g.arboreum_cottongen_reftransV1_0015326, g.arboreum_cottongen_reftransV1_0015326 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0015326
Unique Nameg.arboreum_cottongen_reftransV1_0015326
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length775
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr11chromosomeg.arboreum_cottongen_reftransV1_0015326:1..775 .
Chr11:78233689..78234463 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: A0A0B0PVA0_GOSAR (Far1-related sequence 11-like protein OS=Gossypium arboreum GN=F383_04683 PE=4 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 4.385e-116
Identity = 173/173 (100.00%), Postives = 173/173 (100.00%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL
Sbjct:  508 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 680          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: A0A0D2NQT8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G118900 PE=4 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 3.657e-109
Identity = 168/180 (93.33%), Postives = 170/180 (94.44%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDD-------GFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDD       GFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKL QS+SSDH ERIQL QSMVSTLVTESAKSKERLDIATE+VSILLSRIREQPVASQGARDISPIHRNL
Sbjct:  508 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLLQSTSSDHTERIQLLQSMVSTLVTESAKSKERLDIATEEVSILLSRIREQPVASQGARDISPIHRNL 687          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: A0A061GZJ8_THECC (FAR1-related sequence 11 OS=Theobroma cacao GN=TCM_041141 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 4.425e-104
Identity = 157/173 (90.75%), Postives = 162/173 (93.64%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHAAS+LTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVP+EGIISCSCHQFEFSGILCRHALRVLSTGNCFQIP+RYLPLRWRR  TSPAKL  SS +D  ERIQL QSMVS+LV ESAKSKERLDIATEQVSILLSRIREQPV SQG RDISPIHRNL
Sbjct:  486 ESHAASILTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPQEGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPERYLPLRWRRFCTSPAKLLHSSPTDQTERIQLLQSMVSSLVAESAKSKERLDIATEQVSILLSRIREQPVTSQGVRDISPIHRNL 658          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: A0A0A0KIN5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G003620 PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.247e-102
Identity = 144/173 (83.24%), Postives = 158/173 (91.33%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHAA++LTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTK +GGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPD YLP+RWRRIS   AKL  S+++DH ERIQL QSMV+ LVTESAKS+ERLDIATEQVS+LLSR+RE P +  G+RD+S IHRNL
Sbjct:   42 ESHAATILTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKTDGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDSYLPIRWRRISMPSAKLLPSTTNDHAERIQLLQSMVTNLVTESAKSRERLDIATEQVSLLLSRVREHPTSLPGSRDVSTIHRNL 214          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: F6HK24_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_12s0035g01390 PE=4 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 2.443e-101
