g.arboreum_cottongen_reftransV1_0001749, g.arboreum_cottongen_reftransV1_0001749 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0001749
Unique Nameg.arboreum_cottongen_reftransV1_0001749
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length403
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr7chromosomeg.arboreum_cottongen_reftransV1_0001749:1..403 .
Chr7:38851917..38853944 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A0D2QYC9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G007700 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 5.507e-89
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW
Sbjct:  121 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A0D2M531_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G007700 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 7.298e-89
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW
Sbjct:  121 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A0D2Q649_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G007700 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 8.121e-89
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW
Sbjct:  121 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A0B0NUU6_GOSAR (Zinc-binding alcohol dehydrogenase domain-containing 2 OS=Gossypium arboreum GN=F383_01891 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 9.544e-89
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW
Sbjct:  121 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A0D2NGC0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G007700 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 1.156e-88
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW
Sbjct:  121 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A0D2PYU1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G007800 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 1.554e-74
Identity = 113/134 (84.33%), Postives = 123/134 (91.79%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNLVAVIDCTRLAIKTMQA QKPGVIIN  S AGL+P FL P+YS SKGGV++FTRSLTPYKR+GIRVNVLCPE VRTEM EK+DPK +SLMGGFVPME+VVKGAFELITDESRAGSCLWI+NRRG+ YW
Sbjct:  121 HTINVNLVAVIDCTRLAIKTMQAQQKPGVIINVASSAGLYPLFLGPVYSASKGGVIMFTRSLTPYKRQGIRVNVLCPEFVRTEMVEKMDPKLISLMGGFVPMEMVVKGAFELITDESRAGSCLWITNRRGLEYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A0D2NGC6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G007800 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.267e-74
Identity = 113/134 (84.33%), Postives = 123/134 (91.79%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNLVAVIDCTRLAIKTMQA QKPGVIIN  S AGL+P FL P+YS SKGGV++FTRSLTPYKR+GIRVNVLCPE VRTEM EK+DPK +SLMGGFVPME+VVKGAFELITDESRAGSCLWI+NRRG+ YW
Sbjct:  121 HTINVNLVAVIDCTRLAIKTMQAQQKPGVIINVASSAGLYPLFLGPVYSASKGGVIMFTRSLTPYKRQGIRVNVLCPEFVRTEMVEKMDPKLISLMGGFVPMEMVVKGAFELITDESRAGSCLWITNRRGLEYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A061DZW3_THECC (ARP protein (REF) isoform 3 OS=Theobroma cacao GN=TCM_007040 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 8.113e-74
Identity = 109/134 (81.34%), Postives = 123/134 (91.79%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNL+AV+DCTRLAIKTMQALQKPGVIIN GS AGL+P ++DPIYSGSK GVV+FTRSL PYKR+GIRVNVLCPE V+TEMGEKL  +++SLMGGFVPME+VVKGA ELI D+SRAGSCLWI+NRRGM YW
Sbjct:  121 HTINVNLIAVVDCTRLAIKTMQALQKPGVIINLGSAAGLYPAYVDPIYSGSKAGVVMFTRSLAPYKRQGIRVNVLCPEFVQTEMGEKLGHRFISLMGGFVPMEMVVKGALELIMDKSRAGSCLWITNRRGMEYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A061DZP5_THECC (ARP protein (REF) isoform 2 OS=Theobroma cacao GN=TCM_007040 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.727e-72
Identity = 109/134 (81.34%), Postives = 123/134 (91.79%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNL+AV+DCTRLAIKTMQALQKPGVIIN GS AGL+P ++DPIYSGSK GVV+FTRSL PYKR+GIRVNVLCPE V+TEMGEKL  +++SLMGGFVPME+VVKGA ELI D+SRAGSCLWI+NRRGM YW
Sbjct:  121 HTINVNLIAVVDCTRLAIKTMQALQKPGVIINLGSAAGLYPAYVDPIYSGSKAGVVMFTRSLAPYKRQGIRVNVLCPEFVQTEMGEKLGHRFISLMGGFVPMEMVVKGALELIMDKSRAGSCLWITNRRGMEYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Match: A0A061E7L3_THECC (ARP protein (REF) isoform 1 OS=Theobroma cacao GN=TCM_007040 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.131e-72
Identity = 109/134 (81.34%), Postives = 123/134 (91.79%), Query Frame = -1
Query:    2 HTINVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVKGAFELITDESRAGSCLWISNRRGMVYW 403
            HTINVNL+AV+DCTRLAIKTMQALQKPGVIIN GS AGL+P ++DPIYSGSK GVV+FTRSL PYKR+GIRVNVLCPE V+TEMGEKL  +++SLMGGFVPME+VVKGA ELI D+SRAGSCLWI+NRRGM YW
Sbjct:  121 HTINVNLIAVVDCTRLAIKTMQALQKPGVIINLGSAAGLYPAYVDPIYSGSKAGVVMFTRSLAPYKRQGIRVNVLCPEFVQTEMGEKLGHRFISLMGGFVPMEMVVKGALELIMDKSRAGSCLWITNRRGMEYW 254          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: PGDH_CAVPO (15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.188e-15
Identity = 50/152 (32.89%), Postives = 74/152 (48.68%), Query Frame = -1
Query:    5 TINVNLVAVIDCTRLAIKTM--QALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTPYKR---EGIRVNVLCPEVVRT------EMGEKLDPKYVSLMG---------GFVPMELVVKGAFELITDESRAGSCLWISNRRGMVY 400
            T+ +NLV+VI  T L +  M  Q   + GVIIN  S AGL P    P+Y  SK G++ FTRS    ++    G+R+N +CP  V T      E  E + P Y+   G         G +  E++  G   LI D+   G+ + I+   G+ +
Sbjct:  103 TLQINLVSVISGTYLGLDYMSKQHGGEGGVIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMARKLMNSGVRMNAICPGFVNTSILQSIEKEENMGP-YIEYTGHIKDMMKCYGILDPEMIANGLITLIEDDDLNGAIMKITTSNGIHF 253          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: PGDH_BOVIN (15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 9.282e-14
Identity = 47/151 (31.13%), Postives = 74/151 (49.01%), Query Frame = -1
Query:    5 TINVNLVAVIDCTRLAIKTM--QALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRS---LTPYKREGIRVNVLCPEVVRTEMGEKLDP-----KYVSLMG---------GFVPMELVVKGAFELITDESRAGSCLWISNRRGMVY 400
            T+ +NLV+VI  T L +  M  Q   + G+ IN  S AGL P    P+Y  SK G+V FTRS          G+R+N +CP  V T + + ++      KY+  MG         G +   ++  G   LI D++  G+ + I+  +G+ +
Sbjct:  103 TLQINLVSVISGTYLGLDYMSKQNGGEGGININMSSLAGLMPVAQQPVYCASKHGIVGFTRSAAMAANLMNSGVRLNAICPGFVDTPILKSIEKEENMGKYIEYMGPIKDMMKYYGILDPSMIANGLITLIEDDALNGAIMKITTSKGIHF 253          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: PGDH_HUMAN (15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.229e-13
Identity = 47/153 (30.72%), Postives = 74/153 (48.37%), Query Frame = -1
Query:    5 TINVNLVAVIDCTRLAIKTM--QALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRS---LTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPME----------------LVVKGAFELITDESRAGSCLWISNRRGMVY 400
            T+ +NLV+VI  T L +  M  Q   + G+IIN  S AGL P    P+Y  SK G+V FTRS          G+R+N +CP  V T + E ++ +    MG ++  +                L+  G   LI D++  G+ + I+  +G+ +
Sbjct:  103 TLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKE--ENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHF 253          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: PGDH_MACFA (15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.297e-13
Identity = 47/153 (30.72%), Postives = 74/153 (48.37%), Query Frame = -1
Query:    5 TINVNLVAVIDCTRLAIKTM--QALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRS---LTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPME----------------LVVKGAFELITDESRAGSCLWISNRRGMVY 400
            T+ +NLV+VI  T L +  M  Q   + G+IIN  S AGL P    P+Y  SK G+V FTRS          G+R+N +CP  V T + E ++ +    MG ++  +                L+  G   LI D++  G+ + I+  +G+ +
Sbjct:  103 TLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKE--ENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHF 253          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: PGDH_MOUSE (15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.620e-13
Identity = 47/154 (30.52%), Postives = 76/154 (49.35%), Query Frame = -1
Query:    5 HTINVNLVAVIDCTRLAIKTM--QALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRS---LTPYKREGIRVNVLCPEVVRTEMGEKLDPKYVSLMGGFVPMELVVK----------------GAFELITDESRAGSCLWISNRRGMVY 403
             T+ +NLV+VI  T L +  M  Q   + G+IIN  S AGL P    P+Y  SK G++ FTRS        + G+R+NV+CP  V T + E ++ +    MG ++  +  +K                G   LI D++  G+ + I+  +G+ +
Sbjct:  102 QTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTPILESIEKE--ENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNGAIMKITASKGIHF 253          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: CBR4_MOUSE (Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 2.260e-10
Identity = 35/91 (38.46%), Postives = 53/91 (58.24%), Query Frame = -1
Query:  128 INVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTP-YKREGIRVNVLCPEVVRTEMGEKLDPKY 397
            ++ NL+  +   + A+KTM  +Q+ G I+N GS  GL        YS +KGG+V F+RSL     R+ IRVNV+ P  +RT+M   L  ++
Sbjct:  104 LHTNLLGSMLTCKAAMKTM--IQQGGSIVNVGSIIGLKGNVGQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDMTRHLKEEH 192          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: CBR4_RAT (Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 5.065e-10
Identity = 33/91 (36.26%), Postives = 53/91 (58.24%), Query Frame = -1
Query:  128 INVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLTP-YKREGIRVNVLCPEVVRTEMGEKLDPKY 397
            ++ NL+  +   R A++TM  +Q+ G I+N GS  GL        YS +KGG++ F+RSL     R+ IRVNV+ P  + T+M + L  ++
Sbjct:  104 LHTNLLGTMLTCRAAMRTM--IQQGGSIVNVGSIIGLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHLKEEH 192          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: BACC_BACSU (Bacilysin biosynthesis oxidoreductase BacC OS=Bacillus subtilis (strain 168) GN=bacC PE=3 SV=2)

HSP 1 Score: 58.5362 bits (140), Expect = 6.012e-10
Identity = 35/86 (40.70%), Postives = 50/86 (58.14%), Query Frame = -1
Query:  143 INVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLT-PYKREGIRVNVLCPEVVRTEMGEK 397
            + VNL  +   ++ A+K M A  K G IINT S  GL  +   P Y+ SKGGV+  T+S+   Y +  IRVN +CP ++ T + EK
Sbjct:  108 LQVNLTGMFLMSKHALKHMLAAGK-GNIINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNEK 192          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: DH12A_DANRE (Very-long-chain 3-oxoacyl-CoA reductase-A OS=Danio rerio GN=hsd17b12a PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 7.057e-10
Identity = 38/89 (42.70%), Postives = 52/89 (58.43%), Query Frame = -1
Query:  134 INVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSL-TPYKREGIRVNVLCPEVVRTEMGEKLDP 397
            INVN+ +V   TRL +  M+A  K GVI+N  S +G+FP  L  IYS +K  V  F+R L T YK +GI +  + P  V T+M +   P
Sbjct:  164 INVNITSVCQMTRLVLPRMEARAK-GVILNISSASGMFPVPLLTIYSSTKAFVDFFSRGLQTEYKCKGIIIQSVLPFFVATKMTKIRKP 251          
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Match: BACC2_BACIU (Bacilysin biosynthesis oxidoreductase BacC OS=Bacillus subtilis GN=bacC PE=3 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 7.211e-10
Identity = 35/86 (40.70%), Postives = 50/86 (58.14%), Query Frame = -1
Query:  143 INVNLVAVIDCTRLAIKTMQALQKPGVIINTGSYAGLFPFFLDPIYSGSKGGVVLFTRSLT-PYKREGIRVNVLCPEVVRTEMGEK 397
            +NVNL  +   ++ A+K M    K G IINT S  G+  +   P Y+ SKGGV+  TRS+   Y +  IRVN +CP ++ T + EK
Sbjct:  108 LNVNLTGMFLMSKHALKYMLKSGK-GNIINTCSVGGVVAWPDIPAYNASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIDTPLNEK 192          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2QYC9_GOSRA5.507e-89100.00Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2M531_GOSRA7.298e-89100.00Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2Q649_GOSRA8.121e-89100.00Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0NUU6_GOSAR9.544e-89100.00Zinc-binding alcohol dehydrogenase domain-containi... [more]
A0A0D2NGC0_GOSRA1.156e-88100.00Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PYU1_GOSRA1.554e-7484.33Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2NGC6_GOSRA2.267e-7484.33Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061DZW3_THECC8.113e-7481.34ARP protein (REF) isoform 3 OS=Theobroma cacao GN=... [more]
A0A061DZP5_THECC1.727e-7281.34ARP protein (REF) isoform 2 OS=Theobroma cacao GN=... [more]
A0A061E7L3_THECC2.131e-7281.34ARP protein (REF) isoform 1 OS=Theobroma cacao GN=... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0001749 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
PGDH_CAVPO6.188e-1532.8915-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=... [more]
PGDH_BOVIN9.282e-1431.1315-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=... [more]
PGDH_HUMAN2.229e-1330.7215-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=... [more]
PGDH_MACFA2.297e-1330.7215-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=... [more]
PGDH_MOUSE2.620e-1330.5215-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=... [more]
CBR4_MOUSE2.260e-1038.46Carbonyl reductase family member 4 OS=Mus musculus... [more]
CBR4_RAT5.065e-1036.26Carbonyl reductase family member 4 OS=Rattus norve... [more]
BACC_BACSU6.012e-1040.70Bacilysin biosynthesis oxidoreductase BacC OS=Baci... [more]
DH12A_DANRE7.057e-1042.70Very-long-chain 3-oxoacyl-CoA reductase-A OS=Danio... [more]
BACC2_BACIU7.211e-1040.70Bacilysin biosynthesis oxidoreductase BacC OS=Baci... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 62..79
score: 38.32
coord: 42..61
score: 30.79
coord: 16..32
score: 32.46
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 2..85
e-value: 2.1E-17
score: 63.1
IPR016040NAD(P)-binding domainGENE3D3.40.50.720coord: 3..122
e-value: 1.0E-21
score: 76.8
IPR016040NAD(P)-binding domainSUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 3..120

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0001749 ID=g.arboreum_cottongen_reftransV1_0001749|Name=g.arboreum_cottongen_reftransV1_0001749|organism=Gossypium arboreum|type=contig|length=403bp
GCCAATATACCATGCCTCTGCGGTTTGAAATCCATAGGCAAGAACCAGCT
CTGCTTTCATCAGTGATAAGCTCGAAAGCACCTTTTACCACCAACTCCAT
TGGCACAAAGCCTCCCATTAGAGATACATATTTGGGGTCCAGTTTTTCTC
CCATCTCTGTTCGAACAACCTCAGGGCAAAGAACATTGACACGTATTCCT
TCACGTTTGTACGGAGTTAGTGATCTAGTAAACAAGACAACACCTCCTTT
TGAGCCAGAGTAAATGGGGTCCAAGAAAAATGGGAAAAGACCAGCATAAG
ATCCTGTATTGATTATCACCCCTGGCTTTTGCAGAGCTTGCATAGTTTTA
ATTGCAAGGCGAGTACAATCAATAACTGCAACCAGGTTGACATTAATGGT
GTG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom