g.arboreum_cottongen_reftransV1_0014616, g.arboreum_cottongen_reftransV1_0014616 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0014616
Unique Nameg.arboreum_cottongen_reftransV1_0014616
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2068
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeg.arboreum_cottongen_reftransV1_0014616:1..2068 .
Chr1:137483326..137489164 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A0D2NU36_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G000800 PE=4 SV=1)

HSP 1 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 512/533 (96.06%), Postives = 514/533 (96.44%), Query Frame = -2
Query:  331 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQS 1929
            MEFEITDTKENENKERELVVPVLGASNLN GD PVSPPLQQHPSSPSP P    M ANSIT HTGHANA  NIQPHSTPAHHSTCLL VSNDQSSLKPD+ETTSNVKSESS IFHFKTHTDSTSDHI AAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRG ELNIPISSQ+EAMNVDNQASGSGRARRDAAARAMRGWHSRHFRN EV EPI KDKN ISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQS
Sbjct:    1 MEFEITDTKENENKERELVVPVLGASNLNGGDHPVSPPLQQHPSSPSPVP----MEANSITSHTGHANAGRNIQPHSTPAHHSTCLLPVSNDQSSLKPDVETTSNVKSESSSIFHFKTHTDSTSDHIQAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGAELNIPISSQAEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNCEVSEPIIKDKNSISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQS 529          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A0B0MJU6_GOSAR (AT-rich interactive domain-containing 3-like protein OS=Gossypium arboreum GN=F383_24040 PE=4 SV=1)

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 515/533 (96.62%), Postives = 516/533 (96.81%), Query Frame = -2
Query:  331 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQS 1929
            MEFEITDTKENENKERELVVPVLGASNLNDGDRPVSPPLQQHPSSPSPSPSPVPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLD+IHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKT                 VRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQS
Sbjct:    1 MEFEITDTKENENKERELVVPVLGASNLNDGDRPVSPPLQQHPSSPSPSPSPVPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDEIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKT-----------------VRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQS 516          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A0D2QKM9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G000800 PE=4 SV=1)

HSP 1 Score: 971.844 bits (2511), Expect = 0.000e+0
Identity = 512/541 (94.64%), Postives = 514/541 (95.01%), Query Frame = -2
Query:  331 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSL--------GLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQS 1929
            MEFEITDTKENENKERELVVPVLGASNLN GD PVSPPLQQHPSSPSP P    M ANSIT HTGHANA  NIQPHSTPAHHSTCLL VSNDQSSLKPD+ETTSNVKSESS IFHFKTHTDSTSDHI AAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRG ELNIPISSQ+EAMNVDNQASGSGRARRDAAARAMRGWHSRHFRN EV EPI KDKN ISQQKREKQLKSL        GLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQS
Sbjct:    1 MEFEITDTKENENKERELVVPVLGASNLNGGDHPVSPPLQQHPSSPSPVP----MEANSITSHTGHANAGRNIQPHSTPAHHSTCLLPVSNDQSSLKPDVETTSNVKSESSSIFHFKTHTDSTSDHIQAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGAELNIPISSQAEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNCEVSEPIIKDKNSISQQKREKQLKSLAGFLHINAGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQS 537          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A0D2NU39_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G000800 PE=4 SV=1)

HSP 1 Score: 914.835 bits (2363), Expect = 0.000e+0
Identity = 482/508 (94.88%), Postives = 486/508 (95.67%), Query Frame = -2
Query:  406 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSR 1929
            MEFEITDTKENENKERELVVPVLGASNLN GD PVSPPLQQHPSSPSP P    M ANSIT HTGHANA  NIQPHSTPAHHSTCLL VSNDQSSLKPD+ETTSNVKSESS IFHFKTHTDSTSDHI AAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRG ELNIPISSQ+EAMNVDNQASGSGRARRDAAARAMRGWHSRHFRN EV EPI KDKN ISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKV++   R
Sbjct:    1 MEFEITDTKENENKERELVVPVLGASNLNGGDHPVSPPLQQHPSSPSPVP----MEANSITSHTGHANAGRNIQPHSTPAHHSTCLLPVSNDQSSLKPDVETTSNVKSESSSIFHFKTHTDSTSDHIQAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGAELNIPISSQAEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNCEVSEPIIKDKNSISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVLSTCPR 504          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A0D2QKM1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G000800 PE=4 SV=1)

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 451/475 (94.95%), Postives = 454/475 (95.58%), Query Frame = -2
Query:  505 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQS 1929
            MEFEITDTKENENKERELVVPVLGASNLN GD PVSPPLQQHPSSPSP P    M ANSIT HTGHANA  NIQPHSTPAHHSTCLL VSNDQSSLKPD+ETTSNVKSESS IFHFKTHTDSTSDHI AAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRG ELNIPISSQ+EAMNVDNQASGSGRARRDAAARAMRGWHSRHFRN EV EPI KDKN ISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEV  Q+
Sbjct:    1 MEFEITDTKENENKERELVVPVLGASNLNGGDHPVSPPLQQHPSSPSPVP----MEANSITSHTGHANAGRNIQPHSTPAHHSTCLLPVSNDQSSLKPDVETTSNVKSESSSIFHFKTHTDSTSDHIQAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGAELNIPISSQAEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNCEVSEPIIKDKNSISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVSEQT 471          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A0D2QDF0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G000800 PE=4 SV=1)

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 449/471 (95.33%), Postives = 452/471 (95.97%), Query Frame = -2
Query:  517 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEV 1929