Identity = 145/173 (83.82%), Postives = 159/173 (91.91%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHAA++LTP+AF+KLQ+Q+V A HYASF M+DGFLVRHHTKLEGGRKVYWVPREGIISCSCHQF+FSGILCRHALRVLSTGNCFQIP+RYLP+RWRRISTS  KL Q+  SDH E++QL QSMVSTLVTESAKSKERLD ATEQVSILLSRIREQPV+ QG RDI PIHRNL
Sbjct:   82 ESHAATILTPYAFTKLQDQIVYATHYASFPMEDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFDFSGILCRHALRVLSTGNCFQIPERYLPVRWRRISTSSTKLFQTIPSDHAEKVQLLQSMVSTLVTESAKSKERLDTATEQVSILLSRIREQPVSIQGTRDI-PIHRNL 253          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: A0A067LDA9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_00282 PE=4 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 7.966e-99
Identity = 148/173 (85.55%), Postives = 161/173 (93.06%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHA SVLTP+AFSKLQEQLVLAAHYASFQM+DGFLVRHHTKL+GGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIP+RYLP+RWRRISTSPAKL  +S +DH ER+QL Q+MVSTLV E+AKSKERL+IATEQVSILLSRI+EQPV S G RDI+ IHRN 
Sbjct:  511 ESHALSVLTPYAFSKLQEQLVLAAHYASFQMEDGFLVRHHTKLDGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPERYLPIRWRRISTSPAKLPHTSPNDHGERMQLLQNMVSTLVNEAAKSKERLEIATEQVSILLSRIKEQPVPSHGMRDITSIHRNF 683          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: B9SS96_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0619330 PE=4 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 3.254e-98
Identity = 147/173 (84.97%), Postives = 161/173 (93.06%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHAASVLTP+AFSKLQEQLVLAAHYASFQM+DGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIP+RYLP+RWRRISTSP KL  S+ + H ER+QL Q+MVSTL+ ESAKSKERL+IAT+Q+SIL+SRIREQPV SQG RDI+ IHR L
Sbjct:  512 ESHAASVLTPYAFSKLQEQLVLAAHYASFQMEDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPERYLPIRWRRISTSPGKLLHSAPNGHGERMQLLQNMVSTLINESAKSKERLEIATDQLSILISRIREQPVPSQGVRDIASIHRKL 684          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: A0A067DVB7_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g047253mg PE=4 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 7.069e-97
Identity = 146/173 (84.39%), Postives = 157/173 (90.75%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHAASVLTPFAFSKLQEQLVLAAHYASF  +DGFLVRHHTKLEGGRKVYW P+EGIISCSCHQFEFSGILCRH LRVLSTGNCFQIP+RYLPLRWR+IST   KL QSS SDH ERIQ  QSMVS+L+ ES KSKERLD+ATEQVS LLSRIR+QPV++QG RDISP+HRNL
Sbjct:  507 ESHAASVLTPFAFSKLQEQLVLAAHYASFPFEDGFLVRHHTKLEGGRKVYWAPQEGIISCSCHQFEFSGILCRHTLRVLSTGNCFQIPERYLPLRWRKISTHSVKLLQSSPSDHAERIQFLQSMVSSLIAESVKSKERLDLATEQVSYLLSRIRQQPVSTQGLRDISPLHRNL 679          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: V4UZ79_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10000456mg PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 9.336e-97
Identity = 146/173 (84.39%), Postives = 157/173 (90.75%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHAASVLTPFAFSKLQEQLVLAAHYASF  +DGFLVRHHTKLEGGRKVYW P+EGIISCSCHQFEFSGILCRH LRVLSTGNCFQIP+RYLPLRWR+IST   KL QSS SDH ERIQ  QSMVS+L+ ES KSKERLD+ATEQVS LLSRIR+QPV++QG RDISP+HRNL
