g.arboreum_cottongen_reftransV1_0008171, g.arboreum_cottongen_reftransV1_0008171 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0008171
Unique Nameg.arboreum_cottongen_reftransV1_0008171
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length462
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeg.arboreum_cottongen_reftransV1_0008171:1..462 .
Chr1:134866698..134868245 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: A0A0B0NS35_GOSAR (Serine/threonine-protein kinase HT1 OS=Gossypium arboreum GN=F383_08472 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 2.937e-89
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSKEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            STVDKPKLLSQLTSLLAELGLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSKEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS
Sbjct:  181 STVDKPKLLSQLTSLLAELGLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSKEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 333          
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: A0A0D2REG1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G005100 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 2.834e-88
Identity = 152/153 (99.35%), Postives = 153/153 (100.00%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSKEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            STVDKPKLLSQLTSLLAELGLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKS+EQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS
Sbjct:  181 STVDKPKLLSQLTSLLAELGLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSQEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 333          
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: A0A061DGE3_THECC (ACT-like protein tyrosine kinase family protein OS=Theobroma cacao GN=TCM_000116 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 7.237e-71
Identity = 129/153 (84.31%), Postives = 141/153 (92.16%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSKEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            STVD+PKLLSQLTS LAE+GLNIQEAHAFSTVDGYSLDVFVVDGWPFEET+EL++ALEKEILKSKE+   RKSSISAMT  +KE  +SLP+CVEIPTDGTDVWEID+RQLK E+KIASGSYGDLYRGTY SQEVAIKVLKPE VT E+LREFS
Sbjct:  186 STVDRPKLLSQLTSFLAEIGLNIQEAHAFSTVDGYSLDVFVVDGWPFEETEELRNALEKEILKSKEKCYSRKSSISAMTEHIKEGVISLPDCVEIPTDGTDVWEIDTRQLKFENKIASGSYGDLYRGTYCSQEVAIKVLKPECVTEEMLREFS 338          
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: A0A0D2THR8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G190200 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 4.696e-67
Identity = 127/153 (83.01%), Postives = 139/153 (90.85%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSKEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            STVD+PKLLSQLTSLLAE+GLNIQEAHAFST DGYSLDVFVVDGWP EE +ELK+ALEKEILKSKEQS  RKSS+  MT  VKE  VSLP+CVEIPTDGTDVWEID+RQLKIE++IASGSY DLYRGTY SQEVAIKVLKPE++T E+LREFS
Sbjct:  186 STVDRPKLLSQLTSLLAEIGLNIQEAHAFSTTDGYSLDVFVVDGWPSEEIEELKNALEKEILKSKEQSYSRKSSV--MTEHVKERVVSLPSCVEIPTDGTDVWEIDARQLKIENRIASGSYADLYRGTYCSQEVAIKVLKPEQITREMLREFS 336          
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: A0A0D2SMR5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G190200 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.784e-65
