g.arboreum_cottongen_reftransV1_0018368, g.arboreum_cottongen_reftransV1_0018368 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0018368
Unique Nameg.arboreum_cottongen_reftransV1_0018368
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length384
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr5chromosomeg.arboreum_cottongen_reftransV1_0018368:1..384 .
Chr5:31147641..31148024 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: A0A0D2NDT4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G162800 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 2.611e-74
Identity = 113/117 (96.58%), Postives = 114/117 (97.44%), Query Frame = -2
Query:   33 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLVVRDQK 383
            PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMK KGVLPGMHMYSDLITSLCHK+KLGEACKYFQEMLDAGIRPPAKMFSNLKQALL EGKKDEALNL RKINKLRGTPLVVRDQK
Sbjct:  474 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKAKGVLPGMHMYSDLITSLCHKNKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLGEGKKDEALNLARKINKLRGTPLVVRDQK 590          

HSP 2 Score: 60.077 bits (144), Expect = 5.914e-8
Identity = 31/109 (28.44%), Postives = 54/109 (49.54%), Query Frame = -2
Query:   54 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTP 380
            G EP V TY I++  +C   + D A +++ +M+ K   P  H+Y  LI  L  + +L EA ++F+     G  P A  +++L  A     + D+A  +  ++ K    P
Sbjct:  334 GFEPDVVTYGILISAYCKAKKYDAAIELFHEMEAKNCKPTPHVYCTLINGLGSEKRLSEALEFFERFKSCGFTPEAPTYNSLVGAYCWSMRIDDAFQVIDEMRKHSAGP 442          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: D2STE8_GOSHI (Pentatricopeptide repeat protein OS=Gossypium hirsutum GN=PPR3 PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 5.101e-74
Identity = 112/117 (95.73%), Postives = 113/117 (96.58%), Query Frame = -2
Query:   33 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLVVRDQK 383
            PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMK KGVLPGMHMYSDLITSLCHK+KLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGK DEALNL RKINKLRGTPLVV DQK
Sbjct:  431 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKAKGVLPGMHMYSDLITSLCHKNKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKNDEALNLARKINKLRGTPLVVGDQK 547          