Sbjct:  508 ESHAASVLTPFAFSKLQEQLVLAAHYASFPFEDGFLVRHHTKLEGGRKVYWAPQEGIISCSCHQFEFSGILCRHTLRVLSTGNCFQIPERYLPLRWRKISTHSVKLLQSSPSDHAERIQFLQSMVSSLIAESVKSKERLDLATEQVSYLLSRIRQQPVSTQGLRDISPLHRNL 680          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Match: V4SB21_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10000456mg PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.437e-96
Identity = 146/173 (84.39%), Postives = 157/173 (90.75%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            ESHAASVLTPFAFSKLQEQLVLAAHYASF  +DGFLVRHHTKLEGGRKVYW P+EGIISCSCHQFEFSGILCRH LRVLSTGNCFQIP+RYLPLRWR+IST   KL QSS SDH ERIQ  QSMVS+L+ ES KSKERLD+ATEQVS LLSRIR+QPV++QG RDISP+HRNL
Sbjct:  530 ESHAASVLTPFAFSKLQEQLVLAAHYASFPFEDGFLVRHHTKLEGGRKVYWAPQEGIISCSCHQFEFSGILCRHTLRVLSTGNCFQIPERYLPLRWRKISTHSVKLLQSSPSDHAERIQFLQSMVSSLIAESVKSKERLDLATEQVSYLLSRIRQQPVSTQGLRDISPLHRNL 702          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy Swiss-Prot
Match: FRS11_ARATH (Protein FAR1-RELATED SEQUENCE 11 OS=Arabidopsis thaliana GN=FRS11 PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 1.559e-93
Identity = 142/174 (81.61%), Postives = 157/174 (90.23%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDGFLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDI-SPIHRNL 773
            ESHAASVLTPFAFSKLQEQLVLAAHYASFQMD+G+LVRHHTKL+GGRKVYWVP+EGIISCSC  FEFSG LCRHALRVLSTGNCFQ+PDRYLPLRWRRISTS +K  +S++ DH ER+QL Q++VSTLV+ESAKSKERLDIATEQ SILLSRIREQPV+S   RDI S + RN 
Sbjct:  507 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDEGYLVRHHTKLDGGRKVYWVPQEGIISCSCQLFEFSGFLCRHALRVLSTGNCFQVPDRYLPLRWRRISTSFSKTFRSNAEDHGERVQLLQNLVSTLVSESAKSKERLDIATEQTSILLSRIREQPVSSLAIRDISSSVQRNF 680          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy Swiss-Prot
Match: FRS10_ARATH (Putative protein FAR1-RELATED SEQUENCE 10 OS=Arabidopsis thaliana GN=FRS10 PE=2 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 2.568e-40
Identity = 75/161 (46.58%), Postives = 103/161 (63.98%), Query Frame = -3
Query:  294 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMDDG-FLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVAS 773
            E HA  +LTP+AFS LQ ++VL+  YA  +M +G F+V H+ K+EG   V W P    I CSC +FE SGILCRH LRVL+  NCF IP++Y  LRWR+ S   A  +Q+      +  Q F S+  TL+TES  SK+RLD A +++S+L+ R+R    A+
Sbjct:  520 EDHARGILTPYAFSVLQNEMVLSVQYAVAEMANGPFIVHHYKKMEGECCVIWNPENEEIQCSCKEFEHSGILCRHTLRVLTVKNCFHIPEQYFLLRWRQESPHVATENQNGQGIGDDSAQTFHSLTETLLTESMISKDRLDYANQELSLLIDRVRNTAPAN 680          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy Swiss-Prot
Match: FRS3_ARATH (Protein FAR1-RELATED SEQUENCE 3 OS=Arabidopsis thaliana GN=FRS3 PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.522e-13
Identity = 58/179 (32.40%), Postives = 81/179 (45.25%), Query Frame = -3
Query:  255 ESHAASVLTPFAFSKLQEQLVLA-AHYASFQMDDGFLVRHHT-KLEGGRKVYWVP---REGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQS-SSSDHMERIQLFQSMVSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGARDISPIHRNL 773