            MEFEITDTKENENKERELVVPVLGASNLN GD PVSPPLQQHPSSPSP P    M ANSIT HTGHANA  NIQPHSTPAHHSTCLL VSNDQSSLKPD+ETTSNVKSESS IFHFKTHTDSTSDHI AAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRG ELNIPISSQ+EAMNVDNQASGSGRARRDAAARAMRGWHSRHFRN EV EPI KDKN ISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREE+
Sbjct:    1 MEFEITDTKENENKERELVVPVLGASNLNGGDHPVSPPLQQHPSSPSPVP----MEANSITSHTGHANAGRNIQPHSTPAHHSTCLLPVSNDQSSLKPDVETTSNVKSESSSIFHFKTHTDSTSDHIQAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGAELNIPISSQAEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNCEVSEPIIKDKNSISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEL 467          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A0D2RE39_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G000800 PE=4 SV=1)

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 449/470 (95.53%), Postives = 451/470 (95.96%), Query Frame = -2
Query:  520 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREE 1929
            MEFEITDTKENENKERELVVPVLGASNLN GD PVSPPLQQHPSSPSP P    M ANSIT HTGHANA  NIQPHSTPAHHSTCLL VSNDQSSLKPD+ETTSNVKSESS IFHFKTHTDSTSDHI AAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRG ELNIPISSQ+EAMNVDNQASGSGRARRDAAARAMRGWHSRHFRN EV EPI KDKN ISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREE
Sbjct:    1 MEFEITDTKENENKERELVVPVLGASNLNGGDHPVSPPLQQHPSSPSPVP----MEANSITSHTGHANAGRNIQPHSTPAHHSTCLLPVSNDQSSLKPDVETTSNVKSESSSIFHFKTHTDSTSDHIQAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGAELNIPISSQAEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNCEVSEPIIKDKNSISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREE 466          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A0D2MH95_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G000800 PE=4 SV=1)

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 432/453 (95.36%), Postives = 434/453 (95.81%), Query Frame = -2
Query:  571 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKT 1929
            MEFEITDTKENENKERELVVPVLGASNLN GD PVSPPLQQHPSSPSP P    M ANSIT HTGHANA  NIQPHSTPAHHSTCLL VSNDQSSLKPD+ETTSNVKSESS IFHFKTHTDSTSDHI AAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRG ELNIPISSQ+EAMNVDNQASGSGRARRDAAARAMRGWHSRHFRN EV EPI KDKN ISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKT
Sbjct:    1 MEFEITDTKENENKERELVVPVLGASNLNGGDHPVSPPLQQHPSSPSPVP----MEANSITSHTGHANAGRNIQPHSTPAHHSTCLLPVSNDQSSLKPDVETTSNVKSESSSIFHFKTHTDSTSDHIQAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGAELNIPISSQAEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNCEVSEPIIKDKNSISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKT 449          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A0D2QDF3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G000800 PE=4 SV=1)

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 389/430 (90.47%), Postives = 398/430 (92.56%), Query Frame = -2
Query:  649 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLD---CAVKASCTKV 1929
