g.arboreum_cottongen_reftransV1_0020660, g.arboreum_cottongen_reftransV1_0020660 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0020660
Unique Nameg.arboreum_cottongen_reftransV1_0020660
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1082
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr11chromosomeg.arboreum_cottongen_reftransV1_0020660:1..1082 .
Chr11:21138136..21139380 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A0D2RY42_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G178800 PE=4 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 4.108e-177
Identity = 260/268 (97.01%), Postives = 265/268 (98.88%), Query Frame = -1
Query:   54 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGGLKQQQQNHVVQNRGRYANRTLGLAPSAW 857
            MAEVLDDGEFWLPSQFLTDDDFFADGVK TN+TN+LKDGFGLELDG+KSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAH TLEDDSRRNDRSFAAENTKGW LSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQ+NHVVQNRGRYA+RTLGLAPSAW
Sbjct:    1 MAEVLDDGEFWLPSQFLTDDDFFADGVKATNNTNNLKDGFGLELDGSKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHSTLEDDSRRNDRSFAAENTKGWALSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQENHVVQNRGRYASRTLGLAPSAW 268          
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A0D2S568_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G178800 PE=4 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 9.153e-177
Identity = 260/268 (97.01%), Postives = 265/268 (98.88%), Query Frame = -1
Query:   54 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGGLKQQQQNHVVQNRGRYANRTLGLAPSAW 857
            MAEVLDDGEFWLPSQFLTDDDFFADGVK TN+TN+LKDGFGLELDG+KSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAH TLEDDSRRNDRSFAAENTKGW LSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQ+NHVVQNRGRYA+RTLGLAPSAW
Sbjct:    1 MAEVLDDGEFWLPSQFLTDDDFFADGVKATNNTNNLKDGFGLELDGSKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHSTLEDDSRRNDRSFAAENTKGWALSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQENHVVQNRGRYASRTLGLAPSAW 268          
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A0D2QC13_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G178800 PE=4 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 1.719e-176
Identity = 260/268 (97.01%), Postives = 265/268 (98.88%), Query Frame = -1
Query:   54 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGGLKQQQQNHVVQNRGRYANRTLGLAPSAW 857
            MAEVLDDGEFWLPSQFLTDDDFFADGVK TN+TN+LKDGFGLELDG+KSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAH TLEDDSRRNDRSFAAENTKGW LSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQ+NHVVQNRGRYA+RTLGLAPSAW
Sbjct:    1 MAEVLDDGEFWLPSQFLTDDDFFADGVKATNNTNNLKDGFGLELDGSKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHSTLEDDSRRNDRSFAAENTKGWALSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQENHVVQNRGRYASRTLGLAPSAW 268          
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A0D2SZU2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G178800 PE=4 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 7.489e-176
Identity = 260/268 (97.01%), Postives = 265/268 (98.88%), Query Frame = -1
Query:   54 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGGLKQQQQNHVVQNRGRYANRTLGLAPSAW 857
            MAEVLDDGEFWLPSQFLTDDDFFADGVK TN+TN+LKDGFGLELDG+KSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAH TLEDDSRRNDRSFAAENTKGW LSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQ+NHVVQNRGRYA+RTLGLAPSAW
Sbjct:    1 MAEVLDDGEFWLPSQFLTDDDFFADGVKATNNTNNLKDGFGLELDGSKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHSTLEDDSRRNDRSFAAENTKGWALSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQENHVVQNRGRYASRTLGLAPSAW 268          
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A0B0P1J6_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_24662 PE=4 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 2.662e-172
Identity = 268/268 (100.00%), Postives = 268/268 (100.00%), Query Frame = -1