            E+ AA++ T   F K QE+LV   AH A+   DDG          E   K Y V     E   +CSC  FE SGILCRH L V +  N   +P  Y+  RW R + S  +L +  S + H   I  +      L  E+ K  E   I  E  +I L ++RE      G + +S + + +
Sbjct:  474 ENQAANLFTRKIFGKFQEELVETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRANCSCQMFEHSGILCRHVLTVFTVTNILTLPPHYILRRWTRNAKSMVELDEHVSENGHDSSIHRYNH----LCREAIKYAEEGAITAEAYNIALGQLRE------GGKKVSVVRKRI 642          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy Swiss-Prot
Match: FRS5_ARATH (Protein FAR1-RELATED SEQUENCE 5 OS=Arabidopsis thaliana GN=FRS5 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.529e-11
Identity = 51/154 (33.12%), Postives = 69/154 (44.81%), Query Frame = -3
Query:  348 ESHAASVLTPFAFSKLQEQLVLAAHY-ASFQMDDGFLVRHHTKLEG-GRKVYWVP---REGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPA-----KLHQSSS--SDHMERIQLFQSMVSTLVTESAKSKERLDIA 773
            E  A+ + T   F + QE+LV    + AS   DDG LV +     G   K ++V     E   +CSC  FEFSGI+CRH L V    N   +P  Y+  RW R + S        LH  ++    H  R    +   S  V E+ KS    D+A
Sbjct:  529 EKQASELYTRKLFMRFQEELVGTLTFMASKADDDGDLVTYQVAKYGEAHKAHFVKFNVLEMRANCSCQMFEFSGIICRHILAVFRVTNLLTLPPYYILKRWTRNAKSSVIFDDYNLHAYANYLESHTVRYNTLRHKASNFVQEAGKSLYTCDVA 682          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy Swiss-Prot
Match: FRS9_ARATH (Protein FAR1-RELATED SEQUENCE 9 OS=Arabidopsis thaliana GN=FRS9 PE=2 SV=2)

HSP 1 Score: 65.0846 bits (157), Expect = 8.981e-11
Identity = 54/174 (31.03%), Postives = 78/174 (44.83%), Query Frame = -3
Query:  282 ESHAASVLTPFAFSKLQEQLV-LAAHYASFQMDDG----FLVRHHTKLEGGRKVYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSSDH-MERIQL-FQSM---VSTLVTESAKSKERLDIATEQVSILLSRIREQPVASQGAR 773
            E  AAS+ T  AF K QE+ V   A  A+   D G    + V    ++  G  V +   E   +CSC  FE+SGI+CRH L V S  N   +P RYL  RW + +       Q   S+   E + L F S+    +  V E AKS +   +A + +     ++      + G R
Sbjct:  294 EKQAASLYTRAAFIKFQEEFVETLAIPANIISDSGTHTTYRVAKFGEVHKGHTVSFDSLEVKANCSCQMFEYSGIICRHILAVFSAKNVLALPSRYLLRRWTKEAKIRGTEEQPEFSNGCQESLNLCFNSLRQEATKYVEEGAKSIQIYKVAMDALDEAAKKVAAASNRTPGTR 467          
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy Swiss-Prot
Match: FRS6_ARATH (Protein FAR1-RELATED SEQUENCE 6 OS=Arabidopsis thaliana GN=FRS6 PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 3.129e-7
Identity = 48/175 (27.43%), Postives = 76/175 (43.43%), Query Frame = -3
Query:  315 ESHAASVLTPFAFSKLQEQLVLAAHYASFQMD----DG----FLVRHHTKLEGGRK------VYWVPREGIISCSCHQFEFSGILCRHALRVLSTGNCFQIPDRYLPLRWRRISTSPAKLHQSSSS-----DHMERIQLFQSMVST---LVTESAKSKERLDIATEQVSILLSRI 773
            E+  + + T   F K Q  + +   Y+ F       DG    FLV+   + E  R+      V +    G + C C  F F G LCRHAL VL+     +IP RY+  RWR+      +LH + +      D  +R+Q F  +      +V E A S +   +A + +   L ++
Sbjct:  526 ETQLSRIYTRDMFKKFQ--IEVEEMYSCFSTTQVHVDGPFVIFLVKERVRGESSRREIRDFEVLYNRSVGEVRCICSCFNFYGYLCRHALCVLNFNGVEEIPLRYILPRWRK---DYKRLHFADNGLTGFVDGTDRVQWFDQLYKNSLQVVEEGAVSLDHYKVAMQVLQESLDKV 695          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PVA0_GOSAR4.385e-116100.00Far1-related sequence 11-like protein OS=Gossypium... [more]