HSP 2 Score: 60.8474 bits (146), Expect = 3.176e-8
Identity = 31/109 (28.44%), Postives = 54/109 (49.54%), Query Frame = -2
Query:   54 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTP 380
            G EP V TY I++  +C   + D A +++ +M+ K   P  H+Y  LI  L  + +L EA ++F+     G  P A  +++L  A     + D+A  +  ++ K    P
Sbjct:  291 GFEPDVVTYGILISAYCKAKKYDAAIELFHEMEAKNCKPTPHVYCTLINGLGSEKRLSEALEFFERFKSCGFTPEAPTYNSLVGAYCWSMRIDDAFQVIDEMRKHSAGP 399          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: A0A061E7F9_THECC (Pentatricopeptide repeat-containing protein, putative isoform 1 OS=Theobroma cacao GN=TCM_010824 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 1.118e-57
Identity = 93/116 (80.17%), Postives = 100/116 (86.21%), Query Frame = -2
Query:   36 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLVVRDQ 383
            PGC PTVSTYEIIVRMFCNE++VD+A  VW QMK +GVLPGMHM+SDLI SLCH  KL +ACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKD ALNL RKI+KLR  PLV   Q
Sbjct:  430 PGCVPTVSTYEIIVRMFCNEEQVDMAMLVWAQMKAEGVLPGMHMFSDLINSLCHNSKLDDACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDTALNLARKIDKLRKMPLVGEGQ 545          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: A0A059BEG7_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_G02199 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.274e-53
Identity = 83/112 (74.11%), Postives = 97/112 (86.61%), Query Frame = -2
Query:   48 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLV 383
            PGCEPT+STYEIIVRMFCNEDR D+A +VW QMK KGVLPGMHM+S +I+SLCH++KL +ACKYFQEM+D GIRPPA  FS LKQ LLDEG+KD+ LN +RKI+KLR  PLV
Sbjct:  404 PGCEPTLSTYEIIVRMFCNEDRTDMALRVWKQMKEKGVLPGMHMFSTVISSLCHENKLDDACKYFQEMMDVGIRPPANTFSKLKQCLLDEGRKDDVLNFSRKIDKLRKAPLV 515          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: B9HW85_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0010s12490g PE=4 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 1.698e-52
Identity = 83/111 (74.77%), Postives = 94/111 (84.68%), Query Frame = -2
Query:   48 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLV 380
            GCEP+VSTYEIIVRMFCNEDRVD+A +VWDQMK KG+LP MHM+S LI SLCH+ KL EAC YFQEMLD GIRPPA++FSNLKQ LLDEGKKD  +   RK++KLR  PLV
Sbjct:  377 GCEPSVSTYEIIVRMFCNEDRVDMAIKVWDQMKAKGILPVMHMFSTLINSLCHESKLDEACMYFQEMLDVGIRPPAQLFSNLKQNLLDEGKKDTVVVFERKLDKLRKAPLV 487          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: A0A0A0KUY5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G571490 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 2.221e-52
Identity = 81/112 (72.32%), Postives = 96/112 (85.71%), Query Frame = -2
Query:   48 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLV 383
            PGCEPT+STY+I++RMFCNE+RVD+A Q+WD+MK KGVLPGMH++S LI SLCH+ KL +AC YFQEMLD GIRPPA MFSNLKQALLD+G+KD AL +  KI KLR  PLV
Sbjct:  430 PGCEPTLSTYDIMIRMFCNEERVDMAIQIWDEMKAKGVLPGMHLFSTLINSLCHEHKLEDACTYFQEMLDVGIRPPATMFSNLKQALLDDGRKDTALLMAEKIKKLRKAPLV 541          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: F6HFJ5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0011g04690 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 4.277e-51
Identity = 80/112 (71.43%), Postives = 97/112 (86.61%), Query Frame = -2
Query:   48 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLV 383
            PGCEP+VSTYEI+VRMFCNE+RVD+A +VWD+MK KGVLPGMHM+S LI SLC+++KL EACKYF EMLD GIRPPA MFSNLKQ LLDEGK+D  L L +K++K+R T ++
Sbjct:  419 PGCEPSVSTYEIVVRMFCNEERVDMALRVWDEMKAKGVLPGMHMFSTLINSLCYENKLDEACKYFHEMLDMGIRPPAAMFSNLKQTLLDEGKQDMVLILAQKLDKIRTTQVI 530          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: A0A067KPG2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04675 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.284e-50
Identity = 81/111 (72.97%), Postives = 92/111 (82.88%), Query Frame = -2
Query:   48 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLV 380
            GCEPTVSTYEIIVRMFCN +RVD A Q+WDQMK KG+LPGMHM+  +I SLCH++KL  ACKYFQEMLD GIRPPA +FSNLKQALLD GKK   + L +KI+KLR TP V
Sbjct:  378 GCEPTVSTYEIIVRMFCNAERVDKAIQIWDQMKAKGILPGMHMFCTIINSLCHENKLDMACKYFQEMLDVGIRPPATLFSNLKQALLDNGKKHIVVLLAQKIDKLRKTPFV 488          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: W9RD71_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_025886 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.553e-50
Identity = 80/112 (71.43%), Postives = 95/112 (84.82%), Query Frame = -2
Query:   48 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLV 383
            PGCEPTVSTYEI+VRMFCN +R+D+A Q+WDQMK KGVLPGMHM+S LI SLC +DKL +ACKYFQEM+D GIRPPA+++SNLKQALLDEG++D    L  +I KLR T LV
Sbjct:  439 PGCEPTVSTYEIMVRMFCNVERLDMAIQIWDQMKAKGVLPGMHMFSTLINSLCMEDKLDDACKYFQEMMDMGIRPPAQLYSNLKQALLDEGREDMVQTLYERIEKLRKTSLV 550          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Match: A0A067FBH5_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g037620mg PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 6.632e-50
Identity = 80/116 (68.97%), Postives = 96/116 (82.76%), Query Frame = -2
Query:   36 PGCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLVVRDQ 383
            PG EPTVSTYEI+VRMFC   +VD+A ++WD+MK +GVLP MHMYS LI SLCH+DKL +ACKYFQEMLD GIRPP ++FSNLKQAL DEG ++ A+ L +KI+KLR TPLV R Q
Sbjct:  215 PGTEPTVSTYEIVVRMFCYNAQVDMAMRIWDEMKARGVLPVMHMYSTLINSLCHEDKLDDACKYFQEMLDIGIRPPGQLFSNLKQALRDEGMEETAVVLAQKIDKLRKTPLVDRGQ 330          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PP112_ARATH (Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.266e-49
Identity = 75/111 (67.57%), Postives = 94/111 (84.68%), Query Frame = -2
Query:   48 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLV 380
             CEPTVSTYEI+VRMFCN++R+D+A ++WD+MK KGVLPGMHM+S LIT+LCH++KL EAC+YF EMLD GIRPP  MFS LKQ LLDEG+KD+  +L  K+++LR T LV
Sbjct:  399 SCEPTVSTYEIMVRMFCNKERLDMAIKIWDEMKGKGVLPGMHMFSSLITALCHENKLDEACEYFNEMLDVGIRPPGHMFSRLKQTLLDEGRKDKVTDLVVKMDRLRKTQLV 509          