            MEFEITDTKENENKERELVVPVLGASNLN GD PVSPPLQQHPSSPSP P    M ANSIT HTGHANA  NIQPHSTPAHHSTCLL VSNDQSSLKPD+ETTSNVKSESS IFHFKTHTDSTSDHI AAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRG ELNIPISSQ+EAMNVDNQASGSGRARRDAAARAMRGWHSRHFRN EV EPI KDKN ISQQKREKQLKS  L+ R++   LD     +++ C K+
Sbjct:    1 MEFEITDTKENENKERELVVPVLGASNLNGGDHPVSPPLQQHPSSPSPVP----MEANSITSHTGHANAGRNIQPHSTPAHHSTCLLPVSNDQSSLKPDVETTSNVKSESSSIFHFKTHTDSTSDHIQAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGAELNIPISSQAEAMNVDNQASGSGRARRDAAARAMRGWHSRHFRNCEVSEPIIKDKNSISQQKREKQLKS--LVWRQQWLILDPQQIGLRSMCRKL 424          

HSP 2 Score: 66.6254 bits (161), Expect = 2.819e-8
Identity = 33/51 (64.71%), Postives = 34/51 (66.67%), Query Frame = -3
Query:  486 MWRQQWLILDPQQIGLRSMCRKLKIVLRSML*FQAFFVRRCVFNLILQDAW 638
            +WRQQWLILDPQQIGLRSMCRKL                 CVFNLILQDAW
Sbjct:  402 VWRQQWLILDPQQIGLRSMCRKL-----------------CVFNLILQDAW 435          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Match: A0A061DFY7_THECC (ARID/BRIGHT DNA-binding domain-containing protein, putative OS=Theobroma cacao GN=TCM_000019 PE=4 SV=1)

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 394/538 (73.23%), Postives = 431/538 (80.11%), Query Frame = -2
Query:  334 MEFEITDTKENENKERELVVPVLGASNLNDGDRXXXXXXXXXXXXXXXXXXXXPMAANSITYHTGHANADSNIQPHSTPAHHSTCLLRVSNDQSSLKPDIETTSNVKSESSFI---FHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHS-RHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAH--VETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQ 1929
            M+  I+DTKENEN E EL VP  GAS++N GD P +P LQ+  SSPS  P    + ANSI   T + NAD+NI+PHSTP  HS   + + NDQ+SLKP  E  SNVKSESS +         + S+S+HI  AE TTDVKTETSS SPPK   NAKTET SAL  SKTN D +P+PT  +EPE LTP P  SD++L+KEK +DLKNG NK +LPT PVNGN+NSELSF  DD+HFSDGNESGTEEEQS FMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVT+LGGYDKVTSCKLWRQVGESFKPPKT   +           +   + HKT GGELNIPI+SQSE MNVDNQA+GSGRARRDAAARAMRGWHS RH  NGEV +PI KDKN IS QKREKQLKSLGLLKRKKPSYLD AVKA+ TKV KA   VET VVDIG PADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVV+LP+RIDPHQTSAVVTLHGQLFVRVPFEQ
Sbjct:    4 MDSMISDTKENEN-EAELAVP--GASDMNQGDHPGTPQLQEQSSSPSSVP----VEANSIPSQTENTNADNNIEPHSTPPQHSLSSVPIHNDQASLKPATEIPSNVKSESSDLKAPMDATIDSPSSSNHIQIAEPTTDVKTETSSGSPPKPAANAKTETCSALPLSKTNCDIDPVPTSPNEPEQLTPCPSSSDIKLVKEKGDDLKNGVNKVDLPTAPVNGNSNSELSFRFDDVHFSDGNESGTEEEQSAFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTRLGGYDKVTSCKLWRQVGESFKPPKTQMLL-----------IHKMKMHKTCGGELNIPIASQSEPMNVDNQAAGSGRARRDAAARAMRGWHSQRHLSNGEVSDPIIKDKNSISLQKREKQLKSLGLLKRKKPSYLDHAVKAARTKVSKAQLSVETTVVDIGPPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVSLPARIDPHQTSAVVTLHGQLFVRVPFEQ 523          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy Swiss-Prot
Match: ARID3_ARATH (AT-rich interactive domain-containing protein 3 OS=Arabidopsis thaliana GN=ARID3 PE=1 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 3.841e-153
Identity = 260/444 (58.56%), Postives = 314/444 (70.72%), Query Frame = -2