A0A0D2NQT8_GOSRA3.657e-10993.33Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GZJ8_THECC4.425e-10490.75FAR1-related sequence 11 OS=Theobroma cacao GN=TCM... [more]
A0A0A0KIN5_CUCSA1.247e-10283.24Uncharacterized protein OS=Cucumis sativus GN=Csa_... [more]
F6HK24_VITVI2.443e-10183.82Putative uncharacterized protein OS=Vitis vinifera... [more]
A0A067LDA9_JATCU7.966e-9985.55Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
B9SS96_RICCO3.254e-9884.97Putative uncharacterized protein OS=Ricinus commun... [more]
A0A067DVB7_CITSI7.069e-9784.39Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
V4UZ79_9ROSI9.336e-9784.39Uncharacterized protein OS=Citrus clementina GN=CI... [more]
V4SB21_9ROSI1.437e-9684.39Uncharacterized protein OS=Citrus clementina GN=CI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0015326 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
FRS11_ARATH1.559e-9381.61Protein FAR1-RELATED SEQUENCE 11 OS=Arabidopsis th... [more]
FRS10_ARATH2.568e-4046.58Putative protein FAR1-RELATED SEQUENCE 10 OS=Arabi... [more]
FRS3_ARATH1.522e-1332.40Protein FAR1-RELATED SEQUENCE 3 OS=Arabidopsis tha... [more]
FRS5_ARATH2.529e-1133.12Protein FAR1-RELATED SEQUENCE 5 OS=Arabidopsis tha... [more]
FRS9_ARATH8.981e-1131.03Protein FAR1-RELATED SEQUENCE 9 OS=Arabidopsis tha... [more]
FRS6_ARATH3.129e-727.43Protein FAR1-RELATED SEQUENCE 6 OS=Arabidopsis tha... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006564Zinc finger, PMZ-typeSMARTSM0057526again6coord: 28..55
e-value: 4.2E-6
score: 36.3
IPR007527Zinc finger, SWIM-typePFAMPF04434SWIMcoord: 23..51
e-value: 3.1E-8
score: 33.0
IPR007527Zinc finger, SWIM-typePROSITEPS50966ZF_SWIMcoord: 20..53
score: 9.705
IPR031052FHY3/FAR1 familyPANTHERPTHR31669FAMILY NOT NAMEDcoord: 9..139
NoneNo IPR availablePANTHERPTHR31669:SF34PROTEIN FAR1-RELATED SEQUENCE 11coord: 9..139

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0015326 ID=g.arboreum_cottongen_reftransV1_0015326|Name=g.arboreum_cottongen_reftransV1_0015326|organism=Gossypium arboreum|type=contig|length=775bp
ATTTAGAAATCATCAAGAACATATCCTCCCCTTCCCTCCACCAAAGTCTA
GGTACTGAAAACAAGCATTGACAGGAACGGACAAAACGATGCCTATTGAG
TGCAACTTATGTACTTTGATTCCATAACTACAAAATTACTATGCAAATGC
CGAATCCTTCATCGACTCTTGCATTTCTAACCTCAACAGTGATTTTTTTT
CCTCTCCTCCAAATTTCTTATATTGCCTTCTGCACTAATTGCTTAAGATT
TTCAAAGATTTCTATGAATAGGGGAAATATCCCGCGCACCTTGTGATGCA
ACTGGCTGCTCTCTTATGCGAGACAAAAGAATGGAGACTTGCTCGGTGGC
AATATCCAACCTCTCCTTTGACTTGGCAGATTCAGTTACAAGGGTTGATA
CCATACTCTGAAACAGTTGAATCCGCTCCATATGATCACTTGAAGAACTT
TGGTGAAGCTTTGCCGGTGATGTGCTGATCCTTCTCCACCGTAAGGGAAG
ATATCTGTCTGGAATCTGAAAGCAATTTCCTGTCGAGAGAACTCGAAGGG
CATGGCGGCAAAGAATTCCGGAGAACTCAAACTGATGGCAGCTGCAACTT
ATAATGCCTTCTCGTGGAACCCAATACACTTTCCGGCCTCCTTCGAGTTT
TGTATGATGTCTTACGAGGAAACCATCATCCATCTGAAATGATGCATAGT
GAGCAGCTAAAACTAGTTGCTCTTGAAGCTTGGAGAAGGCAAAAGGAGTG
AGGACAGAGGCAGCATGAGATTCCA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR006564Znf_PMZ
IPR007527Znf_SWIM
IPR031052FHY3/FAR1
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-dependent