HSP 2 Score: 53.1434 bits (126), Expect = 1.188e-7
Identity = 32/95 (33.68%), Postives = 46/95 (48.42%), Query Frame = -2
Query:   96 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEA 380
            G  P   TY+II+       R   A +V+  M  +   P +  Y  ++   C+K++L  A K + EM   G+ P   MFS+L  AL  E K DEA
Sbjct:  367 GVGPNARTYDIILHHLIRMQRSKEAYEVYQTMSCE---PTVSTYEIMVRMFCNKERLDMAIKIWDEMKGKGVLPGMHMFSSLITALCHENKLDEA 458          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PP129_ARATH (Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 7.036e-22
Identity = 43/109 (39.45%), Postives = 63/109 (57.80%), Query Frame = -2
Query:   51 CEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPL 377
            CEP   TY ++++MFC +  ++ A +VW  M+ KGV P MH +S LI  LC +    +AC   +EM++ GIRP    F  L+Q L+ E ++D    L  K+N L   PL
Sbjct:  407 CEPDADTYTMVIKMFCEKKEMETADKVWKYMRKKGVFPSMHTFSVLINGLCEERTTQKACVLLEEMIEMGIRPSGVTFGRLRQLLIKEEREDVLKFLNEKMNVLVNEPL 515          

HSP 2 Score: 59.3066 bits (142), Expect = 1.199e-9
Identity = 27/104 (25.96%), Postives = 60/104 (57.69%), Query Frame = -2
Query:   66 CEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKL 377
            C+PT   Y ++V  +  E+R++ A   + +M+  G+   + +++ LI + C  +++    +  +EM   G+ P +K  + + + L++ G+KDEA ++ RK+ K+
Sbjct:  303 CKPTTFIYSVLVHTYGTENRLEEAVDTFLEMERSGMKADVAVFNSLIGAFCKANRMKNVYRVLKEMKSKGVTPNSKSCNIILRHLIERGEKDEAFDVFRKMIKV 406          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PP247_ARATH (Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.947e-15
Identity = 36/108 (33.33%), Postives = 58/108 (53.70%), Query Frame = -2
Query:   57 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGT 380
            GCEP + TY I++  +C   RVD   +++ ++  KG++P    Y+ L+   C   KL  A + FQEM+  G+ P    +  L   L D G+ ++AL +  K+ K R T
Sbjct:  380 GCEPDIVTYSILINSYCKAKRVDDGMRLFREISSKGLIPNTITYNTLVLGFCQSGKLNAAKELFQEMVSRGVPPSVVTYGILLDGLCDNGELNKALEIFEKMQKSRMT 487          

HSP 2 Score: 54.299 bits (129), Expect = 5.092e-8
Identity = 29/93 (31.18%), Postives = 47/93 (50.54%), Query Frame = -2
Query:   96 EPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEA 374
            + +V  Y I++   C +   D A  ++++M++KG+   +  YS LI  LC+  K  +  K  +EM+   I P    FS L    + EGK  EA
Sbjct:  242 KASVVQYSIVIDSLCKDGSFDDALSLFNEMEMKGIKADVVTYSSLIGGLCNDGKWDDGAKMLREMIGRNIIPDVVTFSALIDVFVKEGKLLEA 334          

HSP 3 Score: 54.299 bits (129), Expect = 5.677e-8
Identity = 32/109 (29.36%), Postives = 52/109 (47.71%), Query Frame = -2
Query:   54 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTP 380
            G  P   TY  ++  FC E+ +  A Q++D M  KG  P +  YS LI S C   ++ +  + F+E+   G+ P    ++ L       GK + A  L +++   RG P
Sbjct:  345 GIAPDTITYNSLIDGFCKENCLHEANQMFDLMVSKGCEPDIVTYSILINSYCKAKRVDDGMRLFREISSKGLIPNTITYNTLVLGFCQSGKLNAAKELFQEMVS-RGVP 452          

HSP 4 Score: 52.373 bits (124), Expect = 2.326e-7
Identity = 28/109 (25.69%), Postives = 58/109 (53.21%), Query Frame = -2
Query:   54 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTP 380
            G  P+V TY I++   C+   ++ A +++++M+   +  G+ +Y+ +I  +C+  K+ +A   F  + D G++P    ++ +   L  +G   EA  L RK+ +   TP
Sbjct:  450 GVPPSVVTYGILLDGLCDNGELNKALEIFEKMQKSRMTLGIGIYNIIIHGMCNASKVDDAWSLFCSLSDKGVKPDVVTYNVMIGGLCKKGSLSEADMLFRKMKEDGCTP 558          

HSP 5 Score: 50.447 bits (119), Expect = 9.455e-7
Identity = 32/102 (31.37%), Postives = 46/102 (45.10%), Query Frame = -2
Query:   75 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKI 380
            G EP   T+  +V  FC E RV  A  + D+M      P +   S LI  LC K ++ EA      M++ G +P    +  +   L   G    AL+L RK+
Sbjct:  135 GYEPDTITFSTLVNGFCLEGRVSEAVALVDRMVEMKQRPDLVTVSTLINGLCLKGRVSEALVLIDRMVEYGFQPDEVTYGPVLNRLCKSGNSALALDLFRKM 236          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PP150_ARATH (Pentatricopeptide repeat-containing protein At2g13420, mitochondrial OS=Arabidopsis thaliana GN=At2g13420 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.428e-14
Identity = 32/103 (31.07%), Postives = 55/103 (53.40%), Query Frame = -2
Query:   69 CEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINK 377
            C+P+  TY +++  F N  +++  K++WD +K     P +  Y+ L+  LC K+K  EAC YF EM++ G  P    F  L + L+   K      L +K+++
Sbjct:  388 CKPSTQTYNVLLGTFINLGKMETVKEIWDDLKASETGPDLDSYTSLVHGLCSKEKWKEACGYFVEMIERGFLPQKLTFETLYKGLIQSNKMRTWRRLKKKLDE 490          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PPR39_ARATH (Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.022e-13
Identity = 33/104 (31.73%), Postives = 57/104 (54.81%), Query Frame = -2
Query:   69 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINK 380
            GC+P + T+ I++  +C  +R+D   +++ +M ++GV+     Y+ L+   C   KL  A K FQEM+   +RP    +  L   L D G+ ++AL +  KI K
Sbjct:  398 GCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQGFCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIFGKIEK 501          

HSP 2 Score: 53.5286 bits (127), Expect = 1.041e-7
Identity = 31/112 (27.68%), Postives = 54/112 (48.21%), Query Frame = -2
Query:   45 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLVV 380
            G  P   TY  ++  FC E+R++ A Q+ D M  KG  P +  ++ LI   C  +++ +  + F+EM   G+      ++ L Q     GK + A  L +++   R  P +V
Sbjct:  363 GIAPNTITYNSLIDGFCKENRLEEAIQMVDLMISKGCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQGFCQSGKLEVAKKLFQEMVSRRVRPDIV 474          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PPR54_ARATH (Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.263e-12
Identity = 34/107 (31.78%), Postives = 60/107 (56.07%), Query Frame = -2
Query:   54 EPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTP 374
            EP V  Y  +VR +C    +  A++V+ +MK+ G+ P ++ YS +I +LC   ++  A   F +MLD+G  P A  F+NL +  +  G+ ++ L +  ++ KL   P
Sbjct:  252 EPDVIVYTNLVRGWCRAGEISEAEKVFKEMKLAGIEPNVYTYSIVIDALCRCGQISRAHDVFADMLDSGCAPNAITFNNLMRVHVKAGRTEKVLQVYNQMKKLGCEP 358          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PPR36_ARATH (Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.756e-12
Identity = 32/104 (30.77%), Postives = 56/104 (53.85%), Query Frame = -2
Query:   69 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINK 380
            GC+P + T+ I++  +C  +R+D   +++ +M ++GV+     Y+ LI   C   KL  A + FQEM+   + P    +  L   L D G+ ++AL +  KI K
Sbjct:  398 GCDPNIRTFNILINGYCKANRIDDGLELFRKMSLRGVVADTVTYNTLIQGFCELGKLNVAKELFQEMVSRKVPPNIVTYKILLDGLCDNGESEKALEIFEKIEK 501          

