCACTTGCAGTACAGG TGATGCTATGGGGATGAACATGGTTTCCAAGGGAGTCCAAAACGTTTTGG ATTTCCTTCAAACTGATTTCCCTGACATGGATGTCATTGGCATCTCTGGT GAGTTTCATTTTTTTTTATAGGCTTGCAACTATGTCTTTTACTGTTCGAC ATAGGATCACTGATATTTATGAATTTGTGCATATAGGAAACTATTGTTCC GACAAAAAACCGGCTGCTATAAATTGGATTGAAGGACGAGGCAAATCTGT TGTCTGTGAAGCCACCATTAAGGGTGATGTGGTTAGGAAGGTCTTGAAGA CAAGTGTGGAATCTCTGGTTGAGCTTAACATGCTTAAGAACCTTACTGGA TCAGCTATGGCTGGAGCTCTGGGTGGATTCAACGCTCACGCCAGTAACAT CGTCACTGCAATCTACATAGCTACGGGCCAAGATCCGGCTCAAAACGTCG AGAGCTCTCATTGCATCACTATGATGGAAGCTGTTAACGAGGGCAAGGAC CTCCACATCTCTGTCACAATGCCTTCCATCGAGGTAATTGATTATGTTGC TGTCTGATTATCCATCACAAGGATTTTCATTACCAAAACAGATCATGGGT AAGTCCCTAAGTATATCTGTTGCTGTATCTTTTAGGTTGGTACTGTTGGT GGTGGAACACAGCTTGCATCTCAGTCAGCCTGTTTGAACTTACTTGGAGT GAAGGGTGCAAATAAAGAGACACCTGGAGCAAACTCTAGAATGCTGGCAA CCATTGTAGCAGGTGCTGTCCTAGCCGGGGAGCTGTCACTCATGTCAGCA CTTGCTGCAGGGCAATTAGTTAAGAGCCATATGAAATACAATAGGTCAAG TAAGGATGTGTCCAAGGCTTCTTCATAG
back to top

Coding sequence (CDS) from alignment at KI_03:38546016..38548043-

>Kirkii_Juiced.00g075700.m01_ISU-kirkii_v3.0.a3 ID=Kirkii_Juiced.00g075700.m01_ISU-kirkii_v3.0.a3|Name=Kirkii_Juiced.00g075700.m01|organism=Gossypioides kirkii|type=CDS|length=1752bp|location=Sequence derived from alignment at KI_03:38546016..38548043- (Gossypioides kirkii)
ATGGAGGCTCACCGGCTGTATTCGACTAAACCTGTTCAATCTCTCAAGCC
CACGAAGAAGATTCCTTTAGAGGAAGATCCCGGTAAAGCCTCCGACGCAT
TGCCGCTTCCCTTGTACCTAACCAATGCCCTGTTCTTCACCCTCTTCTTC
TCGGTGGTTTATTTTCTTCTTTCCCGTTGGCGTGAGAAGATTCGTACCTC
CACGCCTCTCCATGTCGTCACCTTTTCCGAGATCATCGCCATTCTCTCAT
TTTTCGCCTCCTTTATTTACCTTTTGGGTTTCTTTGGGATTGACTTCGTT
CAATCTTTGGTTTTCCAACCATCGCCTGACGCTTGGAATGACGAGGAAGA
GGATAATGAAGTTTTGCTCGCGAAGGAAGACGCCCGTAAGGTCCCTTGTG
GACAAGCTCTCGATTGCTCGATTCCACCTCTGCCTCCTGCCGCACCAATC
GTGACTACCCAGAAGGTGTGCGATGAAAAGCCTGCGACGGTTATAGCAGA
GGAAGATGAAGAAATAGTTAAATCTGTAGTGGCTGGAACAACCCCTTCGT
ATTCCTTGGAATCCAAATTGGGTGATTGCAAGAGGGCGGCTGCAATCAGG
CGGGAAGCGTTGCAAAGATTAACAGGGAAGTCGTTATCTGGATTGCCCTT
GGATGGGTTTGATTACGAGTCGATTTTAGGGCAGTGTTGTGAGATGCCGG
TTGGCTACGTGCAGATTCCCGTTGGAATTGCTGGGCCTTTGTTGGTTAAT
GGAAGAGAGTACTCGGTTCCTATGGCAACCACGGAAGGGTGCTTGGTGGC
TAGCACTAATAGGGGCTGTAAGGCTATTCATTTGTCTGGTGGAGCTACAA
GTGTTCTATTGAAAGATGGTATGACTAGAGCTCCATGTGTAAGGTTCGGT
ACAGCAAAAAGGGCAGCTGATTTGAAGTTGTATTTGGAGGACCCTGATCA
TTTCGAGACCTTGTCTGTTGTTTTCAACAGATCAAGTAGATTTGGCAGGC
TCCAAGGTATCAAATGTGCAATTGCTGGAAAGAATCTGTATATTAGATTC
ACTTGCAGTACAGGTGATGCTATGGGGATGAACATGGTTTCCAAGGGAGT
CCAAAACGTTTTGGATTTCCTTCAAACTGATTTCCCTGACATGGATGTCA
TTGGCATCTCTGGAAACTATTGTTCCGACAAAAAACCGGCTGCTATAAAT
TGGATTGAAGGACGAGGCAAATCTGTTGTCTGTGAAGCCACCATTAAGGG
TGATGTGGTTAGGAAGGTCTTGAAGACAAGTGTGGAATCTCTGGTTGAGC
TTAACATGCTTAAGAACCTTACTGGATCAGCTATGGCTGGAGCTCTGGGT
GGATTCAACGCTCACGCCAGTAACATCGTCACTGCAATCTACATAGCTAC
GGGCCAAGATCCGGCTCAAAACGTCGAGAGCTCTCATTGCATCACTATGA
TGGAAGCTGTTAACGAGGGCAAGGACCTCCACATCTCTGTCACAATGCCT
TCCATCGAGGTTGGTACTGTTGGTGGTGGAACACAGCTTGCATCTCAGTC
AGCCTGTTTGAACTTACTTGGAGTGAAGGGTGCAAATAAAGAGACACCTG
GAGCAAACTCTAGAATGCTGGCAACCATTGTAGCAGGTGCTGTCCTAGCC
GGGGAGCTGTCACTCATGTCAGCACTTGCTGCAGGGCAATTAGTTAAGAG
CCATATGAAATACAATAGGTCAAGTAAGGATGTGTCCAAGGCTTCTTCAT
AG
back to top
Synonyms
The feature 'Kirkii_Juiced.00g075700.m01' has the following synonyms
Synonym
Kirkii_Juiced.00g075700.m01
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002202HMG_CoA_Rdtase
IPR023074HMG_CoA_Rdtase_cat_sf
IPR009023HMG_CoA_Rdtase_NAD(P)-bd_sf
IPR004554HMG_CoA_Rdtase_eu_arc
IPR023282HMG_CoA_Rdtase_N
IPR023076HMG_CoA_Rdtase_CS
IPR009029HMG_CoA_Rdtase_sub-bd_dom_sf
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO:0015936coenzyme A metabolic process
GO:0008299isoprenoid biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0050662coenzyme binding
GO:0004420hydroxymethylglutaryl-CoA reductase (NADPH) activity
GO:0050661NADP binding
GO:0016616oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral to membrane