Query:  334 DQSSLKPDIETTSNVKSESSFIFHFKTHTDSTSDHILAAEATTDVKTETSSVSPPKLTENAKTETSSALTQSKTNYDCNPIPTCLDEPEPLTPSPLFSDMELLKEKVEDLKNGDNKTELPTTPV-NGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHSRHFR-NGEVCEPITKDKNFISQQKREKQLKSL-GLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQ 1656
            D+  +  D E T ++K +   +   K  TD+T D     +A  +  TE             + + SSAL  +  N +  P+      P P   S   S+++       DL NG +K  + T PV +G   ++ SF LDD   SDGNESGTEE+QS FMK+L+ FF+ER M+FKPPKFYGEGLNCLKLWRAVT+LGGYDKVT  KLWRQVGESF+PPKTCTTVSWTFRGFYEKALL+YERHK   GEL IP+  + E MN+DNQASGSGRARRDAA+RAM+GWHS+    NGEV +P  KDKN +  QKREKQ+ +  GLLKRK+ +        +   V K+ ++  VVD+G PADWVKINVQ+T+DCFEVYALVPGL+REEVRVQSDPAGRLVISGEPE+P NPWG TPFKKVV+LP+RIDPH TSAVVTL+GQLFVRVP EQ
Sbjct:  369 DEGMITVDAEPTEDMKLD---VPDSKLVTDTTVDSTNNKDAHVEANTE-------------RQDNSSALVLNDANNESAPVKRV---PGPYVAS---SNIKSEARGSGDLNNGVHKI-VRTPPVFDGTMRAKRSFLLDDA--SDGNESGTEEDQSAFMKELDSFFRERNMDFKPPKFYGEGLNCLKLWRAVTRLGGYDKVTGSKLWRQVGESFRPPKTCTTVSWTFRGFYEKALLEYERHKVSEGELQIPLPLELEPMNIDNQASGSGRARRDAASRAMQGWHSQRLNGNGEVSDPAIKDKNLVLHQKREKQIGTTPGLLKRKRAAEHGA---KNAIHVSKSMLDVTVVDVGPPADWVKINVQRTQDCFEVYALVPGLVREEVRVQSDPAGRLVISGEPENPMNPWGATPFKKVVSLPTRIDPHHTSAVVTLNGQLFVRVPLEQ 784          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy Swiss-Prot
Match: ARID5_ARATH (AT-rich interactive domain-containing protein 5 OS=Arabidopsis thaliana GN=ARID5 PE=1 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 4.550e-120
Identity = 195/315 (61.90%), Postives = 239/315 (75.87%), Query Frame = -2
Query:  334 SFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIPISSQSEAMNVD-----NQASGSGXXXXXXXXXXXRGWHS-RHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQ 1260
            ++ L D    + +E+G  ++Q  F+K++E F KE  +EFK PKFYG+ LNCLKLWRAV KLGGYD VT+ KLWRQVGESF PPKTCTTVSWTFR FYEKALL+YE+H  + GELN+P S+   +  ++     +QASGSGR RRDAAARAM+GWHS R   +GEV EPI K+K   S  K +K LK++G+ K+K  + +D        K   A V    +D+G PADWVKINV++TKDCFE++ALVPGLLREEVRVQSDPAGRLVI+G+PE  DNPWG+TPFKKVVN P+RIDP  TSAVV+LHG+LFVRVPFEQ
Sbjct:  125 TWLLSDAEAREVDEAGAPQDQEAFIKEVEAFNKENFLEFKAPKFYGQPLNCLKLWRAVIKLGGYDVVTTSKLWRQVGESFHPPKTCTTVSWTFRIFYEKALLEYEKHLRQNGELNLPGSASLPSSGIEKEASSHQASGSGRTRRDAAARAMQGWHSQRLLGSGEVTEPIVKEKGLNSTPK-QKNLKNIGVQKQKTTTGMDLVFSHESEKQSTAEV----IDVGPPADWVKINVRETKDCFEIFALVPGLLREEVRVQSDPAGRLVIAGQPEQLDNPWGITPFKKVVNFPARIDPLHTSAVVSLHGRLFVRVPFEQ 434          
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy Swiss-Prot
Match: ARID6_ARATH (AT-rich interactive domain-containing protein 6 OS=Arabidopsis thaliana GN=ARID6 PE=2 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 1.556e-111
Identity = 187/332 (56.33%), Postives = 240/332 (72.29%), Query Frame = -2
Query:  334 KTELPTTPVNGNNNSELSFFLDDIHFSDGNESGTEEEQSVFMKQLEIFFKERGMEFKPPKFYGEGLNCLKLWRAVTKLGGYDKVTSCKLWRQVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELNIP-----ISSQSEAMNVDNQASGSGXXXXXXXXXXXRGWHS-RHFRNGEVCEPITKDKNFISQQKREKQLKSLGLLKRKKPSYLDCAVKASCTKVLKAHVETAVVDIGSPADWVKINVQKTKDCFEVYALVPGLLREEVRVQSDPAGRLVISGEPEHPDNPWGVTPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRVPFEQ 1311