HSP 2 Score: 55.0694 bits (131), Expect = 3.309e-8
Identity = 31/102 (30.39%), Postives = 54/102 (52.94%), Query Frame = -2
Query:   69 EPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINK 374
            E  +  Y II+   CN  +VD A  ++  + +KGV PG+  Y+ +I  LC K  L EA   F++M + G  P    ++ L +A L +G   +++ L  ++ +
Sbjct:  505 ELDIGIYNIIIHGMCNASKVDDAWDLFCSLPLKGVKPGVKTYNIMIGGLCKKGPLSEAELLFRKMEEDGHAPDGWTYNILIRAHLGDGDATKSVKLIEELKR 606          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PP412_ARATH (Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.618e-12
Identity = 35/112 (31.25%), Postives = 61/112 (54.46%), Query Frame = -2
Query:   45 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLVV 380
            G EP + T+  ++  FC  +R++ A  + +QM   G+ P + MY+ +I SLC    +  A   F +M + GIRP   M+++L   L + G+  +A +L R + K +  P V+
Sbjct:  137 GFEPDIVTFTSLINGFCLGNRMEEAMSMVNQMVEMGIKPDVVMYTTIIDSLCKNGHVNYALSLFDQMENYGIRPDVVMYTSLVNGLCNSGRWRDADSLLRGMTKRKIKPDVI 248          

HSP 2 Score: 56.225 bits (134), Expect = 1.212e-8
Identity = 31/109 (28.44%), Postives = 53/109 (48.62%), Query Frame = -2
Query:   54 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTP 380
            G +P V  Y  I+   C    V+ A  ++DQM+  G+ P + MY+ L+  LC+  +  +A    + M    I+P    F+ L  A + EGK  +A  L  ++ ++   P
Sbjct:  172 GIKPDVVMYTTIIDSLCKNGHVNYALSLFDQMENYGIRPDVVMYTSLVNGLCNSGRWRDADSLLRGMTKRKIKPDVITFNALIDAFVKEGKFLDAEELYNEMIRMSIAP 280          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PPR99_ARATH (Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.216e-11
Identity = 34/112 (30.36%), Postives = 61/112 (54.46%), Query Frame = -2
Query:   45 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTPLVV 380
            GC+P + TY I+V   C    +DLA  +  +M+   + PG+ +Y+ +I +LC+   + +A   F EM + GIRP    +++L + L + G+  +A  L   + + +  P VV
Sbjct:  216 GCQPDLVTYGIVVNGLCKRGDIDLALSLLKKMEQGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVV 327          

HSP 2 Score: 58.9214 bits (141), Expect = 1.537e-9
Identity = 31/93 (33.33%), Postives = 47/93 (50.54%), Query Frame = -2
Query:   96 EPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEA 374
            EP V  Y  I+   CN   V+ A  ++ +M  KG+ P +  Y+ LI  LC+  +  +A +   +M++  I P    FS L  A + EGK  EA
Sbjct:  253 EPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEA 345          

HSP 3 Score: 53.9138 bits (128), Expect = 8.375e-8
Identity = 29/104 (27.88%), Postives = 53/104 (50.96%), Query Frame = -2
Query:   63 EPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLR 374
            EP + TY I++   C   +V+    ++  + +KGV P +  Y+ +++  C K    EA   F+EM + G  P +  ++ L +A L +G K  +  L R++   R
Sbjct:  498 EPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVVTYTTMMSGFCRKGLKEEADALFREMKEEGPLPDSGTYNTLIRAHLRDGDKAASAELIREMRSCR 601          

HSP 4 Score: 53.1434 bits (126), Expect = 1.160e-7
Identity = 25/102 (24.51%), Postives = 48/102 (47.06%), Query Frame = -2
Query:   75 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKI 380
            G    + TY I++  FC   ++ LA  V  +M   G  P +   + L+   CH +++ +A     +M++ G +P +  F+ L   L    +  EA+ L  ++
Sbjct:  111 GISHNLYTYSILINCFCRRSQLSLALAVLAKMMKLGYEPDIVTLNSLLNGFCHGNRISDAVSLVGQMVEMGYQPDSFTFNTLIHGLFRHNRASEAVALVDRM 212          

HSP 5 Score: 53.1434 bits (126), Expect = 1.247e-7
Identity = 26/102 (25.49%), Postives = 51/102 (50.00%), Query Frame = -2
Query:   69 EPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINK 374
             P V T+  ++  F  E ++  A++++D+M  + + P +  YS LI   C  D+L EA   F+ M+     P    ++ L +      + DE + L R++++
Sbjct:  323 NPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVDEGMELFREMSQ 424          

HSP 6 Score: 52.373 bits (124), Expect = 2.085e-7
Identity = 28/108 (25.93%), Postives = 51/108 (47.22%), Query Frame = -2
Query:   54 CEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKINKLRGTP 377
            C P V TY  +++ FC   RVD   +++ +M  +G++     Y+ LI       +   A   F++M+  G+ P    +S L   L + GK + AL +   + + +  P
Sbjct:  392 CFPNVVTYNTLIKGFCKAKRVDEGMELFREMSQRGLVGNTVTYTTLIHGFFQARECDNAQIVFKQMVSDGVLPDIMTYSILLDGLCNNGKVETALVVFEYLQRSKMEP 499          

HSP 7 Score: 51.2174 bits (121), Expect = 6.246e-7
Identity = 25/93 (26.88%), Postives = 43/93 (46.24%), Query Frame = -2
Query:   96 EPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEA 374
            +P + TY  ++  FC  DR+D AK +++ M  K   P +  Y+ LI   C   ++ E  + F+EM   G+      ++ L        + D A
Sbjct:  358 DPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVDEGMELFREMSQRGLVGNTVTYTTLIHGFFQARECDNA 450          
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Match: PP418_ARATH (Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.356e-11
Identity = 34/102 (33.33%), Postives = 52/102 (50.98%), Query Frame = -2
Query:   72 CEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNLTRKIN 377
            C PTV TY  ++   C    VD A +  ++MK KG+ P +  YS L+  LC   +  +A + F+ M+  G RP    ++ L   L  E K  EA+ L  ++N
Sbjct:  223 CAPTVVTYTSLINGLCGSKNVDEAMRYLEEMKSKGIEPNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMVTYTTLITGLCKEQKIQEAVELLDRMN 324          

HSP 2 Score: 64.6994 bits (156), Expect = 1.435e-11
Identity = 32/98 (32.65%), Postives = 51/98 (52.04%), Query Frame = -2
Query:   87 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNL 380
            GC+P   TY  ++   C   R+D AK+++ +M  K   P +  Y+ LI  LC    + EA +Y +EM   GI P    +S+L   L  +G+  +A+ L
Sbjct:  187 GCDPDSYTYGTLISGLCRFGRIDEAKKLFTEMVEKDCAPTVVTYTSLINGLCGSKNVDEAMRYLEEMKSKGIEPNVFTYSSLMDGLCKDGRSLQAMEL 284          

HSP 3 Score: 56.225 bits (134), Expect = 1.055e-8
Identity = 23/74 (31.08%), Postives = 39/74 (52.70%), Query Frame = -2
Query:  159 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRP 380
            GC P + TY  ++   C E ++  A ++ D+M ++G+ P   +Y  +I+  C   K  EA  +  EM+  GI P
Sbjct:  292 GCRPNMVTYTTLITGLCKEQKIQEAVELLDRMNLQGLKPDAGLYGKVISGFCAISKFREAANFLDEMILGGITP 365          

