g.arboreum_cottongen_reftransV1_0000098, g.arboreum_cottongen_reftransV1_0000098 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0000098
Unique Nameg.arboreum_cottongen_reftransV1_0000098
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length795
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr12chromosomeg.arboreum_cottongen_reftransV1_0000098:1..795 .
Chr12:56542967..56544014 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A0B0N6J9_GOSAR (Lysine-specific histone demethylase 1-like protein OS=Gossypium arboreum GN=F383_08528 PE=4 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 2.452e-165
Identity = 263/265 (99.25%), Postives = 264/265 (99.62%), Query Frame = -1
Query:    1 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 795
            SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTT+GRLHLAK LLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP
Sbjct: 1226 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTSGRLHLAKTLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 1490          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A0D2VVJ1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G046900 PE=4 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 9.955e-163
Identity = 259/265 (97.74%), Postives = 261/265 (98.49%), Query Frame = -1
Query:    1 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 795
            SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAME AQRRSESGRDEV DIIKRLEAVELSNVLYKNSLDRAWVLSREALL+DMFFNVKTT+GRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRK LKDTASGKPPLHSQHGAFESK SLQDPFPAGKQYP
Sbjct: 1226 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEAAQRRSESGRDEVGDIIKRLEAVELSNVLYKNSLDRAWVLSREALLRDMFFNVKTTSGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKSLKDTASGKPPLHSQHGAFESKASLQDPFPAGKQYP 1490          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A0D2V1W5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G046900 PE=4 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 1.271e-162
Identity = 259/265 (97.74%), Postives = 261/265 (98.49%), Query Frame = -1
Query:    1 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 795
            SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAME AQRRSESGRDEV DIIKRLEAVELSNVLYKNSLDRAWVLSREALL+DMFFNVKTT+GRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRK LKDTASGKPPLHSQHGAFESK SLQDPFPAGKQYP
Sbjct: 1226 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEAAQRRSESGRDEVGDIIKRLEAVELSNVLYKNSLDRAWVLSREALLRDMFFNVKTTSGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKSLKDTASGKPPLHSQHGAFESKASLQDPFPAGKQYP 1490          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A0D2V1W1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G046900 PE=4 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 5.109e-161
Identity = 259/265 (97.74%), Postives = 261/265 (98.49%), Query Frame = -1
Query:    1 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 795
            SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAME AQRRSESGRDEV DIIKRLEAVELSNVLYKNSLDRAWVLSREALL+DMFFNVKTT+GRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRK LKDTASGKPPLHSQHGAFESK SLQDPFPAGKQYP
Sbjct: 1226 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEAAQRRSESGRDEVGDIIKRLEAVELSNVLYKNSLDRAWVLSREALLRDMFFNVKTTSGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKSLKDTASGKPPLHSQHGAFESKASLQDPFPAGKQYP 1490          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A0D2SEI6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G110900 PE=4 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 1.766e-156
Identity = 254/265 (95.85%), Postives = 257/265 (96.98%), Query Frame = -1
Query:    1 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 795
            SGEDYDML RPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAME AQR SESGRDEVRDIIKRLEAVELSNVLYKNSLDRA +LSREALL+DMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLV+VWLEVFRKAKASSKRK LKD ASGKPPLHSQHGAFESK SLQDPF AGKQYP