            + ++ +    G N  +   +L D      +E+GT  EQ  F++++E F+KE  +EFKPPKFYG+ LN LKLWRAV  LGGY+ VT+ KLWRQVGESF PPKTCTTVS+TFR FYEKALL+YE+     GELN+P     +SS  E     +Q SGSGRARRD+AARAM+GWH+ R   +GEV  P  KDK  IS  K  K+LKS+GL K K+ + +D  V     K L A     VVD+G  ADWVKINV+++KD FE++ALVPGLLR+EVR+QSDPAG++VI+G+PE  DNPWG+TPFKK+V+L +RIDP  TSAV+++HG+LF+RVPFEQ
Sbjct:   72 RVQMLSPKTEGENAKKRKTWLLDSEAQGTDEAGTPVEQVAFLREVEAFYKESFLEFKPPKFYGQPLNILKLWRAVVNLGGYEVVTTNKLWRQVGESFNPPKTCTTVSYTFRNFYEKALLEYEKCLRNNGELNLPGSTLILSSSVEKEPSSHQGSGSGRARRDSAARAMQGWHAQRLVGSGEVTAPAVKDKGLISTPKH-KKLKSIGLQKHKQQTSMDHVVTNEADKQLAAE----VVDVGPVADWVKINVKESKDSFEIFALVPGLLRKEVRIQSDPAGKVVITGQPEQLDNPWGITPFKKIVDLSARIDPLHTSAVMSMHGRLFIRVPFEQ 398          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2NU36_GOSRA0.000e+096.06Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MJU6_GOSAR0.000e+096.62AT-rich interactive domain-containing 3-like prote... [more]
A0A0D2QKM9_GOSRA0.000e+094.64Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2NU39_GOSRA0.000e+094.88Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QKM1_GOSRA0.000e+094.95Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QDF0_GOSRA0.000e+095.33Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RE39_GOSRA0.000e+095.53Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2MH95_GOSRA0.000e+095.36Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QDF3_GOSRA2.819e-890.47Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061DFY7_THECC0.000e+073.23ARID/BRIGHT DNA-binding domain-containing protein,... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0014616 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ARID3_ARATH3.841e-15358.56AT-rich interactive domain-containing protein 3 OS... [more]
ARID5_ARATH4.550e-12061.90AT-rich interactive domain-containing protein 5 OS... [more]
ARID6_ARATH1.556e-11156.33AT-rich interactive domain-containing protein 6 OS... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM01014ARID_2coord: 238..328
e-value: 2.6E-25
score: 100.1
NoneNo IPR availablePANTHERPTHR15348:SF6AT-RICH INTERACTIVE DOMAIN-CONTAINING PROTEIN 5-RELATEDcoord: 212..532
NoneNo IPR availablePANTHERPTHR15348AT-RICH INTERACTIVE DOMAIN-CONTAINING PROTEIN ARID DOMAIN- CONTAINING PROTEIN DEAD RINGER PROTEIN B-CELL REGULATOR OF IGH TRANSCRIPTION BRIGHTcoord: 212..532
IPR001606ARID DNA-binding domainSMARTSM00501bright_3coord: 242..333
e-value: 7.1E-33
score: 125.2
IPR001606ARID DNA-binding domainGENE3D1.10.150.60coord: 237..345
e-value: 3.4E-30
score: 103.7
IPR001606ARID DNA-binding domainPFAMPF01388ARIDcoord: 244..328
e-value: 1.3E-17
score: 64.0
IPR001606ARID DNA-binding domainPROSITEPS51011ARIDcoord: 241..332
score: 24.813