HSP 4 Score: 55.8398 bits (133), Expect = 1.584e-8
Identity = 30/98 (30.61%), Postives = 47/98 (47.96%), Query Frame = -2
Query:   87 GCEPTVSTYEIIVRMFCNEDRVDLAKQVWDQMKVKGVLPGMHMYSDLITSLCHKDKLGEACKYFQEMLDAGIRPPAKMFSNLKQALLDEGKKDEALNL 380
            G EP V TY  ++   C + R   A ++++ M  +G  P M  Y+ LIT LC + K+ EA +    M   G++P A ++  +        K  EA N 
Sbjct:  257 GIEPNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMVTYTTLITGLCKEQKIQEAVELLDRMNLQGLKPDAGLYGKVISGFCAISKFREAANF 354          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2NDT4_GOSRA2.611e-7496.58Uncharacterized protein OS=Gossypium raimondii GN=... [more]
D2STE8_GOSHI5.101e-7495.73Pentatricopeptide repeat protein OS=Gossypium hirs... [more]
A0A061E7F9_THECC1.118e-5780.17Pentatricopeptide repeat-containing protein, putat... [more]
A0A059BEG7_EUCGR1.274e-5374.11Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]
B9HW85_POPTR1.698e-5274.77Uncharacterized protein OS=Populus trichocarpa GN=... [more]
A0A0A0KUY5_CUCSA2.221e-5272.32Uncharacterized protein OS=Cucumis sativus GN=Csa_... [more]
F6HFJ5_VITVI4.277e-5171.43Putative uncharacterized protein OS=Vitis vinifera... [more]
A0A067KPG2_JATCU2.284e-5072.97Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
W9RD71_9ROSA2.553e-5071.43Uncharacterized protein OS=Morus notabilis GN=L484... [more]
A0A067FBH5_CITSI6.632e-5068.97Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0018368 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
PP112_ARATH1.266e-4967.57Pentatricopeptide repeat-containing protein At1g71... [more]
PP129_ARATH7.036e-2239.45Pentatricopeptide repeat-containing protein At1g77... [more]
PP247_ARATH1.947e-1533.33Pentatricopeptide repeat-containing protein At3g22... [more]
PP150_ARATH2.428e-1431.07Pentatricopeptide repeat-containing protein At2g13... [more]
PPR39_ARATH2.022e-1331.73Pentatricopeptide repeat-containing protein At1g12... [more]
PPR54_ARATH1.263e-1231.78Pentatricopeptide repeat-containing protein At1g20... [more]
PPR36_ARATH1.756e-1230.77Pentatricopeptide repeat-containing protein At1g12... [more]
PP412_ARATH4.618e-1231.25Pentatricopeptide repeat-containing protein At5g41... [more]
PPR99_ARATH1.216e-1130.36Pentatricopeptide repeat-containing protein At1g63... [more]
PP418_ARATH1.356e-1133.33Pentatricopeptide repeat-containing protein At5g46... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002885Pentatricopeptide repeatTIGRFAMTIGR00756TIGR00756coord: 29..60
e-value: 9.8E-7
score: 26.6
coord: 2..25
e-value: 2.5E-4
score: 19.0
IPR002885Pentatricopeptide repeatPFAMPF01535PPRcoord: 2..23
e-value: 0.076
score: 13.2
coord: 29..58
e-value: 2.4E-5
score: 24.1
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 1..25
score: 8.331
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 26..60
score: 10.402
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 61..95
score: 5.963
NoneNo IPR availablePANTHERPTHR24015:SF261SUBFAMILY NOT NAMEDcoord: 1..100
NoneNo IPR availablePANTHERPTHR24015FAMILY NOT NAMEDcoord: 1..100

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0018368 ID=g.arboreum_cottongen_reftransV1_0018368|Name=g.arboreum_cottongen_reftransV1_0018368|organism=Gossypium arboreum|type=contig|length=384bp
GGGCACCAGCATACAGCTCACATTCTTTCTCACTTCTGGTCTCGAACAAC
TAACGGAGTTCCCCTCAGCTTATTGATTTTCCGAGTCAAATTTAAAGCTT
CATCCTTCTTCCCCTCATCAAGTAGAGCCTGTTTCAGATTACTAAACATC
TTGGCCGGAGGTCGAATACCTGCATCCAACATTTCCTGAAAATATTTGCA
AGCTTCACCTAACTTGTCCTTGTGACACAAACTGGTAATTAAATCAGAGT
ACATATGCATCCCTGGAAGCACTCCCTTGACCTTCATCTGATCCCAAACC
TGCTTTGCCAAATCCACTCGATCCTCGTTGCAGAACATCCTTACTATAAT
TTCGTAAGTACTCACAGTTGGCTCACAGCCCGGC
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002885Pentatricopeptide_repeat