Identity = 127/155 (81.94%), Postives = 139/155 (89.68%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSK--EQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            STVD+PKLLSQLTSLLAE+GLNIQEAHAFST DGYSLDVFVVDGWP EE +ELK+ALEKEILKSK  EQS  RKSS+  MT  VKE  VSLP+CVEIPTDGTDVWEID+RQLKIE++IASGSY DLYRGTY SQEVAIKVLKPE++T E+LREFS
Sbjct:  186 STVDRPKLLSQLTSLLAEIGLNIQEAHAFSTTDGYSLDVFVVDGWPSEEIEELKNALEKEILKSKLQEQSYSRKSSV--MTEHVKERVVSLPSCVEIPTDGTDVWEIDARQLKIENRIASGSYADLYRGTYCSQEVAIKVLKPEQITREMLREFS 338          
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: A0A0D2SG68_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G190200 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.234e-65
Identity = 127/155 (81.94%), Postives = 139/155 (89.68%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSK--EQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            STVD+PKLLSQLTSLLAE+GLNIQEAHAFST DGYSLDVFVVDGWP EE +ELK+ALEKEILKSK  EQS  RKSS+  MT  VKE  VSLP+CVEIPTDGTDVWEID+RQLKIE++IASGSY DLYRGTY SQEVAIKVLKPE++T E+LREFS
Sbjct:  186 STVDRPKLLSQLTSLLAEIGLNIQEAHAFSTTDGYSLDVFVVDGWPSEEIEELKNALEKEILKSKLQEQSYSRKSSV--MTEHVKERVVSLPSCVEIPTDGTDVWEIDARQLKIENRIASGSYADLYRGTYCSQEVAIKVLKPEQITREMLREFS 338          
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: A0A0B0MHN9_GOSAR (Serine/threonine-protein kinase HT1 OS=Gossypium arboreum GN=F383_23334 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 3.422e-64
Identity = 125/155 (80.65%), Postives = 138/155 (89.03%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSK--EQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            STVD+PKLLSQLTSLLAE+GLNIQEAHAFST DGYSLDVFVVDGWP EE +ELK+ALEKEI KSK  EQS  RKSS+  MT  VKE  VSLP+CVEIPTDGTD+WEID+RQLKIE++IASGSY DLYRGTY SQEVAIKVLKPE++T E+LREFS
Sbjct:  186 STVDRPKLLSQLTSLLAEIGLNIQEAHAFSTTDGYSLDVFVVDGWPSEEIEELKNALEKEISKSKLQEQSYSRKSSV--MTEHVKERVVSLPSCVEIPTDGTDLWEIDARQLKIENRIASGSYADLYRGTYCSQEVAIKVLKPEQITREMLREFS 338          
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: B9N912_POPTR (Kinase family protein OS=Populus trichocarpa GN=POPTR_0007s09290g PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 3.336e-60
Identity = 117/153 (76.47%), Postives = 135/153 (88.24%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSKEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            STVD+PKLLSQLTSLLAE+GLNIQEAHAFSTVDG+SLDVFVVDGW  EET+EL++ALEKEILKSKEQ   ++ S+S +    K    SLP+CVEIP+DGTDVWEID+  LK+E+K+ASGSYGDLYRGTY SQEVAIKVLKPERV+GE+LREFS
Sbjct:  197 STVDRPKLLSQLTSLLAEIGLNIQEAHAFSTVDGFSLDVFVVDGWLREETEELRNALEKEILKSKEQCFSKQLSVSLVGEQNKTGVESLPDCVEIPSDGTDVWEIDTSLLKVENKVASGSYGDLYRGTYCSQEVAIKVLKPERVSGEMLREFS 349          
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: V4UGW7_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10025256mg PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.941e-60
Identity = 111/153 (72.55%), Postives = 131/153 (85.62%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSKEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            ST+DKPKLL+QLTSLL E+GLNIQEAHAFSTVDG+SLDVFVVDGWP++ET++LK+ L KEILKSK+QSC ++     +    K    S PNC+EIPTDGTDVWEID++QLKIE K+ASGSYGDLY+GTY SQEVAIKVLKPERV  E+L+EFS
Sbjct:  122 STIDKPKLLTQLTSLLGEIGLNIQEAHAFSTVDGFSLDVFVVDGWPYDETEDLKNVLAKEILKSKDQSCSKRQPTLGVPMHSKLLIESSPNCIEIPTDGTDVWEIDAKQLKIECKVASGSYGDLYKGTYCSQEVAIKVLKPERVNTEMLKEFS 274          
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Match: V4SIA7_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10025256mg PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.618e-59
Identity = 111/153 (72.55%), Postives = 131/153 (85.62%), Query Frame = -3
Query:    2 STVDKPKXXXXXXXXXXXXXLNIQEAHAFSTVDGYSLDVFVVDGWPFEETKELKDALEKEILKSKEQSCVRKSSISAMTGLVKEEAVSLPNCVEIPTDGTDVWEIDSRQLKIEHKIASGSYGDLYRGTYYSQEVAIKVLKPERVTGELLREFS 460
            ST+DKPKLL+QLTSLL E+GLNIQEAHAFSTVDG+SLDVFVVDGWP++ET++LK+ L KEILKSK+QSC ++     +    K    S PNC+EIPTDGTDVWEID++QLKIE K+ASGSYGDLY+GTY SQEVAIKVLKPERV  E+L+EFS
Sbjct:  185 STIDKPKLLTQLTSLLGEIGLNIQEAHAFSTVDGFSLDVFVVDGWPYDETEDLKNVLAKEILKSKDQSCSKRQPTLGVPMHSKLLIESSPNCIEIPTDGTDVWEIDAKQLKIECKVASGSYGDLYKGTYCSQEVAIKVLKPERVNTEMLKEFS 337          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NS35_GOSAR2.937e-89100.00Serine/threonine-protein kinase HT1 OS=Gossypium a... [more]
A0A0D2REG1_GOSRA2.834e-8899.35Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061DGE3_THECC7.237e-7184.31ACT-like protein tyrosine kinase family protein OS... [more]
A0A0D2THR8_GOSRA4.696e-6783.01Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2SMR5_GOSRA1.784e-6581.94Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2SG68_GOSRA3.234e-6581.94Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MHN9_GOSAR3.422e-6480.65Serine/threonine-protein kinase HT1 OS=Gossypium a... [more]
B9N912_POPTR3.336e-6076.47Kinase family protein OS=Populus trichocarpa GN=PO... [more]
V4UGW7_9ROSI3.941e-6072.55Uncharacterized protein OS=Citrus clementina GN=CI... [more]
V4SIA7_9ROSI1.618e-5972.55Uncharacterized protein OS=Citrus clementina GN=CI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0008171 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 36..56
NoneNo IPR availableGENE3D3.30.200.20coord: 79..140
e-value: 2.8E-12
score: 46.0
NoneNo IPR availablePANTHERPTHR23257SERINE-THREONINE PROTEIN KINASEcoord: 1..142
NoneNo IPR availablePANTHERPTHR23257:SF492SUBFAMILY NOT NAMEDcoord: 1..142
NoneNo IPR availableSUPERFAMILY55021ACT-likecoord: 2..49
IPR002912ACT domainPROSITEPS51671ACTcoord: 1..67
score: 11.082
IPR011009Protein kinase-like domainSUPERFAMILY56112Protein kinase-like (PK-like)coord: 85..141

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0008171 ID=g.arboreum_cottongen_reftransV1_0008171|Name=g.arboreum_cottongen_reftransV1_0008171|organism=Gossypium arboreum|type=contig|length=462bp
GAGAAAACTCTCTCAGCAATTCCCCTGTAACCCGCTCAGGCTTGAGGACT
TTAATAGCCACTTCTTGACTATAATATGTGCCTCTGTATAGATCGCCATA
GGACCCAGATGCAATCTTGTGTTCAATTTTGAGCTGCCTGGAATCAATTT
CCCACACATCAGTTCCATCGGTCGGGATTTCAACACAATTGGGTAAAGAA
ACGGCCTCTTCTTTGACAAGCCCGGTCATAGCAGATATTGAACTCTTTCT
CACACAAGATTGCTCCTTAGACTTTAAAATTTCCTTCTCCAGTGCATCTT
TGAGCTCCTTGGTTTCCTCAAAGGGCCAACCATCAACAACAAAAACATCC
AAAGAGTACCCATCAACAGTGGAAAAAGCATGAGCTTCCTGAATGTTCAA
TCCAAGCTCCGCAAGTAAAGAAGTCAACTGACTAAGGAGTTTTGGCTTGT
CAACTGTAGAAA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002912ACT_dom
IPR011009Kinase-like_dom_sf
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0016597amino acid binding