Sbjct: 1179 SGEDYDMLARPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEAAQRHSESGRDEVRDIIKRLEAVELSNVLYKNSLDRARILSREALLRDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVNVWLEVFRKAKASSKRKSLKDPASGKPPLHSQHGAFESKESLQDPFSAGKQYP 1443          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A061FC63_THECC (Lysine-specific histone demethylase 1 isoform 1 OS=Theobroma cacao GN=TCM_034163 PE=4 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 2.995e-148
Identity = 242/265 (91.32%), Postives = 253/265 (95.47%), Query Frame = -1
Query:    1 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 795
            SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGND+TAEVEAME AQR+SES +DEVRDIIKRLEAVELSNVLYKNSLDRA +L+REALL+DMFFNVKTT GRLHLAKKLLGLPVESLKSFAGTKEGL+TLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDL+AVRSSGIGKTVKEK+CVHTSRDIRAIASQLV+VWLEVFRKAKASSKRK LKD ASGKPPL S HGAFE+K SLQDP  AG QYP
Sbjct: 1320 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDHTAEVEAMEAAQRQSESEKDEVRDIIKRLEAVELSNVLYKNSLDRARLLTREALLRDMFFNVKTTVGRLHLAKKLLGLPVESLKSFAGTKEGLTTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLVAVRSSGIGKTVKEKVCVHTSRDIRAIASQLVNVWLEVFRKAKASSKRKNLKDAASGKPPLRSHHGAFENKRSLQDPLSAGSQYP 1584          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A061FDX8_THECC (Lysine-specific histone demethylase 1 isoform 3 OS=Theobroma cacao GN=TCM_034163 PE=4 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 3.244e-148
Identity = 242/265 (91.32%), Postives = 253/265 (95.47%), Query Frame = -1
Query:    1 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 795
            SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGND+TAEVEAME AQR+SES +DEVRDIIKRLEAVELSNVLYKNSLDRA +L+REALL+DMFFNVKTT GRLHLAKKLLGLPVESLKSFAGTKEGL+TLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDL+AVRSSGIGKTVKEK+CVHTSRDIRAIASQLV+VWLEVFRKAKASSKRK LKD ASGKPPL S HGAFE+K SLQDP  AG QYP
Sbjct: 1350 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDHTAEVEAMEAAQRQSESEKDEVRDIIKRLEAVELSNVLYKNSLDRARLLTREALLRDMFFNVKTTVGRLHLAKKLLGLPVESLKSFAGTKEGLTTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLVAVRSSGIGKTVKEKVCVHTSRDIRAIASQLVNVWLEVFRKAKASSKRKNLKDAASGKPPLRSHHGAFENKRSLQDPLSAGSQYP 1614          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A061FCZ0_THECC (Lysine-specific histone demethylase 1 isoform 2 OS=Theobroma cacao GN=TCM_034163 PE=4 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 3.547e-148
Identity = 242/265 (91.32%), Postives = 253/265 (95.47%), Query Frame = -1
Query:    1 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 795
            SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGND+TAEVEAME AQR+SES +DEVRDIIKRLEAVELSNVLYKNSLDRA +L+REALL+DMFFNVKTT GRLHLAKKLLGLPVESLKSFAGTKEGL+TLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDL+AVRSSGIGKTVKEK+CVHTSRDIRAIASQLV+VWLEVFRKAKASSKRK LKD ASGKPPL S HGAFE+K SLQDP  AG QYP
Sbjct: 1350 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDHTAEVEAMEAAQRQSESEKDEVRDIIKRLEAVELSNVLYKNSLDRARLLTREALLRDMFFNVKTTVGRLHLAKKLLGLPVESLKSFAGTKEGLTTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLVAVRSSGIGKTVKEKVCVHTSRDIRAIASQLVNVWLEVFRKAKASSKRKNLKDAASGKPPLRSHHGAFENKRSLQDPLSAGSQYP 1614          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A061FCZ5_THECC (Lysine-specific histone demethylase 1 isoform 6 OS=Theobroma cacao GN=TCM_034163 PE=4 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 5.133e-148
Identity = 242/265 (91.32%), Postives = 253/265 (95.47%), Query Frame = -1
Query:    1 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLKDTASGKPPLHSQHGAFESKPSLQDPFPAGKQYP 795
            SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGND+TAEVEAME AQR+SES +DEVRDIIKRLEAVELSNVLYKNSLDRA +L+REALL+DMFFNVKTT GRLHLAKKLLGLPVESLKSFAGTKEGL+TLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDL+AVRSSGIGKTVKEK+CVHTSRDIRAIASQLV+VWLEVFRKAKASSKRK LKD ASGKPPL S HGAFE+K SLQDP  AG QYP
Sbjct: 1350 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDHTAEVEAMEAAQRQSESEKDEVRDIIKRLEAVELSNVLYKNSLDRARLLTREALLRDMFFNVKTTVGRLHLAKKLLGLPVESLKSFAGTKEGLTTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLVAVRSSGIGKTVKEKVCVHTSRDIRAIASQLVNVWLEVFRKAKASSKRKNLKDAASGKPPLRSHHGAFENKRSLQDPLSAGSQYP 1614          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Match: A0A067HAT5_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g046008mg PE=4 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.753e-129
Identity = 218/267 (81.65%), Postives = 234/267 (87.64%), Query Frame = -1
Query:   37 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASS--------------KRKPLKDTASGKPPLHSQHGAFESKPS 795
            SGEDYD+LGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVR+IDI TTGND+TAEVEAME AQ +SES  DEVRDI +RLEAVELSNVLYKNSLDRA +L+RE+LLQDMFFN KTTAGRLHLAK+LL LPV +LKSFAGT+EGL+TLNSW+LDSMGKDGTQLLRHCVRLLV VSTDLLAVR SGIGKTV+EK+CVHTSRDIRAIASQLVSVWLEVFRK KASS              KRK LKD +SGKPPLHS HG  ESK S
Sbjct: 1304 SGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRIIDILTTGNDFTAEVEAMEAAQMQSESEGDEVRDITRRLEAVELSNVLYKNSLDRALILTRESLLQDMFFNAKTTAGRLHLAKELLNLPVATLKSFAGTREGLTTLNSWILDSMGKDGTQLLRHCVRLLVRVSTDLLAVRLSGIGKTVREKVCVHTSRDIRAIASQLVSVWLEVFRKEKASSRLKLLKQSTAVDSIKRKSLKDPSSGKPPLHSHHGGLESKVS 1570          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy Swiss-Prot
Match: LDL3_ARATH (Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 4.610e-100
Identity = 166/232 (71.55%), Postives = 200/232 (86.21%), Query Frame = -1
Query:  100 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEGAQRRSESGRDEVRDIIKRLEAVELSNVLYKNSLDRAWVLSREALLQDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWMLDSMGKDGTQXXXXXXXXXXXVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVWLEVFRKAKASSKRKPLK 795
            SGEDYD+LGRPV+NCLFFAGEATCKEHPDTVGGAM++G+REAVR+IDI  +GNDYTAE+E +E AQR+S   RDEVRD+IKRLE VELSNVL           +R++LL++MFF+ KTT GRLHLAK+LL LP E+LKSFAGTKEGL+ LNSW+LDSMGK+GTQLLRHCV +LV V++DL A+R SGIGKTVKEK+C HTSRDIRAIASQLV+VWL+++RK KA+S +K L+
Sbjct: 1057 SGEDYDVLGRPVQNCLFFAGEATCKEHPDTVGGAMMTGVREAVRIIDILRSGNDYTAEIETLEKAQRKSVPVRDEVRDLIKRLEVVELSNVL-----------ARQSLLRNMFFSAKTTVGRLHLAKELLNLPGETLKSFAGTKEGLAVLNSWILDSMGKNGTQLLRHCVHILVRVTSDLFALRLSGIGKTVKEKVCAHTSRDIRAIASQLVNVWLDLYRKEKANSGKKSLR 1277          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy Swiss-Prot
Match: LDL2_ARATH (Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.935e-9
Identity = 28/48 (58.33%), Postives = 36/48 (75.00%), Query Frame = -1
Query:  652 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLIDI 795
            SG DYD+L   V N LFFAGEAT ++HP T+ GA LSGLREA +++ +
Sbjct:  549 SGVDYDILAESVSNRLFFAGEATTRQHPATMHGAYLSGLREASKILHV 596          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy Swiss-Prot
Match: KDM1A_MOUSE (Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 7.336e-8
Identity = 33/76 (43.42%), Postives = 42/76 (55.26%), Query Frame = -1
Query:  604 SGEDYDMLGRPVENC------------LFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEG 795
            SG DYD++ +P+               LFFAGE T + +P TV GA+LSGLREA R+ D F  G  YT   +A  G
Sbjct:  770 SGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQF-LGAMYTLPRQATPG 844          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy Swiss-Prot
Match: KDM1A_HUMAN (Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 7.824e-8
Identity = 33/76 (43.42%), Postives = 42/76 (55.26%), Query Frame = -1
Query:  604 SGEDYDMLGRPVENC------------LFFAGEATCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEG 795
            SG DYD++ +P+               LFFAGE T + +P TV GA+LSGLREA R+ D F  G  YT   +A  G
Sbjct:  769 SGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQF-LGAMYTLPRQATPG 843          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy Swiss-Prot
Match: LDL2_ORYSJ (Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.209e-7
Identity = 26/46 (56.52%), Postives = 35/46 (76.09%), Query Frame = -1
Query:  658 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLI 795
            SG DYD+L   V + LFFAGEAT + +P T+ GA+LSGLREA +++
Sbjct:  551 SGTDYDILAESVNDRLFFAGEATNRAYPATMHGALLSGLREASKIL 596          
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy Swiss-Prot
Match: LDL1_ORYSJ (Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 9.092e-7
Identity = 24/46 (52.17%), Postives = 34/46 (73.91%), Query Frame = -1
Query:  658 SGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRLI 795
            SG+DYD+L   V + +FFAGEAT + +P T+ GA+LSG REA  ++
Sbjct:  668 SGDDYDILAESVCDRVFFAGEATNRRYPATMHGALLSGYREAANIV 713          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0N6J9_GOSAR2.452e-16599.25Lysine-specific histone demethylase 1-like protein... [more]
A0A0D2VVJ1_GOSRA9.955e-16397.74Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2V1W5_GOSRA1.271e-16297.74Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2V1W1_GOSRA5.109e-16197.74Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2SEI6_GOSRA1.766e-15695.85Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FC63_THECC2.995e-14891.32Lysine-specific histone demethylase 1 isoform 1 OS... [more]
A0A061FDX8_THECC3.244e-14891.32Lysine-specific histone demethylase 1 isoform 3 OS... [more]
A0A061FCZ0_THECC3.547e-14891.32Lysine-specific histone demethylase 1 isoform 2 OS... [more]
A0A061FCZ5_THECC5.133e-14891.32Lysine-specific histone demethylase 1 isoform 6 OS... [more]
A0A067HAT5_CITSI1.753e-12981.65Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0000098 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
LDL3_ARATH4.610e-10071.55Lysine-specific histone demethylase 1 homolog 3 OS... [more]
LDL2_ARATH1.935e-958.33Lysine-specific histone demethylase 1 homolog 2 OS... [more]
KDM1A_MOUSE7.336e-843.42Lysine-specific histone demethylase 1A OS=Mus musc... [more]
KDM1A_HUMAN7.824e-843.42Lysine-specific histone demethylase 1A OS=Homo sap... [more]
LDL2_ORYSJ1.209e-756.52Lysine-specific histone demethylase 1 homolog 2 OS... [more]
LDL1_ORYSJ9.092e-752.17Lysine-specific histone demethylase 1 homolog 1 OS... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017923Transcription factor IIS, N-terminalPFAMPF08711Med26coord: 175..209
e-value: 2.2E-4
score: 21.1
IPR017923Transcription factor IIS, N-terminalGENE3D1.20.930.10coord: 136..223
e-value: 3.7E-6
score: 26.1
IPR017923Transcription factor IIS, N-terminalSUPERFAMILY47676Conserved domain common to transcription factors TFIIS, elongin A, CRSP70coord: 137..222
IPR002937Amine oxidasePFAMPF01593Amino_oxidasecoord: 6..40
e-value: 1.6E-8
score: 34.1
IPR023753FAD/NAD(P)-binding domainGENE3D3.50.50.60coord: 2..43
e-value: 1.2E-9
score: 36.9
IPR023753FAD/NAD(P)-binding domainSUPERFAMILY51905FAD/NAD(P)-binding domaincoord: 5..41
NoneNo IPR availablePANTHERPTHR10742AMINE OXIDASEcoord: 1..66
NoneNo IPR availablePANTHERPTHR10742:SF284LYSINE-SPECIFIC HISTONE DEMETHYLASE 1Acoord: 1..66

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0000098 ID=g.arboreum_cottongen_reftransV1_0000098|Name=g.arboreum_cottongen_reftransV1_0000098|organism=Gossypium arboreum|type=contig|length=795bp
AGGATACTGCTTTCCAGCAGGAAATGGATCCTGCAAGCTTGGTTTACTCT
CAAAAGCACCATGTTGTGAGTGTAGAGGCGGCTTTCCTGAAGCAGTATCT
TTAAGGGGTTTTCTCTTTGAAGAAGCTTTTGCCTTACGGAAGACTTCAAG
CCAAACACTAACCAGCTGGCTTGCTATAGCACGTATATCACGACTTGTAT
GCACACAAATTTTTTCCTTCACTGTTTTCCCTATGCCTGATGAACGAACT
GCAAGTAGATCAGTTGAAACAAGCACAAGAAGACGAACACAATGGCGCAA
CAACTGAGTCCCATCTTTCCCCATCGAATCCAGCATCCATGAGTTGAGTG
TGCTAAGCCCTTCCTTTGTCCCAGCAAAGGATTTCAAGGATTCAACTGGG
AGACCTAACAACTTCTTGGCTAGATGCAATCGTCCTGCAGTGGTTTTCAC
ATTAAAGAACATGTCCTGTAGTAAAGCTTCCCTGCTCAAAACCCAAGCAC
GATCCAAAGAGTTTTTGTACAAGACATTAGAAAGTTCAACTGCTTCAAGT
CTCTTAATTATGTCCCTAACTTCATCCCTTCCTGATTCTGATCGTCTCTG
TGCACCCTCCATTGCCTCTACTTCAGCTGTATAATCATTTCCAGTGGTAA
ATATGTCAATTAATCGCACAGCCTCCCGAAGTCCACTCAACATTGCACCA
CCAACTGTGTCAGGATGCTCCTTGCAGGTAGCTTCTCCAGCAAAAAACAA
GCAGTTCTCAACAGGCCTGCCCAGCATATCATAGTCTTCTCCAGA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR017923TFIIS_N
IPR002937Amino_oxidase
IPR023753FAD/NAD-binding_dom
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0006351transcription, DNA-dependent
GO:0055114oxidation-reduction process