Query:   54 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGGLKQQQQNHVVQNRGRYANRTLGLAPSAW 857
            MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQQNHVVQNRGRYANRTLGLAPSAW
Sbjct:    1 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQQNHVVQNRGRYANRTLGLAPSAW 268          
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A0D2NUC4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G178800 PE=4 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 2.897e-167
Identity = 252/268 (94.03%), Postives = 257/268 (95.90%), Query Frame = -1
Query:   54 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGGLKQQQQNHVVQNRGRYANRTLGLAPSAW 857
            MAEVLDDGEFWLPSQFLTDDDFFADGVK TN+TN+LKDGFGLELDG+KSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAH TLEDDSRRNDRSFAAENTK         STLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQ+NHVVQNRGRYA+RTLGLAPSAW
Sbjct:    1 MAEVLDDGEFWLPSQFLTDDDFFADGVKATNNTNNLKDGFGLELDGSKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDEDYLAGLTRQMAHSTLEDDSRRNDRSFAAENTK---------STLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYTQQSLSHNKLRTTHFQQLKQQQLMKQQNALAWGGLKQQQENHVVQNRGRYASRTLGLAPSAW 259          
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A061ESJ4_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_021816 PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 2.497e-119
Identity = 204/274 (74.45%), Postives = 225/274 (82.12%), Query Frame = -1
Query:   54 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDE-DYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFY-TQQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGG--LKQQQQNHVVQNRGR--YANRTLGLAPSAW 857
            MA+VLDDGEFWLP +FLTDDD F D  K  N+  + KDGFGLELDG+KSLFP+E   GFGS G S DL SP+ESV+GSTETESDE DYLAGLTRQMAH TLED  RRNDR F +EN+KGW+LS SPQSTLCA+ SGCGCKQGSSR SPN QSRVSSPPGTWDLLYAAAGEV R+RMNEE YGGF+NR LLGPPARKPSPNLDV G+Y   QSLSH KL+ T FQQLKQ+QLMKQQNA  WGG   + Q  +HVVQNRGR   +NR LGL+PSAW
Sbjct:    1 MADVLDDGEFWLPPEFLTDDDLFLDNSKAKNNHKNPKDGFGLELDGSKSLFPYEFRHGFGSFGFSSDLSSPIESVVGSTETESDEEDYLAGLTRQMAHSTLEDGFRRNDRVFGSENSKGWILSRSPQSTLCAVGSGCGCKQGSSRGSPNSQSRVSSPPGTWDLLYAAAGEVARMRMNEESYGGFNNRSLLGPPARKPSPNLDVPGYYPPHQSLSHQKLQATQFQQLKQEQLMKQQNASVWGGQKQQHQHHHHVVQNRGRNGNSNRPLGLSPSAW 274          
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A0B0PTV6_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_14772 PE=4 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 1.023e-110
Identity = 190/280 (67.86%), Postives = 210/280 (75.00%), Query Frame = -1
Query:   45 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDE-DYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYT-QQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGGLKQQ----QQNHVVQNRGR---YANRTLGLAPSAWPPL 857
            MA+VLDD EFWLP QFLTDDD   D  K  ++   +  GFGLELD +KSLFP+E P GFGSLG S D  SPVESV+GSTETESDE DYLAGLTRQMAH TLED  RRN R+FA+EN KG V+SSSPQSTLC   SGCGC QGSSR SP CQSRV SPPGTWDLLYAAA EV R+RM+EE YGG +NRGLLG  ARK SPN DV+GFY   QSL+H KL+   FQ LKQQ LMKQQNA  W G KQQ      NHVVQ+R R    +NR +GL+ SAW PL
Sbjct:    1 MAQVLDDAEFWLPPQFLTDDDLGIDNSKAKSNPKYVDGGFGLELDSSKSLFPYEFPYGFGSLGFSSDPSSPVESVVGSTETESDEEDYLAGLTRQMAHSTLEDGIRRNVRAFASENPKGRVMSSSPQSTLCVSRSGCGCMQGSSRGSPTCQSRVPSPPGTWDLLYAAAEEVARMRMSEESYGGLNNRGLLGSSARKFSPNADVTGFYLPTQSLAHQKLQAAQFQMLKQQLLMKQQNASVWAGQKQQLHSHHHNHVVQSRVRSNNSSNRPMGLSQSAWTPL 280          
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A0D2TME1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G109000 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 2.659e-109
Identity = 189/280 (67.50%), Postives = 210/280 (75.00%), Query Frame = -1
Query:   45 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDE-DYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFY-TQQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGGLKQQ----QQNHVVQNRGR---YANRTLGLAPSAWPPL 857
            MA+VLDD EF LP QFLTDDD   D  K  ++   +  GFGLEL G+KSLFP+E P GFGSLG S D  SPVESV+GSTETESDE DYLAGLTRQMAH TLED  RRNDR+F++EN KG V+SSSPQSTLC   SGC C QGSSR SP CQSRV  PPGTWDLLYAAA EV R+RM+EE YGG +NRGLLG  ARK SPN DV+GFY   QS +H KL+T  FQ LKQQQLMKQQNA  W G KQQ      NHVVQ+R R    +NR +GL+ SAWPPL
Sbjct:    1 MAQVLDDAEFCLPPQFLTDDDLVMDNSKAKSNPKYVDGGFGLELGGSKSLFPYEFPYGFGSLGFSSDPSSPVESVVGSTETESDEEDYLAGLTRQMAHSTLEDGIRRNDRAFSSENPKGRVMSSSPQSTLCVSRSGCSCMQGSSRGSPTCQSRVPPPPGTWDLLYAAAEEVARMRMSEESYGGLNNRGLLGSSARKFSPNADVTGFYLPTQSHAHQKLQTAQFQMLKQQQLMKQQNASVWAGQKQQLHSHHHNHVVQSRVRSNNSSNRPMGLSQSAWPPL 280          
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Match: A0A0D2V4U9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G109000 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 1.878e-108
Identity = 189/280 (67.50%), Postives = 210/280 (75.00%), Query Frame = -1
Query:   45 MAEVLDDGEFWLPSQFLTDDDFFADGVKTTNDTNSLKDGFGLELDGNKSLFPFEIPGGFGSLGLSPDLGSPVESVLGSTETESDE-DYLAGLTRQMAHCTLEDDSRRNDRSFAAENTKGWVLSSSPQSTLCALPSGCGCKQGSSRASPNCQSRVSSPPGTWDLLYAAAGEVERLRMNEEGYGGFSNRGLLGPPARKPSPNLDVSGFYT-QQSLSHNKLRTTHFXXXXXXXXXXXQNALAWGGLKQQ----QQNHVVQNRGR---YANRTLGLAPSAWPPL 857
            MA+VLDD EF LP QFLTDDD   D  K  ++   +  GFGLEL G+KSLFP+E P GFGSLG S D  SPVESV+GSTETESDE DYLAGLTRQMAH TLED  RRNDR+F++EN KG V+SSSPQSTLC   SGC C QGSSR SP CQSRV  PPGTWDLLYAAA EV R+RM+EE YGG +NRGLLG  ARK SPN DV+GFY   QS +H KL+T  FQ LKQQQLMKQQNA  W G KQQ      NHVVQ+R R    +NR +GL+ SAWPPL
Sbjct:    1 MAQVLDDAEFCLPPQFLTDDDLVMDNSKAKSNPKYVDGGFGLELGGSKSLFPYEFPYGFGSLGFSSDPSSPVESVVGSTETESDEEDYLAGLTRQMAHSTLEDGIRRNDRAFSSENPKGRVMSSSPQSTLCVSRSGCSCMQGSSRGSPTCQSRVPPPPGTWDLLYAAAEEVARMRMSEESYGGLNNRGLLGSSARKFSPNADVTGFYLPTQSHAHQKLQTAQFQMLKQQQLMKQQNASVWAGQKQQLHSHHHNHVVQSRVRSNNSSNRPMGLSQSAWPPL 280          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2RY42_GOSRA4.108e-17797.01Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2S568_GOSRA9.153e-17797.01Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QC13_GOSRA1.719e-17697.01Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2SZU2_GOSRA7.489e-17697.01Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0P1J6_GOSAR2.662e-172100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2NUC4_GOSRA2.897e-16794.03Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061ESJ4_THECC2.497e-11974.45Uncharacterized protein OS=Theobroma cacao GN=TCM_... [more]
A0A0B0PTV6_GOSAR1.023e-11067.86Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2TME1_GOSRA2.659e-10967.50Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2V4U9_GOSRA1.878e-10867.50Uncharacterized protein OS=Gossypium raimondii GN=... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0020660 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0020660 ID=g.arboreum_cottongen_reftransV1_0020660|Name=g.arboreum_cottongen_reftransV1_0020660|organism=Gossypium arboreum|type=contig|length=1082bp
GGCTGGGGTTGCTGTTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCAGAGG
GGGCCACGCAGATGGGGCCAAACCCAAAGTCCTATTGGCATACCTTCCTC
TGTTTTGGACCACATGGTTTTGTTGTTGCTGCTTCAACCCTCCCCACGCC
AACGCGTTTTGTTGCTTCATTAGCTGTTGTTGCTTCAGTTGCTGGAAATG
AGTGGTCCGCAGCTTATTGTGAGAAAGTGACTGTTGAGTGTAAAACCCAG
AAACATCGAGATTTGGAGAGGGTTTTCTAGCTGGTGGACCCAAAAGGCCT
CTGTTGCTGAATCCACCATACCCTTCTTCATTCATTCGCAACCTTTCCAC
TTCCCCGGCCGCTGCATAAAGCAAGTCCCAGGTTCCCGGCGGCGATGAAA
CTCGAGATTGACAGTTCGGGCTTGCACGACTAGAACCTTGCTTACAACCA
CAACCGCTCGGTAACGCACATAGGGTAGACTGCGGTGAACTGGACAAGAC
CCAACCCTTGGTATTTTCAGCGGCAAACGAGCGGTCGTTTCGGCGGGAAT
CGTCTTCGAGAGTGCAGTGAGCCATTTGGCGAGTTAAGCCAGCGAGATAA
TCTTCATCACTCTCTGTTTCAGTTGAACCCAGCACAGACTCAACAGGAGA
ACCTAGATCCGGAGACAACCCGAGAGACCCAAACCCGCCGGGGATCTCAA
AGGGAAACAAAGACTTGTTACCATCAAGCTCTAACCCGAACCCATCTTTA
AGACTATTGGTATCGTTGGTAGTCTTAACTCCGTCGGCGAAAAAGTCATC
GTCGGTTAAGAACTGGGACGGAAGCCAAAACTCACCGTCGTCTAAAACCT
CCGCCATAACCAGCAAGAGAAAAAAAAAGAAAAAAAAAAGGCCAAAAGAA
AAGCAGCAAAGAGAGGTTATTAGAAGGGAAAAGAAGGGAGCATTTGGTGA
GAGTAGGGAGCTCGGCGCTTAAGGGTAAGAATTAATATAATAAGCAGTTG
CAGCCCTGTTGATATCGCTGGCTGTGGCAGAGATCGGGCCCAGCCAAAGA
GAAAAAAGCGAAAAAGAAAAATGAAAATGTAT
back to top