IPR001606ARID DNA-binding domainSUPERFAMILY46774ARID-likecoord: 236..338
IPR008978HSP20-like chaperoneGENE3D2.60.40.790coord: 446..530
e-value: 5.4E-7
score: 28.9
IPR008978HSP20-like chaperoneSUPERFAMILY49764HSP20-like chaperonescoord: 443..530
IPR002068Alpha crystallin/Hsp20 domainPFAMPF00011HSP20coord: 451..530
e-value: 1.5E-5
score: 24.9
IPR002068Alpha crystallin/Hsp20 domainPROSITEPS01031HSP20coord: 449..530
score: 11.269

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0014616 ID=g.arboreum_cottongen_reftransV1_0014616|Name=g.arboreum_cottongen_reftransV1_0014616|organism=Gossypium arboreum|type=contig|length=2068bp
TTTTTATATAGATTACCTCTTGTTATAGATATACCGTGGTTACTTGTCCA
TTACAATCAAACACATAGGAGCGTCATGTCAATTTGACAATGGAATTTTG
TCAATGAGGGGTTAATCCTATTCTCAACAGACGTCTCAAATTCCGTGACT
CAGAGGCACCTAAGATCATAATATCTGTATCTCATATAATGTAAACTATA
AAGAGGGCTTCAACTAAATGACGACATAAGTGAAACTACACTACTTTGAA
AACGAGAATAAACACTACATGGACGGACGCACAAATAAGCCACTGGCTTT
CAATCATCCACACCTTACCCCCACTACTCAGCTTTGCTCAAATGGAACAC
GTACAAACAACTGTCCATGAAGGGTTACAACCGCTGATGTCTGATGTGGA
TCAATCCTCGAGGGCAAGTTGACAACCTTTTTGAATGGTGTGACACCCCA
AGGATTATCTGGATGCTCAGGTTCACCGCTTATTACCAGGCGTCCTGCAG
GATCAGATTGAACACGCACCTCCTCACGAAGAAGGCCTGGAACTAAAGCA
TAGACCTCAAAACAATCTTTAGTTTTCTGCACATTGATCTTAACCCAATC
TGCTGGGGATCCAATATCAACCACTGCTGTCTCCACATGTGCCTTCAATA
CTTTAGTACATGAAGCCTTGACAGCACAGTCCAAATACGACGGTTTCTTG
CGTTTAAGCAGGCCCAGGCTTTTAAGCTGTTTCTCACGCTTTTGTTGAGA
AATAAAATTCTTATCCTTAGTTATTGGTTCACAGACTTCACCATTACGAA
AATGACGTGAGTGCCAACCCCTCATAGCACGTGCTGCTGCATCCCTTCGT
GCTCTACCAGATCCTGAAGCCTGATTATCAACATTCATAGCCTCTGATTG
CGATGAAATAGGTATATTAAGCTCACCCCCACGAGTCTTATGCCTTTCAT
AATCAAGGAGTGCCTTCTCATAGAAACCACGAAATGTCCATGAAACAGTA
GTACAGGTCTTTGGGGGCTTGAAAGATTCTCCAACTTGCCGCCACAATTT
ACATGAAGTTACCTTGTCATAGCCACCCAATTTAGTAACAGCTCTCCACA
ACTTAAGGCAATTCAGCCCTTCCCCATAAAATTTAGGAGGCTTAAATTCC
ATGCCTCTCTCTTTGAAGAAAATTTCCAGTTGCTTCATGAAGACTGATTG
CTCCTCTTCTGTTCCTGACTCATTGCCATCGGAAAAATGAATGTCATCCA
AAAAAAATGAGAGCTCAGAATTGTTGTTCCCATTAACAGGGGTTGTAGGC
AACTCCGTTTTATTATCCCCATTCTTCAAATCTTCCACTTTCTCCTTCAG
TAGTTCCATATCAGAAAATAATGGAGAAGGGGTAAGTGGCTCAGGTTCAT
CAAGGCAAGTTGGTATGGGGTTACAATCATAATTCGTTTTGCTTTGAGTT
AATGCAGAAGAAGTTTCAGTTTTGGCATTTTCTGTGAGTTTAGGAGGTGA
GACAGAAGAGGTTTCGGTTTTGACATCAGTTGTAGCTTCAGCAGCCAGAA
TATGATCGGAGGTAGAATCAGTGTGGGTCTTGAAATGAAAAATAAAAGAC
GATTCAGATTTCACATTGCTTGTGGTTTCTATATCAGGCTTCAGTGACGA
TTGATCATTGGATACACGAAGTAAGCACGTTGAGTGGTGAGCTGGAGTAG
AATGTGGTTGTATGTTGCTATCAGCATTGGCATGCCCTGTGTGATAGGTT
ATGGAGTTAGCCGCCATGGGCACGGGGGAAGGGGAGGGGGAAGGAGAGGA
AGGATGTTGCTGAAGCGGTGGACTAACAGGACGATCTCCATCGTTCAAGT
TAGAAGCACCTAATACTGGAACAACTAGTTCGCGCTCCTTGTTTTCATTT
TCCTTGGTGTCAGTTATCTCGAATTCCATTAATGAAAGGTTGAAAACTCC
TCCTGCTCCGTAGCTTGCTTAGGAAAATGACGATGAAGAAGGAATCTTGA
ATCCAAATCTAATTAAACCCTAATTATCTTGTGTATCCACAGAGAGCAAC
ACAACAAAACAGAATCTG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR001606ARID_dom
IPR008978HSP20-like_chaperone
IPR002068A-crystallin/Hsp20_dom
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding